DOCSLIB.ORG

Mouse Hpn Conditional Knockout Project (CRISPR/Cas9)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mouse Hpn Conditional Knockout Project (CRISPR/Cas9) https://www.alphaknockout.com Mouse Hpn Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Hpn conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Hpn gene (NCBI Reference Sequence: NM_001110252 ; Ensembl: ENSMUSG00000001249 ) is located on Mouse chromosome 7. 14 exons are identified, with the ATG start codon in exon 2 and the TGA stop codon in exon 14 (Transcript: ENSMUST00000108102). Exon 2 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Hpn gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-29F19 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Mice homozygous for a null mutation are hypothyroidic and develop profound hearing loss associated with structural changes in the tectorial membrane and a myelination defect affecting the compaction of spiral ganglion neurons. Exon 2 starts from about 100% of the coding region. The knockout of Exon 2 will result in frameshift of the gene. The size of intron 1 for 5'-loxP site insertion: 391 bp, and the size of intron 2 for 3'-loxP site insertion: 3904 bp. The size of effective cKO region: ~458 bp. The cKO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele gRNA region 5' gRNA region 3' 5 1 2 14 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Scn1b Homology arm Exon of mouse Hpn cKO region loxP site Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the GC Content Distribution Window size: 300 bp Sequence 12 Summary: Full Length(6903bp) | A(21.4% 1477) | C(26.81% 1851) | T(22.45% 1550) | G(29.34% 2025) Note: The sequence of homologous arms and cKO region is analyzed to determine the GC content. Significant high GC-content regions are found. It may be difficult to construct this targeting vector. Page 3 of 8 https://www.alphaknockout.com BLAT Search Results (up) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr7 - 31114886 31117885 3000 browser details YourSeq 31 1715 1757 3000 86.1% chr1 - 6531240 6531282 43 browser details YourSeq 24 1859 1882 3000 100.0% chr2 + 33066576 33066599 24 browser details YourSeq 22 1667 1691 3000 96.0% chr12 - 71577866 71577892 27 browser details YourSeq 22 521 542 3000 100.0% chr10 - 123092421 123092442 22 browser details YourSeq 22 991 1016 3000 92.4% chr13 + 42711886 42711911 26 browser details YourSeq 21 2555 2575 3000 100.0% chr6 - 94700416 94700436 21 browser details YourSeq 21 2562 2582 3000 100.0% chr5 + 141079461 141079481 21 Note: The 3000 bp section upstream of Exon 2 is BLAT searched against the genome. No significant similarity is found. BLAT Search Results (down) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr7 - 31111428 31114427 3000 browser details YourSeq 207 1437 1716 3000 94.5% chr7 - 16181058 16264640 83583 browser details YourSeq 200 1490 1716 3000 94.8% chr7 - 30304283 30304993 711 browser details YourSeq 200 1490 1848 3000 89.8% chr5 + 140011957 140012417 461 browser details YourSeq 200 1490 1743 3000 92.4% chr5 + 130480767 130481210 444 browser details YourSeq 197 1490 1717 3000 94.3% chr7 + 24375294 24375583 290 browser details YourSeq 197 1491 1763 3000 93.5% chr5 + 136649813 136650393 581 browser details YourSeq 196 1490 1716 3000 93.9% chr7 + 28553753 28638775 85023 browser details YourSeq 195 1487 1716 3000 93.4% chr5 + 144034262 144034497 236 browser details YourSeq 193 1490 1716 3000 95.0% chr7 - 19763075 19867624 104550 browser details YourSeq 193 1490 1716 3000 94.6% chr7 - 6201815 6202050 236 browser details YourSeq 192 1490 1716 3000 95.0% chr5 + 134001482 134375302 373821 browser details YourSeq 191 1490 1716 3000 92.9% chr7 - 35610942 35611330 389 browser details YourSeq 191 1490 1716 3000 94.5% chr7 - 19351329 19351564 236 browser details YourSeq 191 1490 1716 3000 94.5% chr7 + 29003994 29004229 236 browser details YourSeq 191 1491 1716 3000 94.5% chr7 + 27297003 27390425 93423 browser details YourSeq 191 1490 1716 3000 92.5% chr7 + 25111469 25111701 233 browser details YourSeq 191 1490 1718 3000 94.1% chr5 + 142037560 142330923 293364 browser details YourSeq 191 1490 1716 3000 94.5% chr5 + 140484087 140484322 236 browser details YourSeq 190 1490 1716 3000 92.6% chr7 - 35631982 35632217 236 Note: The 3000 bp section downstream of Exon 2 is BLAT searched against the genome. No significant similarity is found. Page 4 of 8 https://www.alphaknockout.com Gene and protein information: Hpn hepsin [ Mus musculus (house mouse) ] Gene ID: 15451, updated on 12-Aug-2019 Gene summary Official Symbol Hpn provided by MGI Official Full Name hepsin provided by MGI Primary source MGI:MGI:1196620 See related Ensembl:ENSMUSG00000001249 Gene type protein coding RefSeq status REVIEWED Organism Mus musculus Lineage Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus Also known as Hlb320 Summary This gene encodes a type II transmembrane serine protease that may function in diverse processes, including regulation of Expression cell growth. Deficiency in this gene results in hearing loss. The protein is cleaved into a catalytic serine protease chain and a non-catalytic scavenger receptor cysteine-rich chain, which associate via a single disulfide bond. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013] Orthologs Biased expression in liver adult (RPKM 275.8), kidney adult (RPKM 197.4) and 4 other tissuesS ee more human all Genomic context Location: 7; 7 B1 See Hpn in Genome Data Viewer Exon count: 15 Annotation release Status Assembly Chr Location 108 current GRCm38.p6 (GCF_000001635.26) 7 NC_000073.6 (31098725..31115326, complement) Build 37.2 previous assembly MGSCv37 (GCF_000001635.18) 7 NC_000073.5 (31883744..31900309, complement) Chromosome 7 - NC_000073.6 Page 5 of 8 https://www.alphaknockout.com Transcript information: This gene has 11 transcripts Gene: Hpn ENSMUSG00000001249 Description hepsin [Source:MGI Symbol;Acc:MGI:1196620] Gene Synonyms Hlb320 Location Chromosome 7: 31,098,725-31,115,290 reverse strand. GRCm38:CM001000.2 About this gene This gene has 11 transcripts (splice variants), 179 orthologues, 20 paralogues, is a member of 1 Ensembl protein family and is associated with 18 phenotypes. Transcripts Name Transcript ID bp Protein Translation ID Biotype CCDS UniProt Flags Hpn- ENSMUST00000108102.8 1830 436aa ENSMUSP00000103737.2 Protein coding CCDS52188 O35453 TSL:1 202 GENCODE basic Hpn- ENSMUST00000168884.7 1762 416aa ENSMUSP00000131658.1 Protein coding CCDS52187 G3UWE8 TSL:1 209 GENCODE basic APPRIS P1 Hpn- ENSMUST00000039435.14 1743 445aa ENSMUSP00000038149.8 Protein coding CCDS71936 E9Q5P0 TSL:1 201 GENCODE basic Hpn- ENSMUST00000164929.2 1110 82aa ENSMUSP00000127229.1 Protein coding - E9Q3X9 CDS 3' 204 incomplete TSL:3 Hpn- ENSMUST00000171259.1 621 179aa ENSMUSP00000132307.1 Protein coding - F6W6S4 CDS 5' 211 incomplete TSL:5 Hpn- ENSMUST00000171225.1 469 32aa ENSMUSP00000130966.1 Protein coding - F7C9T6 CDS 5' 210 incomplete TSL:3 Hpn- ENSMUST00000165124.7 1861 137aa ENSMUSP00000145624.1 Nonsense mediated - A0A0U1RNM3 TSL:2 205 decay Hpn- ENSMUST00000164340.1 920 No - Retained intron - - TSL:5 203 protein Hpn- ENSMUST00000167719.7 679 No - Retained intron - - TSL:3 207 protein Hpn- ENSMUST00000165480.1 541 No - Retained intron - - TSL:3 206 protein Hpn- ENSMUST00000168623.1 351 No - Retained intron - - TSL:3 208 protein Page 6 of 8 https://www.alphaknockout.com 36.57 kb Forward strand 31.09Mb 31.10Mb 31.11Mb 31.12Mb Contigs AC158993.2 > Genes (Comprehensive set... < Hpn-202protein coding < Scn1b-201protein coding < Hpn-209protein coding < Scn1b-203protein coding < Hpn-205nonsense mediated decay < Scn1b-202retained intron < Hpn-201protein coding < Hpn-211protein coding < Hpn-204protein coding < Hpn-210protein coding < Hpn-208retained intron < Hpn-203retained intron < Hpn-207retained intron < Hpn-206retained intron Regulatory Build 31.09Mb 31.10Mb 31.11Mb 31.12Mb Reverse strand 36.57 kb Regulation Legend CTCF Open Chromatin Promoter Promoter Flank Transcription Factor Binding Site Gene Legend Protein Coding Ensembl protein coding merged Ensembl/Havana Non-Protein Coding processed transcript Page 7 of 8 https://www.alphaknockout.com Transcript: ENSMUST00000108102 < Hpn-202protein coding Reverse strand 16.57 kb ENSMUSP00000103... Transmembrane heli... MobiDB lite Superfamily SRCR-like domain superfamily Peptidase S1, PA clan SMART SRCR-like domain Serine proteases, trypsin domain Prints Peptidase S1A, chymotrypsin family Pfam Hepsin, SRCR domain Serine proteases, trypsin domain PROSITE profiles Serine proteases, trypsin domain PROSITE patterns Serine proteases, trypsin family, histidine active site Serine proteases, trypsin family, serine active site PANTHER Hepsin PTHR24253 Gene3D SRCR-like domain superfamily 2.40.10.10 CDD Serine proteases, trypsin domain All sequence SNPs/i... Sequence variants (dbSNP and all other sources) Variant Legend missense variant synonymous variant Scale bar 0 40 80 120 160 200 240 280 320 360 436 We wish to acknowledge the following valuable scientific information resources: Ensembl, MGI, NCBI, UCSC. Page 8 of 8.
Load more

Recommended publications
  • Annual Scientific Report 2013 on the Cover Structure 3Fof in the Protein Data Bank, Determined by Laponogov, I
    EMBL-European Bioinformatics Institute Annual Scientific Report 2013 On the cover Structure 3fof in the Protein Data Bank, determined by Laponogov, I. et al. (2009) Structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases. Nature Structural & Molecular Biology 16, 667-669. © 2014 European Molecular Biology Laboratory This publication was produced by the External Relations team at the European Bioinformatics Institute (EMBL-EBI) A digital version of the brochure can be found at www.ebi.ac.uk/about/brochures For more information about EMBL-EBI please contact: [email protected] Contents Introduction & overview 3 Services 8 Genes, genomes and variation 8 Molecular atlas 12 Proteins and protein families 14 Molecular and cellular structures 18 Chemical biology 20 Molecular systems 22 Cross-domain tools and resources 24 Research 26 Support 32 ELIXIR 36 Facts and figures 38 Funding & resource allocation 38 Growth of core resources 40 Collaborations 42 Our staff in 2013 44 Scientific advisory committees 46 Major database collaborations 50 Publications 52 Organisation of EMBL-EBI leadership 61 2013 EMBL-EBI Annual Scientific Report 1 Foreword Welcome to EMBL-EBI’s 2013 Annual Scientific Report. Here we look back on our major achievements during the year, reflecting on the delivery of our world-class services, research, training, industry collaboration and European coordination of life-science data. The past year has been one full of exciting changes, both scientifically and organisationally. We unveiled a new website that helps users explore our resources more seamlessly, saw the publication of ground-breaking work in data storage and synthetic biology, joined the global alliance for global health, built important new relationships with our partners in industry and celebrated the launch of ELIXIR.
    [Show full text]
  • Roles of Nickel Binding Proteins in Helicobacter Species
    ROLES OF NICKEL BINDING PROTEINS IN HELICOBACTER SPECIES by SUSMITHA SESHADRI (Under the Direction of Robert J. Maier) ABSTRACT Proteins Hpn and Hpn-like of the gastric pathogen H. pylori were hypothesized to bind nickel since histidine residues make up 45% and 27% of their amino acid content, respectively. Characterization of an hpn, an hpn-like and an hpn, hpn-like double mutant revealed novel functions for these gene products in nickel detoxification and storage. Compared to the wild-type parent, mutant strains were more sensitive to elevated concentrations of nickel, cobalt, and cadmium, indicating roles for the two proteins in surviving metal toxicity. Under low nickel conditions, the mutants exhibited higher urease activities and had increased amount of Ni- associated with urease; but similar urease apo-protein levels to wild-type. The parent achieved mutant level urease activities under nickel supplementation and lower pH conditions while growth with a nickel chelator decreased mutant but not wild-type urease activities. These results strongly imply a role for these proteins as nickel reservoirs/storage proteins. H. hepaticus colonizes a non-acidic niche, hence nickel metabolism may be different than in H. pylori. A nikR mutant exhibited higher urease and hydrogenase activities under all supplemental nickel conditions, but there was no change in urease expression, and NikR did not bind pUreA or pHydA. Higher total nickel levels (detected by ICP-MS) in the nikR mutant implied possible higher nickel transporter (NikA) levels, which was later verified by qRT-PCR and binding of NikR to pNikA. Periplasmic nitrate reductase (NapA) was upregulated in the NikR strain.
    [Show full text]
  • A Highly Accurate Model for Screening Prostate Cancer Using Propensity Index Panel of Ten Genes
    bioRxiv preprint doi: https://doi.org/10.1101/2021.03.22.436371; this version posted March 22, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. A highly accurate model for screening prostate cancer using propensity index panel of ten genes Shipra Jain#, Kawal Preet Kaur Malhotra#, Sumeet Patiyal#, Gajendra P. S. Raghava* Department of Computational Biology, Indraprastha Institute of Information Technology, New Delhi-110020, India. # - Contributed Equally * - Corresponding Author Mailing Address of Authors Shipra Jain: [email protected] ORCID ID: https://orcid.org/0000-0002-7045-5188 Kawal Preet Kaur Malhotra: [email protected] Sumeet Patiyal: [email protected] ORCID ID: https://orcid.org/0000-0003-1358-292X GPS Raghava: [email protected] ORCID ID: https://orcid.org/0000-0002-8902-2876 Corresponding Author Gajendra Pal Singh Raghava Head and Professor, Department of Computational Biology Office: A-302 R&D Block, Indraprastha Institute of Information Technology, Delhi Okhla Industrial Estate, Phase III, (Near Govind Puri Metro Station) New Delhi, India - 110020 Phone: 011-26907444 Email: [email protected] Website: http://webs.iiitd.edu.in/raghava/ Highlights ● Application of Machine learning techniques to identify Biomarkers for PRAD cancer. ● Highly accurate models developed for classifying prostate cancer vs. normal sample. ● Introducing Propensity index concept for enhancing model performance. ● Top 10 genes identified using feature selection techniques. bioRxiv preprint doi: https://doi.org/10.1101/2021.03.22.436371; this version posted March 22, 2021.
    [Show full text]
  • The Human Genome Project
    TO KNOW OURSELVES ❖ THE U.S. DEPARTMENT OF ENERGY AND THE HUMAN GENOME PROJECT JULY 1996 TO KNOW OURSELVES ❖ THE U.S. DEPARTMENT OF ENERGY AND THE HUMAN GENOME PROJECT JULY 1996 Contents FOREWORD . 2 THE GENOME PROJECT—WHY THE DOE? . 4 A bold but logical step INTRODUCING THE HUMAN GENOME . 6 The recipe for life Some definitions . 6 A plan of action . 8 EXPLORING THE GENOMIC LANDSCAPE . 10 Mapping the terrain Two giant steps: Chromosomes 16 and 19 . 12 Getting down to details: Sequencing the genome . 16 Shotguns and transposons . 20 How good is good enough? . 26 Sidebar: Tools of the Trade . 17 Sidebar: The Mighty Mouse . 24 BEYOND BIOLOGY . 27 Instrumentation and informatics Smaller is better—And other developments . 27 Dealing with the data . 30 ETHICAL, LEGAL, AND SOCIAL IMPLICATIONS . 32 An essential dimension of genome research Foreword T THE END OF THE ROAD in Little has been rapid, and it is now generally agreed Cottonwood Canyon, near Salt that this international project will produce Lake City, Alta is a place of the complete sequence of the human genome near-mythic renown among by the year 2005. A skiers. In time it may well And what is more important, the value assume similar status among molecular of the project also appears beyond doubt. geneticists. In December 1984, a conference Genome research is revolutionizing biology there, co-sponsored by the U.S. Department and biotechnology, and providing a vital of Energy, pondered a single question: Does thrust to the increasingly broad scope of the modern DNA research offer a way of detect- biological sciences.
    [Show full text]
  • Complex Rearrangement of Chromosomes 19, 21, and 22 In
    Cancer Genetics and Cytogenetics 181 (2008) 81e92 Complex rearrangement of chromosomes 19, 21, and 22 in Ewing sarcoma involving a novel reciprocal inversioneinsertion mechanism of EWSeERG fusion gene formation: a case analysis and literature review Georges Mairea, Christopher W. Brownb,c,d, Jane Bayania, Carlos Pereirae, Denis H. Gravelf, John C. Bellc, Maria Zielenskae,g,h, Jeremy A. Squirea,h* aDivision of Applied Molecular Oncology, Ontario Cancer Institute, Princess Margaret Hospital, University Health Network, 610 University Avenue, Room 9-717, Toronto, Ontario M5G 2M9, Canada bOttawa Health Research Institute, Centre for Cancer Therapeutics, Ottawa, Ontario, Canada cDepartment of Biochemistry, Microbiology and Immunology, University of Ottawa, Ottawa, Ontario, Canada dDepartment of Orthopaedic Surgery, Ottawa Hospital and University of Ottawa, Ottawa, Ontario, Canada eDepartment of Pediatric Laboratory Medicine and Pathology, The Hospital for Sick Children, Toronto, Ontario, Canada fDepartment of Pathology and Laboratory Medicine, Ottawa Hospital and University of Ottawa, Ottawa, Ontario, Canada gGenetics and Genome Biology, Hospital for Sick Children, Toronto, Ontario, Canada hDepartment of Laboratory Medicine and Pathology, University of Toronto, Toronto, Ontario, Canada Received 9 August 2007; received in revised form 5 November 2007; accepted 7 November 2007 Abstract EWSeERG Ewing sarcoma (ES) gene fusions often result from complex chromosomal rearrange- ments. We report an unusually aggressive case of ES with an EWSeERG fusion gene that appeared to be a result of a simple balanced and reciprocal translocation, t(19;22)(q13.2;q12.2). Subsequent molecular investigation of the primary tumor, the metastasis, and a cell line generated from this ES permitted reconstruction of each genomic step in the evolution of this complex EWSeERG fusion.
    [Show full text]
  • COMPUTATIONAL MODELLING of PROTEIN FIBRILLATION with APPLICATION to GLUCAGON Hamed Tabatabaei Ghomi Purdue University
    Purdue University Purdue e-Pubs Open Access Dissertations Theses and Dissertations January 2015 COMPUTATIONAL MODELLING OF PROTEIN FIBRILLATION WITH APPLICATION TO GLUCAGON Hamed Tabatabaei Ghomi Purdue University Follow this and additional works at: https://docs.lib.purdue.edu/open_access_dissertations Recommended Citation Tabatabaei Ghomi, Hamed, "COMPUTATIONAL MODELLING OF PROTEIN FIBRILLATION WITH APPLICATION TO GLUCAGON" (2015). Open Access Dissertations. 1321. https://docs.lib.purdue.edu/open_access_dissertations/1321 This document has been made available through Purdue e-Pubs, a service of the Purdue University Libraries. Please contact [email protected] for additional information. i COMPUTATIONAL MODELLING OF PROTEIN FIBRILLATION WITH APPLICATION TO GLUCAGON A Dissertation Submitted to the Faculty of Purdue University by Hamed Tabatabaei Ghomi In Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy i December 2015 Purdue University West Lafayette, Indiana ii ای الهه ای رتاهن ام آشیاهن ام یس ای ربای شاد ز تن بهاهن ام قهرمان قصه اهی عاشقاهن ام نس با یم انم تو بهار می شود بذر شعراهی اتزه رد میان خاک بی رقار می شود ii iii ACKNOWLEDGEMENTS I am indebted to my advisors, Dr. Lill and Dr. Topp who taught me many things about science, and about life. Also, I thank my advisory committee, Dr. Park, Dr. Post and Dr. Kihara for all their support. I am grateful to my lovely wife, Elaheh. I owe all my success to her support and sacrifice. I am also grateful to my parent for their support and encouragement. And finally, I owe my deepest and greatest gratitude to God, the Most Beneficent, the Most Merciful.
    [Show full text]
  • S41419-021-03972-6.Pdf
    www.nature.com/cddis ARTICLE OPEN Primed to die: an investigation of the genetic mechanisms underlying noise-induced hearing loss and cochlear damage in homozygous Foxo3-knockout mice ✉ Holly J. Beaulac1,3, Felicia Gilels1,4, Jingyuan Zhang1,5, Sarah Jeoung2 and Patricia M. White 1 © The Author(s) 2021 The prevalence of noise-induced hearing loss (NIHL) continues to increase, with limited therapies available for individuals with cochlear damage. We have previously established that the transcription factor FOXO3 is necessary to preserve outer hair cells (OHCs) and hearing thresholds up to two weeks following mild noise exposure in mice. The mechanisms by which FOXO3 preserves cochlear cells and function are unknown. In this study, we analyzed the immediate effects of mild noise exposure on wild-type, Foxo3 heterozygous (Foxo3+/−), and Foxo3 knock-out (Foxo3−/−) mice to better understand FOXO3’s role(s) in the mammalian cochlea. We used confocal and multiphoton microscopy to examine well-characterized components of noise-induced damage including calcium regulators, oxidative stress, necrosis, and caspase-dependent and caspase-independent apoptosis. Lower immunoreactivity of the calcium buffer Oncomodulin in Foxo3−/− OHCs correlated with cell loss beginning 4 h post-noise exposure. Using immunohistochemistry, we identified parthanatos as the cell death pathway for OHCs. Oxidative stress response pathways were not significantly altered in FOXO3’s absence. We used RNA sequencing to identify and RT-qPCR to confirm differentially expressed genes. We further investigated a gene downregulated in the unexposed Foxo3−/− mice that may contribute to OHC noise susceptibility. Glycerophosphodiester phosphodiesterase domain containing 3 (GDPD3), a possible endogenous source of lysophosphatidic acid (LPA), has not previously been described in the cochlea.
    [Show full text]
  • Mouse Hpn Knockout Project (CRISPR/Cas9)
    https://www.alphaknockout.com Mouse Hpn Knockout Project (CRISPR/Cas9) Objective: To create a Hpn knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Hpn gene (NCBI Reference Sequence: NM_001110252 ; Ensembl: ENSMUSG00000001249 ) is located on Mouse chromosome 7. 14 exons are identified, with the ATG start codon in exon 2 and the TGA stop codon in exon 14 (Transcript: ENSMUST00000108102). Exon 2~5 will be selected as target site. Cas9 and gRNA will be co-injected into fertilized eggs for KO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Mice homozygous for a null mutation are hypothyroidic and develop profound hearing loss associated with structural changes in the tectorial membrane and a myelination defect affecting the compaction of spiral ganglion neurons. Exon 2 starts from the coding region. Exon 2~5 covers 16.59% of the coding region. The size of effective KO region: ~5780 bp. The KO region does not have any other known gene. Page 1 of 9 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 3 4 5 14 Legends Exon of mouse Hpn Knockout region Page 2 of 9 https://www.alphaknockout.com Overview of the Dot Plot (up) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 391 bp section upstream of Exon 2 is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis.
    [Show full text]
  • Protein Preliminaries and Structure Prediction Fundamentals For
    AN ARXIV PREPRINT 1 Protein preliminaries and structure prediction fundamentals for computer scientists Mahmood A. Rashid, Firas Khatib, and Abdul Sattar Abstract—Protein structure prediction is a chal- I. PROTEIN FUNDAMENTALS lenging and unsolved problem in computer science. Proteins are the sequence of amino acids connected Proteins are the principal constituents of the together by single peptide bond. The combinations of protoplasm of all cells. Proteins essentially con- the twenty primary amino acids are the constituents sist of amino acids, which are themselves bonded of all proteins. In-vitro laboratory methods used in by peptide linkages. In this section, we give an this problem are very time-consuming, cost-intensive, overview of protein preliminaries. and failure-prone. Thus, alternative computational methods come into play. The protein structure predic- tion problem is to find the three-dimensional native A. Amino acids structure of a protein, from its amino acid sequence. The native structure of a protein has the minimum Amino acids, also known as protein monomers free energy possible and arguably determines the or residues, are the molecules containing an amino function of the protein. In this study, we present the group, a carboxyl group, and a side-chain. This preliminaries of proteins and their structures, protein side-chain is the only component that varies be- structure prediction problem, and protein models. We tween different amino acids. Figure 1 shows the also give a brief overview on experimental and compu- tational methods used in protein structure prediction. generic structure of an amino acid. An amino This study will provide a fundamental knowledge to acid has the generic formula H2NCHROOH.
    [Show full text]
  • HPN (Human) Recombinant Protein (P01)
    HPN (Human) Recombinant Protein (P01) Catalog # : H00003249-P01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human HPN full-length ORF ( AAH25716.1, 40 a.a. - 417 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: VAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAG protein) LSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVIS VCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYD Antibody Production GAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGL QLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA Protein Array AGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFY GNQIKPKMFCAGYPEGGIDACQGDSGGPFACEDSISRTPRWRLCGIVS WGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL Host: Wheat Germ (in vitro) Theoretical MW 67.43 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Applications Enzyme-linked Immunoabsorbent Assay Page 1 of 2 2019/2/15 Western Blot (Recombinant protein) Antibody Production Protein Array Gene Information Entrez GeneID: 3249 GeneBank BC025716 Accession#: Protein AAH25716.1 Accession#: Gene Name: HPN Gene Alias: TMPRSS1 Gene hepsin
    [Show full text]
  • Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands That Promote Axonal Growth
    Research Article: New Research Development Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands that Promote Axonal Growth Jeremy S. Toma,1 Konstantina Karamboulas,1,ª Matthew J. Carr,1,2,ª Adelaida Kolaj,1,3 Scott A. Yuzwa,1 Neemat Mahmud,1,3 Mekayla A. Storer,1 David R. Kaplan,1,2,4 and Freda D. Miller1,2,3,4 https://doi.org/10.1523/ENEURO.0066-20.2020 1Program in Neurosciences and Mental Health, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada, 2Institute of Medical Sciences University of Toronto, Toronto, Ontario M5G 1A8, Canada, 3Department of Physiology, University of Toronto, Toronto, Ontario M5G 1A8, Canada, and 4Department of Molecular Genetics, University of Toronto, Toronto, Ontario M5G 1A8, Canada Abstract Peripheral nerves provide a supportive growth environment for developing and regenerating axons and are es- sential for maintenance and repair of many non-neural tissues. This capacity has largely been ascribed to paracrine factors secreted by nerve-resident Schwann cells. Here, we used single-cell transcriptional profiling to identify ligands made by different injured rodent nerve cell types and have combined this with cell-surface mass spectrometry to computationally model potential paracrine interactions with peripheral neurons. These analyses show that peripheral nerves make many ligands predicted to act on peripheral and CNS neurons, in- cluding known and previously uncharacterized ligands. While Schwann cells are an important ligand source within injured nerves, more than half of the predicted ligands are made by nerve-resident mesenchymal cells, including the endoneurial cells most closely associated with peripheral axons. At least three of these mesen- chymal ligands, ANGPT1, CCL11, and VEGFC, promote growth when locally applied on sympathetic axons.
    [Show full text]
  • Association of 19Q, 8Q24 Regions and Mismatch Repair (MMR) Genes with Prostate Cancer in Caucasians
    Association of 19q, 8q24 regions and Mismatch Repair (MMR) Genes with Prostate Cancer in Caucasians A dissertation submitted to the Division of Research and Advanced Studies of the University of Cincinnati in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY in the Department of Environmental Health of the College of Medicine June, 2008 by Prodipto Pal M.B.B.S., University of Calcutta, Calcutta, India, 2000 Committee: Dr. Ranjan Deka, Ph.D. (Chair) Dr.Ranajit Chakraborty, Ph.D. Dr. Charles Ralph Buncher D.Sc. Dr. Daniel Woo, M.S., M.D. Dr. Divakar Choubey, Ph.D. ABSTRACT Prostate cancer (PCa) is the most commonly diagnosed visceral malignancy with over one-third of all incident cancers and the second leading cause of cancer deaths in men in the United States. Age, ethnicity and family history are among the classical epidemiological risk factors. Both environmental and genetic factors contribute to the etiopathogenesis of PCa. The region on 19q11-13, identified through linkage and association studies, was previously shown to harbor genes for PCa susceptibility as well as for biologic aggressiveness. Recently, admixture mapping and a number of independently performed genome-wide association studies (GWAS) further identified strong association signals on chromosome 8q24. The only biologically plausible candidate gene for cancers on 8q24 is the myc oncogene, located ~500 kb downstream to the identified region. The myc protein is a key regulator of cell cycle, growth and differentiation, apoptosis, genomic instability and angiogenesis. At the cellular level, myc synergistically interacts with mutL homolog 1 (MLH1), one of the key genes in mismatch repair (MMR) of DNA.
    [Show full text]