DOCSLIB.ORG

You Can Check If Genes Are Captured by the Agilent Sureselect V5 Exome

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
You Can Check If Genes Are Captured by the Agilent Sureselect V5 Exome IIHG Clinical Exome Sequencing Test Gene Coverage • Whole Exome Sequencing is a targeted capture platform which does not capture the entire exome. Regions not captured by the exome will not be analyzed. o Please note, it is important to understand the absence of a reportable variant in a given gene does not mean there are not pathogenic variants in that gene. • Data sensitivity and specificity for exome testing is variable as gene coverage is not uniform throughout the exome. • The Agilent SureSelect XT Human All Exon v5 kit captures ~98% of Refseq coding base pairs, and >94% of the captured coding bases in the exome are covered at our depth-of-coverage minimum threshold (30 reads). • All test reports include the following information: o Regions of the Symptom Candidate Gene List which were not captured by the current exome capture platform. o Regions of the Symptom Candidate Gene List which were not sequenced to a sufficient depth of coverage to make a clinical diagnosis. • You can check if genes are captured by the Agilent Agilent SureSelect v5 exome capture, and how well those genes are typically covered here. • Explanations for the headings; • Symbol: Gene symbol • Chr: Chromosome • % Captured: the minimum portion of the gene captured by the Agilent SureSelect XT Human All Exon v5 kit. This includes all transcripts for a given gene. o 100.00% = the entire gene is captured o 0.00% = none of the gene is captured • % Covered: the minimum portion of the gene that has at least 30x average coverage when sequenced on the Illumina HiSeq2000 with 100 base pair (bp) paired-end reads for eight CEPH samples. This is the result for a typical sample, but the minimum when considering all of the different isoforms for the given gene. • % High Quality: The minimum portion of the gene we would anticipate being captured and having 30x sequence coverage or greater. o For example, for the gene BAGE4, 94.26% of the gene is captured, 99.89% of the captured regions of the gene are covered by 30x sequencing depth, for a minimum of 94.15% of BAGE4 will be captured and sequenced to a depth required to make a clinical diagnosis. o Please note, these are minimum values, and any gene may be better covered than the values listed in this table. • Please contact us if you have any questions regarding gene capture and coverage metrics at [email protected]. Symbol Chr % Captured % Covered % High Quality A1BG chr19 100.00% 97.40% 97.40% A1BG-AS1 chr19 100.00% 99.63% 99.63% A1CF chr10 100.00% 99.55% 99.55% A2M chr12 100.00% 96.69% 96.69% A2M-AS1 chr12 100.00% 99.95% 99.95% A2ML1 chr12 100.00% 94.48% 94.48% A2MP1 chr12 100.00% 100.00% 100.00% A3GALT2 chr1 100.00% 98.14% 98.14% A4GALT chr22 100.00% 99.81% 99.81% A4GNT chr3 100.00% 97.17% 97.17% AA06 chr17 100.00% 100.00% 100.00% AAAS chr12 100.00% 97.45% 97.45% AACS chr12 100.00% 98.54% 98.54% AACSP1 chr5 100.00% 100.00% 100.00% AADAC chr3 100.00% 98.79% 98.79% AADACL2 chr3 100.00% 99.48% 99.48% AADACL3 chr1 100.00% 99.63% 99.63% AADACL4 chr1 100.00% 98.76% 98.76% AADACP1 chr3 100.00% 100.00% 100.00% AADAT chr4 100.00% 95.73% 95.73% AAED1 chr9 100.00% 76.58% 76.58% AAGAB chr15 100.00% 98.52% 98.52% AAK1 chr2 100.00% 99.36% 99.36% AAMDC chr11 100.00% 98.53% 98.53% AAMP chr2 100.00% 98.63% 98.63% AANAT chr17 100.00% 88.37% 88.37% AAR2 chr20 100.00% 99.05% 99.05% AARD chr8 100.00% 98.12% 98.12% AARS chr16 100.00% 98.28% 98.28% AARS2 chr6 100.00% 97.64% 97.64% AARSD1 chr17 100.00% 97.24% 97.24% AASDH chr4 100.00% 98.22% 98.22% AASDHPPT chr11 100.00% 99.04% 99.04% AASS chr7 100.00% 98.87% 98.87% AATF chr17 100.00% 98.54% 98.54% AATK chr17 100.00% 94.42% 94.42% AATK-AS1 chr17 100.00% 100.00% 100.00% ABAT chr16 100.00% 98.67% 98.67% ABCA1 chr9 100.00% 95.84% 95.84% ABCA10 chr17 100.00% 94.92% 94.92% ABCA11P chr4 100.00% 99.95% 99.95% ABCA12 chr2 100.00% 97.25% 97.25% ABCA13 chr7 100.00% 98.03% 98.03% ABCA17P chr16 100.00% 100.00% 100.00% ABCA2 chr9 100.00% 96.71% 96.71% ABCA3 chr16 100.00% 95.73% 95.73% ABCA4 chr1 100.00% 96.86% 96.86% ABCA5 chr17 100.00% 97.06% 97.06% ABCA6 chr17 100.00% 92.82% 92.82% ABCA7 chr19 100.00% 96.31% 96.31% ABCA8 chr17 100.00% 96.03% 96.03% ABCA9 chr17 100.00% 97.09% 97.09% ABCB1 chr7 100.00% 97.40% 97.40% ABCB10 chr1 100.00% 81.69% 81.69% ABCB11 chr2 100.00% 97.59% 97.59% ABCB4 chr7 100.00% 95.85% 95.85% ABCB5 chr7 100.00% 97.98% 97.98% ABCB6 chr2 100.00% 98.16% 98.16% ABCB7 chrX 100.00% 94.01% 94.01% ABCB8 chr7 100.00% 98.96% 98.96% ABCB9 chr12 100.00% 97.46% 97.46% ABCC1 chr16 100.00% 96.41% 96.41% ABCC10 chr6 100.00% 96.17% 96.17% ABCC11 chr16 100.00% 96.76% 96.76% ABCC12 chr16 100.00% 97.31% 97.31% ABCC13 chr21 100.00% 100.00% 100.00% ABCC2 chr10 100.00% 98.08% 98.08% ABCC3 chr17 100.00% 95.51% 95.51% ABCC4 chr13 100.00% 96.21% 96.21% ABCC5 chr3 100.00% 98.19% 98.19% ABCC5-AS1 chr3 100.00% 100.00% 100.00% ABCC6 chr16 94.64% 95.95% 90.58% ABCC6P1 chr16 100.00% 100.00% 100.00% ABCC6P2 chr16 100.00% 100.00% 100.00% ABCC8 chr11 100.00% 96.05% 96.05% ABCC9 chr12 100.00% 97.76% 97.76% ABCD1 chrX 93.86% 81.03% 74.89% ABCD2 chr12 100.00% 99.43% 99.43% ABCD3 chr1 100.00% 90.26% 90.26% ABCD4 chr14 100.00% 97.31% 97.31% ABCE1 chr4 100.00% 87.28% 87.28% ABCF1 chr6 100.00% 96.94% 96.94% ABCF2 chr7 100.00% 97.92% 97.92% ABCF3 chr3 100.00% 97.84% 97.84% ABCG1 chr21 100.00% 96.78% 95.77% ABCG2 chr4 100.00% 98.26% 98.26% ABCG4 chr11 100.00% 98.91% 98.91% ABCG5 chr2 100.00% 98.61% 98.61% ABCG8 chr2 100.00% 94.96% 94.96% ABHD1 chr2 100.00% 98.83% 98.83% ABHD10 chr3 100.00% 99.62% 99.62% ABHD11 chr7 100.00% 98.23% 98.23% ABHD11-AS1 chr7 100.00% 100.00% 100.00% ABHD12 chr20 100.00% 88.30% 88.30% ABHD12B chr14 100.00% 90.49% 90.49% ABHD13 chr13 100.00% 99.96% 99.96% ABHD14A chr3 100.00% 92.49% 92.49% ABHD14A-ACY1 chr3 100.00% 91.70% 91.70% ABHD14B chr3 100.00% 97.94% 97.94% ABHD15 chr17 100.00% 96.50% 96.50% ABHD16A chr6 100.00% 94.84% 94.84% ABHD16B chr20 100.00% 99.83% 99.83% ABHD17A chr19 79.42% 64.60% 44.02% ABHD17B chr9 100.00% 99.64% 99.64% ABHD17C chr15 100.00% 88.70% 88.70% ABHD2 chr15 100.00% 99.53% 99.53% ABHD3 chr18 100.00% 98.93% 98.93% ABHD4 chr14 100.00% 99.11% 99.11% ABHD5 chr3 100.00% 99.72% 99.72% ABHD6 chr3 100.00% 96.94% 96.94% ABHD8 chr19 100.00% 98.36% 98.36% ABI1 chr10 100.00% 98.80% 98.80% ABI2 chr2 100.00% 99.33% 99.33% ABI3 chr17 100.00% 93.56% 93.56% ABI3BP chr3 100.00% 96.16% 96.16% ABL1 chr9 100.00% 99.35% 99.35% ABL2 chr1 100.00% 91.21% 91.21% ABLIM1 chr10 100.00% 99.23% 99.23% ABLIM2 chr4 100.00% 97.94% 97.94% ABLIM3 chr5 100.00% 98.36% 98.36% ABO chr9 100.00% 98.00% 98.00% ABR chr17 100.00% 95.16% 95.16% ABRA chr8 100.00% 99.71% 99.71% ABRACL chr6 100.00% 99.66% 99.66% ABT1 chr6 100.00% 98.87% 98.87% ABTB1 chr3 100.00% 96.37% 96.37% ABTB2 chr11 100.00% 96.22% 96.22% ACAA1 chr3 100.00% 92.62% 92.62% ACAA2 chr18 100.00% 70.01% 70.01% ACACA chr17 100.00% 97.91% 97.91% ACACB chr12 100.00% 96.59% 96.59% ACAD10 chr12 100.00% 97.71% 97.71% ACAD11 chr3 100.00% 98.19% 98.19% ACAD8 chr11 100.00% 98.62% 98.62% ACAD9 chr3 100.00% 97.06% 97.06% ACADL chr2 100.00% 94.42% 94.42% ACADM chr1 100.00% 94.68% 94.68% ACADS chr12 100.00% 97.77% 97.77% ACADSB chr10 100.00% 97.75% 97.75% ACADVL chr17 100.00% 95.28% 95.28% ACAN chr15 100.00% 97.48% 97.48% ACAP1 chr17 100.00% 96.92% 96.92% ACAP2 chr3 100.00% 98.74% 98.74% ACAP3 chr1 100.00% 95.05% 95.05% ACAT1 chr11 100.00% 97.96% 97.96% ACAT2 chr6 100.00% 98.48% 98.48% ACBD3 chr1 100.00% 99.34% 99.34% ACBD4 chr17 100.00% 94.81% 94.81% ACBD5 chr10 100.00% 98.42% 98.42% ACBD6 chr1 100.00% 97.29% 97.29% ACBD7 chr10 100.00% 99.53% 99.53% ACCS chr11 100.00% 92.35% 92.35% ACCSL chr11 100.00% 97.50% 97.50% ACD chr16 100.00% 97.39% 97.39% ACE chr17 100.00% 93.68% 93.68% ACE2 chrX 100.00% 97.65% 97.65% ACER1 chr19 100.00% 98.87% 98.87% ACER2 chr9 100.00% 99.24% 99.24% ACER3 chr11 100.00% 95.49% 95.49% ACHE chr7 100.00% 90.82% 90.82% ACIN1 chr14 100.00% 97.58% 97.58% ACKR1 chr1 100.00% 99.84% 99.84% ACKR2 chr3 100.00% 99.90% 99.90% ACKR3 chr2 100.00% 99.72% 99.72% ACKR4 chr3 100.00% 99.96% 99.96% ACLY chr17 100.00% 97.35% 97.35% ACMSD chr2 100.00% 97.11% 97.11% ACN9 chr7 100.00% 99.90% 99.90% ACO1 chr9 100.00% 98.54% 98.54% ACO2 chr22 100.00% 84.08% 84.08% ACOT1 chr14 100.00% 57.44% 57.44% ACOT11 chr1 100.00% 88.88% 88.88% ACOT12 chr5 100.00% 91.63% 91.63% ACOT13 chr6 100.00% 99.85% 99.85% ACOT2 chr14 100.00% 92.59% 92.59% ACOT4 chr14 100.00% 91.88% 91.88% ACOT6 chr14 100.00% 99.41% 99.41% ACOT7 chr1 100.00% 96.57% 96.57% ACOT8 chr20 100.00% 98.05% 98.05% ACOT9 chrX 100.00% 96.40% 96.40% ACOX1 chr17 100.00% 99.50% 99.50% ACOX2 chr3 100.00% 96.18% 96.18% ACOX3 chr4 100.00% 97.68% 97.68% ACOXL chr2 100.00% 97.30% 97.30% ACP1 chr2 100.00% 90.88% 90.88% ACP2 chr11 100.00% 95.06% 95.06% ACP5 chr19 100.00% 96.52% 96.52% ACP6 chr1 100.00% 91.46% 91.46% ACPP chr3 100.00% 98.14% 98.14% ACPT chr19 100.00% 82.09% 82.09% ACR chr22 100.00% 90.49% 90.49% ACRBP chr12 100.00% 98.49% 98.49% ACRC chrX 100.00% 98.25% 98.25% ACRV1 chr11 100.00% 99.21% 99.21% ACSBG1 chr15 100.00% 97.75% 97.75% ACSBG2 chr19 100.00% 98.64% 98.64% ACSF2 chr17 100.00% 98.25% 98.25% ACSF3 chr16 100.00% 98.86% 98.86% ACSL1 chr4 100.00% 97.91% 97.91% ACSL3 chr2 100.00% 98.46% 98.46% ACSL4 chrX 100.00% 96.66% 96.66% ACSL5 chr10 100.00% 97.49% 97.49% ACSL6 chr5 100.00% 98.47% 98.47% ACSM1 chr16 100.00% 94.91% 94.91% ACSM2A chr16 100.00% 99.13% 99.13% ACSM2B chr16 100.00% 98.86% 98.86% ACSM3 chr16 100.00% 98.90% 98.90% ACSM4 chr12 100.00% 92.15% 92.15% ACSM5 chr16 100.00% 91.21% 91.21% ACSM6 chr10 100.00% 98.03% 98.03% ACSS1 chr20 100.00% 94.10% 94.10% ACSS2 chr20 100.00% 89.49% 89.49% ACSS3 chr12 100.00%
Load more

Recommended publications
  • (12) Patent Application Publication (10) Pub. No.: US 2015/0337275 A1 Pearlman Et Al
    US 20150337275A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2015/0337275 A1 Pearlman et al. (43) Pub. Date: Nov. 26, 2015 (54) BOCONVERSION PROCESS FOR Publication Classification PRODUCING NYLON-7, NYLON-7.7 AND POLYESTERS (51) Int. C. CI2N 9/10 (2006.01) (71) Applicant: INVISTATECHNOLOGIES S.a.r.l., CI2P 7/40 (2006.01) St. Gallen (CH) CI2PI3/00 (2006.01) CI2PI3/04 (2006.01) (72) Inventors: Paul S. Pearlman, Thornton, PA (US); CI2P 13/02 (2006.01) Changlin Chen, Cleveland (GB); CI2N 9/16 (2006.01) Adriana L. Botes, Cleveland (GB); Alex CI2N 9/02 (2006.01) Van Eck Conradie, Cleveland (GB); CI2N 9/00 (2006.01) Benjamin D. Herzog, Wichita, KS (US) CI2P 7/44 (2006.01) CI2P I 7/10 (2006.01) (73) Assignee: INVISTATECHNOLOGIES S.a.r.l., (52) U.S. C. St. Gallen (CH) CPC. CI2N 9/13 (2013.01); C12P 7/44 (2013.01); CI2P 7/40 (2013.01); CI2P 13/005 (2013.01); (21) Appl. No.: 14/367,484 CI2P 17/10 (2013.01); CI2P 13/02 (2013.01); CI2N 9/16 (2013.01); CI2N 9/0008 (2013.01); (22) PCT Fled: Dec. 21, 2012 CI2N 9/93 (2013.01); CI2P I3/04 (2013.01); PCT NO.: PCT/US2012/071.472 CI2P 13/001 (2013.01); C12Y 102/0105 (86) (2013.01) S371 (c)(1), (2) Date: Jun. 20, 2014 (57) ABSTRACT Embodiments of the present invention relate to methods for Related U.S. Application Data the biosynthesis of di- or trifunctional C7 alkanes in the (60) Provisional application No.
    [Show full text]
  • ASSESSING DIAGNOSTIC and THERAPEUTIC TARGETS in OBESITY- ASSOCIATED LIVER DISEASES Noemí Cabré Casares
    ASSESSING DIAGNOSTIC AND THERAPEUTIC TARGETS IN OBESITY- ASSOCIATED LIVER DISEASES Noemí Cabré Casares ADVERTIMENT. L'accés als continguts d'aquesta tesi doctoral i la seva utilització ha de respectar els drets de la persona autora. Pot ser utilitzada per a consulta o estudi personal, així com en activitats o materials d'investigació i docència en els termes establerts a l'art. 32 del Text Refós de la Llei de Propietat Intel·lectual (RDL 1/1996). Per altres utilitzacions es requereix l'autorització prèvia i expressa de la persona autora. En qualsevol cas, en la utilització dels seus continguts caldrà indicar de forma clara el nom i cognoms de la persona autora i el títol de la tesi doctoral. No s'autoritza la seva reproducció o altres formes d'explotació efectuades amb finalitats de lucre ni la seva comunicació pública des d'un lloc aliè al servei TDX. Tampoc s'autoritza la presentació del seu contingut en una finestra o marc aliè a TDX (framing). Aquesta reserva de drets afecta tant als continguts de la tesi com als seus resums i índexs. ADVERTENCIA. El acceso a los contenidos de esta tesis doctoral y su utilización debe respetar los derechos de la persona autora. Puede ser utilizada para consulta o estudio personal, así como en actividades o materiales de investigación y docencia en los términos establecidos en el art. 32 del Texto Refundido de la Ley de Propiedad Intelectual (RDL 1/1996). Para otros usos se requiere la autorización previa y expresa de la persona autora. En cualquier caso, en la utilización de sus contenidos se deberá indicar de forma clara el nombre y apellidos de la persona autora y el título de la tesis doctoral.
    [Show full text]
  • Implications in Parkinson's Disease
    Journal of Clinical Medicine Review Lysosomal Ceramide Metabolism Disorders: Implications in Parkinson’s Disease Silvia Paciotti 1,2 , Elisabetta Albi 3 , Lucilla Parnetti 1 and Tommaso Beccari 3,* 1 Laboratory of Clinical Neurochemistry, Department of Medicine, University of Perugia, Sant’Andrea delle Fratte, 06132 Perugia, Italy; [email protected] (S.P.); [email protected] (L.P.) 2 Section of Physiology and Biochemistry, Department of Experimental Medicine, University of Perugia, Sant’Andrea delle Fratte, 06132 Perugia, Italy 3 Department of Pharmaceutical Sciences, University of Perugia, Via Fabretti, 06123 Perugia, Italy; [email protected] * Correspondence: [email protected] Received: 29 January 2020; Accepted: 20 February 2020; Published: 21 February 2020 Abstract: Ceramides are a family of bioactive lipids belonging to the class of sphingolipids. Sphingolipidoses are a group of inherited genetic diseases characterized by the unmetabolized sphingolipids and the consequent reduction of ceramide pool in lysosomes. Sphingolipidoses include several disorders as Sandhoff disease, Fabry disease, Gaucher disease, metachromatic leukodystrophy, Krabbe disease, Niemann Pick disease, Farber disease, and GM2 gangliosidosis. In sphingolipidosis, lysosomal lipid storage occurs in both the central nervous system and visceral tissues, and central nervous system pathology is a common hallmark for all of them. Parkinson’s disease, the most common neurodegenerative movement disorder, is characterized by the accumulation and aggregation of misfolded α-synuclein that seem associated to some lysosomal disorders, in particular Gaucher disease. This review provides evidence into the role of ceramide metabolism in the pathophysiology of lysosomes, highlighting the more recent findings on its involvement in Parkinson’s disease. Keywords: ceramide metabolism; Parkinson’s disease; α-synuclein; GBA; GLA; HEX A-B; GALC; ASAH1; SMPD1; ARSA * Correspondence [email protected] 1.
    [Show full text]
  • PRODUCT SPECIFICATION Prest Antigen ACRV1 Product
    PrEST Antigen ACRV1 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen ACRV1 Product Number APrEST80590 Gene Description acrosomal vesicle protein 1 Alternative Gene D11S4365, SP-10, SPACA2 Names Corresponding Anti-ACRV1 (HPA038718) Antibodies Description Recombinant protein fragment of Human ACRV1 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEH GSSEHGSSKHTVAEHTSGEHAE Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 25 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • C12) United States Patent (IO) Patent No.: US 10,774,349 B2 San Et Al
    I1111111111111111 1111111111 111111111111111 IIIII IIIII IIIII IIIIII IIII IIII IIII US010774349B2 c12) United States Patent (IO) Patent No.: US 10,774,349 B2 San et al. (45) Date of Patent: Sep.15,2020 (54) ALPHA OMEGA BIFUNCTIONAL FATTY 9/1029 (2013.01); C12N 9/13 (2013.01); ACIDS C12N 9/16 (2013.01); C12N 9/88 (2013.01); C12N 9/93 (2013.01) (71) Applicant: William Marsh Rice University, (58) Field of Classification Search Houston, TX (US) None See application file for complete search history. (72) Inventors: Ka-Yiu San, Houston, TX (US); Dan Wang, Houston, TX (US) (56) References Cited (73) Assignee: William Marsh Rice University, U.S. PATENT DOCUMENTS Houston, TX (US) 9,994,881 B2 * 6/2018 Gonzalez . Cl2N 9/0006 2016/0090576 Al 3/2016 Garg et al. ( *) Notice: Subject to any disclaimer, the term ofthis patent is extended or adjusted under 35 FOREIGN PATENT DOCUMENTS U.S.C. 154(b) by 152 days. WO W02000075343 12/2000 (21) Appl. No.: 15/572,099 WO W02016179572 11/2016 (22) PCT Filed: May 7, 2016 OTHER PUBLICATIONS (86) PCT No.: PCT/US2016/031386 Choi, K. H., R. J. Heath, and C. 0. Rock. 2000. 13-Ketoacyl-acyl carrier protein synthase III (FabH) is a determining factor in § 371 (c)(l), branched-chain fatty acid biosynthesis. J. Bacteriol. 182:365-370. (2) Date: Nov. 6, 2017 He, X., and K. A. Reynolds. 2002. Purification, characterization, and identification of novel inhibitors of the beta-ketoacyl-acyl (87) PCT Pub. No.: WO2016/179572 carrier protein synthase III (FabH) from Staphylococcus aureus.
    [Show full text]
  • Constitutive Activation of RAS/MAPK Pathway Cooperates with Trisomy 21 and Is Therapeutically Exploitable in Down Syndrome B-Cell Leukemia
    Author Manuscript Published OnlineFirst on March 27, 2020; DOI: 10.1158/1078-0432.CCR-19-3519 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Constitutive activation of RAS/MAPK pathway cooperates with trisomy 21 and is therapeutically exploitable in Down syndrome B-cell Leukemia Anouchka P. Laurent1,2, Aurélie Siret1, Cathy Ignacimouttou1, Kunjal Panchal3, M’Boyba K. Diop4, Silvia Jenny5, Yi-Chien Tsai5, Damien Ross-Weil1, Zakia Aid1, Naïs Prade6, Stéphanie Lagarde6, Damien Plassard7, Gaelle Pierron8, Estelle Daudigeos-Dubus4, Yann Lecluse4, Nathalie Droin1, Beat Bornhauser5, Laurence C. Cheung3,9, John D. Crispino10, Muriel Gaudry1, Olivier A. Bernard1, Elizabeth Macintyre11, Carole Barin Bonnigal12, Rishi S. Kotecha3,9,13, Birgit Geoerger4, Paola Ballerini14, Jean-Pierre Bourquin5, Eric Delabesse6, Thomas Mercher1,15 and Sébastien Malinge1,3 1INSERM U1170, Gustave Roussy Institute, Université Paris Saclay, Villejuif, France 2Université Paris Diderot, Paris, France 3Telethon Kids Cancer Centre, Telethon Kids Institute, University of Western Australia, Perth, Australia 4Gustave Roussy Institute Cancer Campus, Department of Pediatric and Adolescent Oncology, INSERM U1015, Equipe Labellisée Ligue Nationale contre le Cancer, Université Paris-Saclay, Villejuif, France 5Department of Pediatric Oncology, Children’s Research Centre, University Children’s Hospital Zurich, Zurich, Switzerland 6Centre of Research on Cancer of Toulouse (CRCT), CHU Toulouse, Université Toulouse III, Toulouse, France 7IGBMC, Plateforme GenomEast, UMR7104 CNRS, Ilkirch, France 8Service de Génétique, Institut Curie, Paris, France 9School of Pharmacy and Biomedical Sciences, Curtin University, Bentley, Australia 10Division of Hematology/Oncology, Northwestern University, Chicago, USA 11Hematology, Université de Paris, Institut Necker-Enfants Malades and Assistance Publique – Hopitaux de Paris, Paris, France 12Centre Hospitalier Universitaire de Tours, Tours, France 1 Downloaded from clincancerres.aacrjournals.org on September 30, 2021.
    [Show full text]
  • Datasheet PB1029 Anti-AEBP2 Antibody
    Product datasheet Anti-AEBP2 Antibody Catalog Number: PB1029 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Basic Information Product Name Anti-AEBP2 Antibody Gene Name AEBP2 Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB,IHC-P,ICC/IF,FCM Contents 500ug/ml antibody with PBS ，0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen E.coli-derived human AEBP2 recombinant protein (Position: K424-Q517). Human AEBP2 shares 98.8% amino acid (aa) sequence identity with mouse AEBP2. Purification Immunogen affinity purified. Observed MW 54KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry(Paraffin-embedded Section): 1:50-400 Immunocytochemistry/Immunofluorescence (ICC/IF): 1:50-400 Flow cytometry (FCM): 1-3μg/1x106 cells Storage 12 months from date of receipt，-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing Background Information Adipocyte Enhancer-Binding Protein is a zinc finger protein that in humans is encoded by the evolutionarily well-conserved gene AEBP2. This gene is mapped to 12p12.3. AEBP2 is a DNA-binding transcriptional repressor. It may regulate the migration and development of the neural crest cells through the PRC2-mediated epigenetic mechanism and is most likely a targeting protein for the mammalian PRC2 complex. Reference Anti-AEBP2 Antibody被引用在0文献中。 暂无引用 FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-AEBP2 Antibody Catalog Number: PB1029 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Selected Validation Data Figure 1.
    [Show full text]
  • TCTE1 Is a Conserved Component of the Dynein Regulatory Complex and Is Required for Motility and Metabolism in Mouse Spermatozoa
    TCTE1 is a conserved component of the dynein regulatory complex and is required for motility and metabolism in mouse spermatozoa Julio M. Castanedaa,b,1, Rong Huac,d,1, Haruhiko Miyatab, Asami Ojib,e, Yueshuai Guoc,d, Yiwei Chengc,d, Tao Zhouc,d, Xuejiang Guoc,d, Yiqiang Cuic,d, Bin Shenc, Zibin Wangc, Zhibin Huc,f, Zuomin Zhouc,d, Jiahao Shac,d, Renata Prunskaite-Hyyrylainena,g,h, Zhifeng Yua,i, Ramiro Ramirez-Solisj, Masahito Ikawab,e,k,2, Martin M. Matzuka,g,i,l,m,n,2, and Mingxi Liuc,d,2 aDepartment of Pathology and Immunology, Baylor College of Medicine, Houston, TX 77030; bResearch Institute for Microbial Diseases, Osaka University, Suita, Osaka 5650871, Japan; cState Key Laboratory of Reproductive Medicine, Nanjing Medical University, Nanjing 210029, People’s Republic of China; dDepartment of Histology and Embryology, Nanjing Medical University, Nanjing 210029, People’s Republic of China; eGraduate School of Pharmaceutical Sciences, Osaka University, Suita, Osaka 5650871, Japan; fAnimal Core Facility of Nanjing Medical University, Nanjing 210029, People’s Republic of China; gCenter for Reproductive Medicine, Baylor College of Medicine, Houston, TX 77030; hFaculty of Biochemistry and Molecular Medicine, University of Oulu, Oulu FI-90014, Finland; iCenter for Drug Discovery, Baylor College of Medicine, Houston, TX 77030; jWellcome Trust Sanger Institute, Hinxton CB10 1SA, United Kingdom; kThe Institute of Medical Science, The University of Tokyo, Minato-ku, Tokyo 1088639, Japan; lDepartment of Molecular and Cellular Biology, Baylor College of Medicine, Houston, TX 77030; mDepartment of Molecular and Human Genetics, Baylor College of Medicine, Houston, TX 77030; and nDepartment of Pharmacology, Baylor College of Medicine, Houston, TX 77030 Contributed by Martin M.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • ABCC12 Monoclonal Antibody, Clone M9II-3
    ABCC12 monoclonal antibody, Gene Symbol: ABCC12 clone M9II-3 Gene Alias: MGC27071, MRP9 Catalog Number: MAB6675 Gene Summary: This gene is a member of the superfamily of ATP-binding cassette (ABC) transporters Regulatory Status: For research use only (RUO) and the encoded protein contains two ATP-binding domains and 12 transmembrane regions. ABC proteins Product Description: Rat monoclonal antibody raised transport various molecules across extra- and against partial recombinant ABCC12. intracellular membranes. ABC genes are divided into Clone Name: M9II-3 seven distinct subfamilies: ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White. This gene is a member of Immunogen: Recombinant protein corresponding to the MRP subfamily which is involved in multi-drug amino acids 690-734 of human ABCC12. resistance. This gene and another subfamily member are arranged head-to-tail on chromosome 16q12.1. Host: Rat Increased expression of this gene is associated with breast cancer. [provided by RefSeq] Reactivity: Human References: Applications: ICC, IHC-Fr, WB 1. Multidrug resistance-associated protein 9 (ABCC12) is (See our web site product page for detailed applications present in mouse and boar sperm. Ono N, Van der information) Heijden I, Scheffer GL, Van de Wetering K, Van Deemter E, De Haas M, Boerke A, Gadella BM, De Rooij Protocols: See our web site at DG, Neefjes JJ, Groothuis TA, Oomen L, Brocks L, http://www.abnova.com/support/protocols.asp or product Ishikawa T, Borst P. Ono N, Van der Heijden I, Scheffer page for detailed protocols GL, Van de Wetering K, Van Deemter E, De Haas M, Boerke A, Gadella BM, De Rooij DG, Neefjes JJ, Specificity: M9II-3 reacts with an internal epitope of Groothuis TA, Oomen L, Brocks L, Ishikawa T, Borst P.
    [Show full text]
  • Evaluation of Chromatin Accessibility in Prefrontal Cortex of Individuals with Schizophrenia
    ARTICLE DOI: 10.1038/s41467-018-05379-y OPEN Evaluation of chromatin accessibility in prefrontal cortex of individuals with schizophrenia Julien Bryois 1, Melanie E. Garrett2, Lingyun Song3, Alexias Safi3, Paola Giusti-Rodriguez 4, Graham D. Johnson 3, Annie W. Shieh13, Alfonso Buil5, John F. Fullard6, Panos Roussos 6,7,8, Pamela Sklar6, Schahram Akbarian 6, Vahram Haroutunian 6,9, Craig A. Stockmeier 10, Gregory A. Wray3,11, Kevin P. White12, Chunyu Liu13, Timothy E. Reddy 3,14, Allison Ashley-Koch2,15, Patrick F. Sullivan 1,4,16 & Gregory E. Crawford 3,17 1234567890():,; Schizophrenia genome-wide association studies have identified >150 regions of the genome associated with disease risk, yet there is little evidence that coding mutations contribute to this disorder. To explore the mechanism of non-coding regulatory elements in schizophrenia, we performed ATAC-seq on adult prefrontal cortex brain samples from 135 individuals with schizophrenia and 137 controls, and identified 118,152 ATAC-seq peaks. These accessible chromatin regions in the brain are highly enriched for schizophrenia SNP heritability. Accessible chromatin regions that overlap evolutionarily conserved regions exhibit an even higher heritability enrichment, indicating that sequence conservation can further refine functional risk variants. We identify few differences in chromatin accessibility between cases and controls, in contrast to thousands of age-related differential accessible chromatin regions. Altogether, we characterize chromatin accessibility in the human prefrontal cortex, the effect of schizophrenia and age on chromatin accessibility, and provide evidence that our dataset will allow for fine mapping of risk variants. 1 Department of Medical Epidemiology and Biostatistics, Karolinska Institutet, SE-17177 Stockholm, Sweden.
    [Show full text]
  • Understanding the Molecular Pathobiology of Acid Ceramidase Deficiency
    Understanding the Molecular Pathobiology of Acid Ceramidase Deficiency By Fabian Yu A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Institute of Medical Science University of Toronto © Copyright by Fabian PS Yu 2018 Understanding the Molecular Pathobiology of Acid Ceramidase Deficiency Fabian Yu Doctor of Philosophy Institute of Medical Science University of Toronto 2018 Abstract Farber disease (FD) is a devastating Lysosomal Storage Disorder (LSD) caused by mutations in ASAH1, resulting in acid ceramidase (ACDase) deficiency. ACDase deficiency manifests along a broad spectrum but in its classical form patients die during early childhood. Due to the scarcity of cases FD has largely been understudied. To circumvent this, our lab previously generated a mouse model that recapitulates FD. In some case reports, patients have shown signs of visceral involvement, retinopathy and respiratory distress that may lead to death. Beyond superficial descriptions in case reports, there have been no in-depth studies performed to address these conditions. To improve the understanding of FD and gain insights for evaluating future therapies, we performed comprehensive studies on the ACDase deficient mouse. In the visual system, we reported presence of progressive uveitis. Further tests revealed cellular infiltration, lipid buildup and extensive retinal pathology. Mice developed retinal dysplasia, impaired retinal response and decreased visual acuity. Within the pulmonary system, lung function tests revealed a decrease in lung compliance. Mice developed chronic lung injury that was contributed by cellular recruitment, and vascular leakage. Additionally, we report impairment to lipid homeostasis in the lungs. ii To understand the liver involvement in FD, we characterized the pathology and performed transcriptome analysis to identify gene and pathway changes.
    [Show full text]