DOCSLIB.ORG

TCTE1 Is a Conserved Component of the Dynein Regulatory Complex and Is Required for Motility and Metabolism in Mouse Spermatozoa

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
TCTE1 Is a Conserved Component of the Dynein Regulatory Complex and Is Required for Motility and Metabolism in Mouse Spermatozoa TCTE1 is a conserved component of the dynein regulatory complex and is required for motility and metabolism in mouse spermatozoa Julio M. Castanedaa,b,1, Rong Huac,d,1, Haruhiko Miyatab, Asami Ojib,e, Yueshuai Guoc,d, Yiwei Chengc,d, Tao Zhouc,d, Xuejiang Guoc,d, Yiqiang Cuic,d, Bin Shenc, Zibin Wangc, Zhibin Huc,f, Zuomin Zhouc,d, Jiahao Shac,d, Renata Prunskaite-Hyyrylainena,g,h, Zhifeng Yua,i, Ramiro Ramirez-Solisj, Masahito Ikawab,e,k,2, Martin M. Matzuka,g,i,l,m,n,2, and Mingxi Liuc,d,2 aDepartment of Pathology and Immunology, Baylor College of Medicine, Houston, TX 77030; bResearch Institute for Microbial Diseases, Osaka University, Suita, Osaka 5650871, Japan; cState Key Laboratory of Reproductive Medicine, Nanjing Medical University, Nanjing 210029, People’s Republic of China; dDepartment of Histology and Embryology, Nanjing Medical University, Nanjing 210029, People’s Republic of China; eGraduate School of Pharmaceutical Sciences, Osaka University, Suita, Osaka 5650871, Japan; fAnimal Core Facility of Nanjing Medical University, Nanjing 210029, People’s Republic of China; gCenter for Reproductive Medicine, Baylor College of Medicine, Houston, TX 77030; hFaculty of Biochemistry and Molecular Medicine, University of Oulu, Oulu FI-90014, Finland; iCenter for Drug Discovery, Baylor College of Medicine, Houston, TX 77030; jWellcome Trust Sanger Institute, Hinxton CB10 1SA, United Kingdom; kThe Institute of Medical Science, The University of Tokyo, Minato-ku, Tokyo 1088639, Japan; lDepartment of Molecular and Cellular Biology, Baylor College of Medicine, Houston, TX 77030; mDepartment of Molecular and Human Genetics, Baylor College of Medicine, Houston, TX 77030; and nDepartment of Pharmacology, Baylor College of Medicine, Houston, TX 77030 Contributed by Martin M. Matzuk, May 15, 2017 (sent for review December 27, 2016; reviewed by George L. Gerton and Mary Ann Handel) Flagella and cilia are critical cellular organelles that provide a dynein is anchored to the outer microtubules and responsible for means for cells to sense and progress through their environment. generating the force required to produce the beating pattern of The central component of flagella and cilia is the axoneme, which flagella and cilia (6). The force generated by dynein causes comprises the “9+2” microtubule arrangement, dynein arms, ra- sliding of the microtubules among each other; however, the dial spokes, and the nexin-dynein regulatory complex (N-DRC). nexin complex anchors the microtubules in place. The nexin Failure to properly assemble components of the axoneme leads complex [or nexin-dynein regulatory complex (N-DRC)] has to defective flagella and in humans leads to a collection of diseases been observed in transmission electron micrographs for several referred to as ciliopathies. Ciliopathies can manifest as severe syn- decades as a thin filament between outer microtubule doublets, dromic diseases that affect lung and kidney function, central nervous but only recently has the N-DRC’s role in regulating flagellar system development, bone formation, visceral organ organization, function been elucidated (7). By preventing the sliding of mi- and reproduction. T-Complex-Associated–Testis-Expressed 1 (TCTE1) Chla- crotubules, the nexin complex turns the force generated by is an evolutionarily conserved axonemal protein present from dynein into a bending motion of both flagella and cilia. The mydomonas (DRC5) to mammals that localizes to the N-DRC. Here, we show that mouse TCTE1 is testis-enriched in its expression, with its mRNA appearing in early round spermatids and protein localized Significance to the flagellum. TCTE1 is 498 aa in length with a leucine rich repeat domain at the C terminus and is present in eukaryotes containing a Infertility is a global problem that afflicts 15% of couples, and in flagellum. Knockout of Tcte1 results in male sterility because Tcte1- 50% of cases, the attributing factor is linked to men. Among these null spermatozoa show aberrant motility. Although the axoneme is infertile men, 18% specifically exhibit decreased motility of sperm structurally normal in Tcte1 mutant spermatozoa, Tcte1-null sperm (asthenozoospermia). Sperm motility is dependent on the forma- demonstrate a significant decrease of ATP, which is used by dynein tion and functioning of the flagellum, a modified cilium used for motors to generate the bending force of the flagellum. These data locomotion. Cilia are present in almost every cell of vertebrates and provide a link to defining the molecular intricacies required for axo- are essential for proper organ functioning. Defects in cilia forma- neme function, sperm motility, and male fertility. tion lead to severe syndromic diseases, termed ciliopathies, af- fecting numerous tissues (e.g., polycystic kidney disease), wherein male infertility | asthenozoospermia | glycolysis | mutant mouse | male infertility is often comorbid. Advances in mouse genetics testis-specific gene implicate several genes responsible for ciliopathies observed in humans. Here, we identify a nonsyndromic flagellum protein, TCTE1, that is required for sperm motility in mice. lagella are ancient, analogous cellular structures used for Flocomotion and as sensory organelles present in all three Author contributions: J.M.C., R.H., M.I., M.M.M., and M.L. designed research; J.M.C., R.H., domains of life (bacteria, archaea, and eukaryotes). The advan- H.M., A.O., Y.G., Y. Cheng, T.Z., X.G., Y. Cui, B.S., Z.W., Z.H., Z.Z., J.S., R.P.-H., Z.Y., R.R.-S., tages conferred by this organelle are highlighted by the flagella’s M.I., M.M.M., and M.L. performed research; R.R.-S. contributed new reagents/analytic apparent independent evolution in all three domains (1–3). Of tools; J.M.C., R.H., H.M., A.O., Y.G., Y. Cheng, T.Z., X.G., Y. Cui, B.S., Z.W., Z.H., Z.Z., J.S., R.P.-H., Z.Y., R.R.-S., M.I., M.M.M., and M.L. analyzed data; and J.M.C. and R.H. wrote all of the different flagella present among eukaryotes, flagella the paper. attached to gametes play a critical function in uniting gametes Reviewers: G.L.G., Perelman School of Medicine, University of Pennsylvania; and M.A.H., for fertilization and the perpetuation of a species. Mammalian The Jackson Laboratory. spermatozoa have a specialized flagellum that contains a mid- The authors declare no conflict of interest. piece, principal piece, and end piece with the axoneme running Freely available online through the PNAS open access option. along the entire length (4). The flagellum equips sperm with the ’ Data deposition: The data reported in this article have been deposited in the ProteomeX- capability to deliver half of the male s genetic material to the change Consortium with identifier PXD005343. female gamete, the oocyte. In addition to flagella, eukaryotes 1J.M.C. and R.H. contributed equally to this work. contain another related structure called cilia. The defining fea- 2To whom correspondence may be addressed. Email: [email protected], ikawa@ ture of flagella and cilia is the axoneme, the “9+2” microtubule biken.osaka-u.ac.jp, or [email protected]. arraignment of two central pairs of microtubules surrounded by This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. nine pairs of microtubule doublets (5). The microtubule motor 1073/pnas.1621279114/-/DCSupplemental. E5370–E5378 | PNAS | Published online June 19, 2017 www.pnas.org/cgi/doi/10.1073/pnas.1621279114 Downloaded by guest on September 29, 2021 N-DRC is a complex of up to 11 proteins that, in addition to TCTE1 Is Required for Progressive Movement in Spermatozoa. Male PNAS PLUS linking adjacent outer doublets, is also thought to regulate the infertility could result from defects in spermatogenesis up to di- motor activity in dynein (7). minished fertilization ability once the spermatozoa reaches the egg Failure to assemble or regulate flagellar function in sperma- (10). To determine if a block in spermatogenesis was the reason of tozoa leads to defective motility (asthenozoospermia) and fer- male infertility, we examined spermatogenesis in Tcte1 null males. tility defects, including male sterility (8). Mutations in multiple Gross examination of testis revealed no difference in appearance, genes in mouse models have been identified that disrupt the testis weight, and sperm counts between homozygous and control formation of the flagellum or the function of the flagellum (9, littermates (Fig. S3 A and B). Using the hematoxylin–eosin (H&E) 10). For example, mutations in Akap4, Tekt3, Tekt4, and Cabyr in staining method, no difference was observed in spermatogenesis mice lead to structural defects in the flagellum, whereas muta- between wild-type control and null testes (Fig. 1 F and G). Fur- tions in CatSper1, Pgk2, Gapdhs, and Ldhc lead to functional thermore, meiotic progression and acrosome formation did not re- defects in the flagellum, some of which cause defective metab- veal a difference between the two genotypes (Fig. S3 C and D). olism or glycolysis (11–18). In men, mutations in CATSPER, When examining epididymis sections, both genotypes contained DNAH1, DNAH11, and TEKT2 have been shown to lead to tubules full of spermatozoa in the cauda and caput regions of the asthenozoospermia and sterility (19–22). Here, we report that a epididymis (Fig. 1 H and I). In addition, spermatozoa morphology mutation in mouse T-Complex-Associated–Testis-Expressed 1 appears normal in Tcte1 KOs (Fig. 1 J and K). Taken together, these [Tcte1; the ortholog of the Chlamydomonas N-DRC component observations suggest that a block in spermatogenesis is not the Drc5 (23)] leads to male sterility characterized by asthenozoo- reason for male infertility observed in Tcte1 KOs. − − spermia and decreased metabolism within sperm. To determine the sperm quality in Tcte1 / males, we exam- ined sperm function using a Computer Assisted Sperm Analyzer Results (CASA). CASA analysis revealed decreased forwardly motile Tcte1 Is a Testis-Enriched Gene Required for Male Fertility.
Load more

Recommended publications
  • PRODUCT SPECIFICATION Prest Antigen ACRV1 Product
    PrEST Antigen ACRV1 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen ACRV1 Product Number APrEST80590 Gene Description acrosomal vesicle protein 1 Alternative Gene D11S4365, SP-10, SPACA2 Names Corresponding Anti-ACRV1 (HPA038718) Antibodies Description Recombinant protein fragment of Human ACRV1 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEH GSSEHGSSKHTVAEHTSGEHAE Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 25 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • ACRV1 (NM 020069) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC214263 ACRV1 (NM_020069) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: ACRV1 (NM_020069) Human Tagged ORF Clone Tag: Myc-DDK Symbol: ACRV1 Synonyms: D11S4365; SP-10; SPACA2 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC214263 representing NM_020069 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACAGGTTTCTCTTGCTAATGAGTCTTTATCTGCTTGGATCTGCCAGAGGAACATCAAGTCAGCCTA ATGAGCTTTCTGGCTCCATAGATCATCAAACTTCAGTTCAGCAACTTCCAGGTGAGTTCTTTTCACTTGA AAACCCTTCTGATGCTGAGGCTTTATATGAGACTTCTTCAGGCCTGAACACTTTAAGTGAGCATGGTTCC AGTGAGCATGGTTCAAGCAAGCACACTGTGGCCGAGCACACTTCTGGAGAACATGCTGAGAGTGAGCATG CTTCAGGTGAGCCCGCTGCGACTGAACATGCTGAAGGTGAGCATACTGTAGGTGAGCAGCCTTCAGGAGA ACAGCCTTCAGGTGAACACCTCTCCGGAGAACAGCCTTTGAGTGAGCTTGAGTCAGGTGAACAGCCTTCA GATGAACAGCCTTCAGGTGAACATGGCTCCGGTGAACAGCCTTCTGGTGAGCAGGCCTCGGGTGAACAGC CTTCAGGCACAATATTAAATTGCTACACATGTGCTTATATGAATGATCAAGGAAAATGTCTTCGTGGAGA GGGAACCTGCATCACTCAGAATTCCCAGCAGTGCATGTTAAAGAAGATCTTTGAAGGTGGAAAACTCCAA TTCATGGTTCAAGGGTGTGAGAACATGTGCCCATCTATGAACCTCTTCTCCCATGGAACGAGGATGCAAA TTATATGCTGTCGAAATCAATCTTTCTGCAATAAGATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is
    [Show full text]
  • 1 Retrotransposons and Pseudogenes Regulate Mrnas and Lncrnas Via the Pirna Pathway 1 in the Germline 2 3 Toshiaki Watanabe*, E
    Downloaded from genome.cshlp.org on October 6, 2021 - Published by Cold Spring Harbor Laboratory Press 1 Retrotransposons and pseudogenes regulate mRNAs and lncRNAs via the piRNA pathway 2 in the germline 3 4 Toshiaki Watanabe*, Ee-chun Cheng, Mei Zhong, and Haifan Lin* 5 Yale Stem Cell Center and Department of Cell Biology, Yale University School of Medicine, New Haven, 6 Connecticut 06519, USA 7 8 Running Title: Pachytene piRNAs regulate mRNAs and lncRNAs 9 10 Key Words: retrotransposon, pseudogene, lncRNA, piRNA, Piwi, spermatogenesis 11 12 *Correspondence: [email protected]; [email protected] 13 1 Downloaded from genome.cshlp.org on October 6, 2021 - Published by Cold Spring Harbor Laboratory Press 14 ABSTRACT 15 The eukaryotic genome has vast intergenic regions containing transposons, pseudogenes, and other 16 repetitive sequences. They produce numerous long non-coding RNAs (lncRNAs) and PIWI-interacting 17 RNAs (piRNAs), yet the functions of the vast intergenic regions remain largely unknown. Mammalian 18 piRNAs are abundantly expressed in late spermatocytes and round spermatids, coinciding with the 19 widespread expression of lncRNAs in these cells. Here, we show that piRNAs derived from transposons 20 and pseudogenes mediate the degradation of a large number of mRNAs and lncRNAs in mouse late 21 spermatocytes. In particular, they have a large impact on the lncRNA transcriptome, as a quarter of 22 lncRNAs expressed in late spermatocytes are up-regulated in mice deficient in the piRNA pathway. 23 Furthermore, our genomic and in vivo functional analyses reveal that retrotransposon sequences in the 24 3´UTR of mRNAs are targeted by piRNAs for degradation.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Molecular Classification of Patients with Unexplained Hamartomatous and Hyperplastic Polyposis
    ORIGINAL CONTRIBUTION Molecular Classification of Patients With Unexplained Hamartomatous and Hyperplastic Polyposis Kevin Sweet, MS, CGC Context Significant proportions of patients with hamartomatous polyposis or with Joseph Willis, MD hyperplastic/mixed polyposis remain without specific clinical and molecular diagnosis Xiao-Ping Zhou, MD, PhD or present atypically. Assigning a syndromic diagnosis is important because it guides management, especially surveillance and prophylactic surgery. Carol Gallione, PhD Objective To systematically classify patients with unexplained hamartomatous or hy- Takeshi Sawada, MD, PhD perplastic/mixed polyposis by extensive molecular analysis in the context of central Pia Alhopuro, MD rereview of histopathology results. Sok Kean Khoo, PhD Design, Setting, and Patients Prospective, referral-based study of 49 unrelated patients from outside institutions (n=28) and at a comprehensive cancer center (n=21), Attila Patocs, MD, PhD conducted from May 2, 2002, until December 15, 2004. Germline analysis of PTEN, Cossette Martin, PhD BMPR1A, STK11 (sequence, deletion), SMAD4, and ENG (sequence), specific exon screen- Scott Bridgeman, BSc ing of BRAF, MYH, and BHD, and rereview of polyp histology results were performed. John Heinz, PhD Main Outcome Measures Molecular, clinical, and histopathological findings in pa- tients with unexplained polyposis. Robert Pilarski, MS, CGC Results Of the 49 patients, 11 (22%) had germline mutations. Of 14 patients with Rainer Lehtonen, BSc juvenile polyposis, 2 with early-onset disease had mutations in ENG, encoding endo- Thomas W. Prior, PhD glin, previously only associated with hereditary hemorrhagic telangiectasia; 1 had hemi- zygous deletion encompassing PTEN and BMPR1A; and 1 had an SMAD4 mutation. Thierry Frebourg, MD, PhD One individual previously classified with Peutz-Jeghers syndrome had a PTEN dele- Bin Tean Teh, MD, PhD tion.
    [Show full text]
  • Mouse Acrv1 Conditional Knockout Project (CRISPR/Cas9)
    https://www.alphaknockout.com Mouse Acrv1 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Acrv1 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Acrv1 gene (NCBI Reference Sequence: NM_007391 ; Ensembl: ENSMUSG00000032110 ) is located on Mouse chromosome 9. 4 exons are identified, with the ATG start codon in exon 1 and the TAG stop codon in exon 4 (Transcript: ENSMUST00000034620). Exon 2~3 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Acrv1 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-339F21 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 2~3 is not frameshift exon, and covers 78.16% of the coding region. The size of intron 1 for 5'-loxP site insertion: 847 bp, and the size of intron 3 for 3'-loxP site insertion: 1789 bp. The size of effective cKO region: ~2999 bp. The cKO region does not have any other known gene. Page 1 of 7 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 3 4 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Homology arm Exon of mouse Acrv1 cKO region loxP site Page 2 of 7 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • TCTE1 Is a Conserved Component of the Dynein Regulatory Complex and Is Required for Motility and Metabolism in Mouse Spermatozoa
    TCTE1 is a conserved component of the dynein PNAS PLUS regulatory complex and is required for motility and metabolism in mouse spermatozoa Julio M. Castanedaa,b,1, Rong Huac,d,1, Haruhiko Miyatab, Asami Ojib,e, Yueshuai Guoc,d, Yiwei Chengc,d, Tao Zhouc,d, Xuejiang Guoc,d, Yiqiang Cuic,d, Bin Shenc, Zibin Wangc, Zhibin Huc,f, Zuomin Zhouc,d, Jiahao Shac,d, Renata Prunskaite-Hyyrylainena,g,h, Zhifeng Yua,i, Ramiro Ramirez-Solisj, Masahito Ikawab,e,k,2, Martin M. Matzuka,g,i,l,m,n,2, and Mingxi Liuc,d,2 aDepartment of Pathology and Immunology, Baylor College of Medicine, Houston, TX 77030; bResearch Institute for Microbial Diseases, Osaka University, Suita, Osaka 5650871, Japan; cState Key Laboratory of Reproductive Medicine, Nanjing Medical University, Nanjing 210029, People’s Republic of China; dDepartment of Histology and Embryology, Nanjing Medical University, Nanjing 210029, People’s Republic of China; eGraduate School of Pharmaceutical Sciences, Osaka University, Suita, Osaka 5650871, Japan; fAnimal Core Facility of Nanjing Medical University, Nanjing 210029, People’s Republic of China; gCenter for Reproductive Medicine, Baylor College of Medicine, Houston, TX 77030; hFaculty of Biochemistry and Molecular Medicine, University of Oulu, Oulu FI-90014, Finland; iCenter for Drug Discovery, Baylor College of Medicine, Houston, TX 77030; jWellcome Trust Sanger Institute, Hinxton CB10 1SA, United Kingdom; kThe Institute of Medical Science, The University of Tokyo, Minato-ku, Tokyo 1088639, Japan; lDepartment of Molecular and Cellular Biology, Baylor College of Medicine, Houston, TX 77030; mDepartment of Molecular and Human Genetics, Baylor College of Medicine, Houston, TX 77030; and nDepartment of Pharmacology, Baylor College of Medicine, Houston, TX 77030 Contributed by Martin M.
    [Show full text]
  • Research Article Clinic-Genomic Association Mining for Colorectal Cancer Using Publicly Available Datasets
    Hindawi Publishing Corporation BioMed Research International Volume 2014, Article ID 170289, 10 pages http://dx.doi.org/10.1155/2014/170289 Research Article Clinic-Genomic Association Mining for Colorectal Cancer Using Publicly Available Datasets Fang Liu,1 Yaning Feng,1 Zhenye Li,2 Chao Pan,1 Yuncong Su,1 Rui Yang,1 Liying Song,1 Huilong Duan,1 and Ning Deng1 1 Department of Biomedical Engineering, Key Laboratory for Biomedical Engineering of Ministry of Education, Zhejiang University, Hangzhou 310027, China 2 General Hospital of Ningxia Medical University, Yinchuan 750004, China Correspondence should be addressed to Ning Deng; [email protected] Received 30 March 2014; Accepted 12 May 2014; Published 2 June 2014 Academic Editor: Degui Zhi Copyright © 2014 Fang Liu et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. In recent years, a growing number of researchers began to focus on how to establish associations between clinical and genomic data. However, up to now, there is lack of research mining clinic-genomic associations by comprehensively analysing available gene expression data for a single disease. Colorectal cancer is one of the malignant tumours. A number of genetic syndromes have been proven to be associated with colorectal cancer. This paper presents our research on mining clinic-genomic associations for colorectal cancer under biomedical big data environment. The proposed method is engineered with multiple technologies, including extracting clinical concepts using the unified medical language system (UMLS), extracting genes through the literature mining, and mining clinic-genomic associations through statistical analysis.
    [Show full text]
  • Role and Regulation of the P53-Homolog P73 in the Transformation of Normal Human Fibroblasts
    Role and regulation of the p53-homolog p73 in the transformation of normal human fibroblasts Dissertation zur Erlangung des naturwissenschaftlichen Doktorgrades der Bayerischen Julius-Maximilians-Universität Würzburg vorgelegt von Lars Hofmann aus Aschaffenburg Würzburg 2007 Eingereicht am Mitglieder der Promotionskommission: Vorsitzender: Prof. Dr. Dr. Martin J. Müller Gutachter: Prof. Dr. Michael P. Schön Gutachter : Prof. Dr. Georg Krohne Tag des Promotionskolloquiums: Doktorurkunde ausgehändigt am Erklärung Hiermit erkläre ich, dass ich die vorliegende Arbeit selbständig angefertigt und keine anderen als die angegebenen Hilfsmittel und Quellen verwendet habe. Diese Arbeit wurde weder in gleicher noch in ähnlicher Form in einem anderen Prüfungsverfahren vorgelegt. Ich habe früher, außer den mit dem Zulassungsgesuch urkundlichen Graden, keine weiteren akademischen Grade erworben und zu erwerben gesucht. Würzburg, Lars Hofmann Content SUMMARY ................................................................................................................ IV ZUSAMMENFASSUNG ............................................................................................. V 1. INTRODUCTION ................................................................................................. 1 1.1. Molecular basics of cancer .......................................................................................... 1 1.2. Early research on tumorigenesis ................................................................................. 3 1.3. Developing
    [Show full text]
  • Organization, Evolution and Functions of the Human and Mouse Ly6/Upar Family Genes Chelsea L
    Loughner et al. Human Genomics (2016) 10:10 DOI 10.1186/s40246-016-0074-2 GENE FAMILY UPDATE Open Access Organization, evolution and functions of the human and mouse Ly6/uPAR family genes Chelsea L. Loughner1, Elspeth A. Bruford2, Monica S. McAndrews3, Emili E. Delp1, Sudha Swamynathan1 and Shivalingappa K. Swamynathan1,4,5,6,7* Abstract Members of the lymphocyte antigen-6 (Ly6)/urokinase-type plasminogen activator receptor (uPAR) superfamily of proteins are cysteine-rich proteins characterized by a distinct disulfide bridge pattern that creates the three-finger Ly6/uPAR (LU) domain. Although the Ly6/uPAR family proteins share a common structure, their expression patterns and functions vary. To date, 35 human and 61 mouse Ly6/uPAR family members have been identified. Based on their subcellular localization, these proteins are further classified as GPI-anchored on the cell membrane, or secreted. The genes encoding Ly6/uPAR family proteins are conserved across different species and are clustered in syntenic regions on human chromosomes 8, 19, 6 and 11, and mouse Chromosomes 15, 7, 17, and 9, respectively. Here, we review the human and mouse Ly6/uPAR family gene and protein structure and genomic organization, expression, functions, and evolution, and introduce new names for novel family members. Keywords: Ly6/uPAR family, LU domain, Three-finger domain, uPAR, Lymphocytes, Neutrophils Introduction an overview of the Ly6/uPAR gene family and their gen- The lymphocyte antigen-6 (Ly6)/urokinase-type plas- omic organization, evolution, as well as functions, and minogen activator receptor (uPAR) superfamily of struc- provide a nomenclature system for the newly identified turally related proteins is characterized by the LU members of this family.
    [Show full text]
  • Comparative Transcriptomics Analyses Across Species, Organs and Developmental Stages Reveal Functionally Constrained Lncrnas
    bioRxiv preprint doi: https://doi.org/10.1101/607200; this version posted April 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Comparative transcriptomics analyses across species, organs and developmental stages reveal 2 functionally constrained lncRNAs 3 4 Fabrice Darbellay1,$,* and Anamaria Necsulea1,2,* 5 6 7 1School of Life Sciences, École Polytechnique Fédérale de Lausanne (EPFL), Lausanne, Switzerland 8 2Université de Lyon, Université Lyon 1, CNRS, Laboratoire de Biométrie et Biologie Évolutive UMR 9 5558, F-69622 Villeurbanne, France 10 11 $Present address: Environmental Genomics and Systems Biology Division, Lawrence Berkeley 12 National Laboratory, 1 Cyclotron Road, Berkeley, California 94720, USA. 13 14 15 *Corresponding authors: 16 Fabrice Darbellay ([email protected]) 17 Anamaria Necsulea ([email protected]) 18 19 Running title: Functionally constrained lncRNAs in embryonic development 20 21 Keywords: long non-coding RNAs; evolution; development; comparative transcriptomics. 22 23 24 1 bioRxiv preprint doi: https://doi.org/10.1101/607200; this version posted April 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 25 Abstract 26 Background Transcription of long non-coding RNAs (lncRNAs) is pervasive, but their functionality is 27 disputed. As a class, lncRNAs show little selective constraint and negligible phenotypic effects upon 28 perturbation.
    [Show full text]