DOCSLIB.ORG

Mouse Genetics • Mouse Strains

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text

Load more

3/2/20 Outline • History of the laboratory mouse Mouse Genetics • Mouse strains Heather A Lawson • Genetic mapping Department of Genetics • How do we find genes? Spring 2020 • Genetic Engineering • How do we analyze gene function? Why Mice? • 95% of their genome is similar to our own Three Main Subspecies: • Mice have short generation times and lifespans that make Mus musculus castaneus (southern and southeastern them easy to manage Asia) • Variety of inbred strains and genetic backgrounds give us Mus musculus domesticus (western Europe, the opportunity to closely examine the effects of genes and southwestern Asia, Americas, Africa, and Oceania) their interactions Mus musculus musculus (eastern Europe and northern • We have the technology to manipulate their genome Asia) directly and create models for human diseases • We have control over their environment Origin of Modern Classical Strains History of Mouse Genetics ~1850 Gregor Mendel begins genetic studies of coat colors in mice but turns to plants when the Bishop of his Abbey, Anton Schaffgoth, is critical of the requisite copulation. 1 3/2/20 Fancy Mice Become Lab Mice Husbandry Basics • 18-21 day gestation period ~1900 Abbie Lathrop 1908 William Castle opens • 21 day weaning breeds fancy mice at Harvard’s Bussy Institution Granby Farm, MA • Sexual maturity 6-8 weeks • Average birthweight: 1g • Average weaning weight: 8-12g Rex • Average adult weight: 20-30g Golden curly Angora Hereford History of Mouse Genetics Inbred Strain • Defined as the product of >20 generations of brother-sister matings 1909 Clarence Little • Individuals are ~98% identical begins to develop the first • After 40 generations of inbreeding, they inbred strain, designated are ~99.5% similar DBA for dilute, brown, • Inbreeding coefficient ~0.99 non-agouti. • Animals maintained at different institutions for many generations may show genetic drift Inbred Strain History of Mouse Genetics x AaBbCc AaBbCc x AABbCc AABbCc 1915 J.B.S. Haldane et al. publish the first genetic linkage study in mice. x AABBCc AABBCc x AABBCC AABBCC Inbred Strain 2 3/2/20 Linkage Mapping History of Mouse Genetics • Linkage refers to the presence of 2 or more genes on same chromosome • Tendency for traits to be inherited together • A linkage map is a genetic map showing the position of genes or genetic markers relative to each other 1926 Clarence Little starts • In terms of meiotic recombination frequency the Jackson Laboratory in Bar Harbor, Maine. LG/J www.jax.org Substrains Recombinant Inbred Strain • Branches of an inbred strain that have known or probable genetic differences • Branches of a strain that are separated before • Chromosomes are alternating th haplotypes of variable length that the 40 generation of inbreeding are inherited intact from the parents • Branches of a strain that have been maintained separately from other branches • Animals within a strain are for more than 10 generations of inbreeding genetically identical and • Example: C57B6 from different vendors are interchangeable NOT equivalent 3 3/2/20 Phenotypic Variation Among RI lines Examine RI Haplotype Structure High Fat Fed Females High Fat Fed Males LGXSM recombinant inbred line set - 16 RI lines Lines vary in progress towards diabetes Low Fat Fed Females Low Fat Fed Males - Allows studies of genetic LOD factors Cheverud et al., Diabetes 2004 Toth et al., Pathogens and Disease 2014 Advanced Intercross QTL Mapping • Statistically links two types of information 1. Phenotypic data • Variation in a measurable quantitative trait (e.g. height, weight, expression level) 2. Genotypic data • Variation at molecular markers • Attempt to explain genetic basis of variation in complex traits General Experimental Method QTL Mapping: correlating phenotypic variation with genotypic variation population measure phenotype 9 QTL Position 8 7 significance LOD 6 5 4 3 SignificAnce M1 M2 M3 M4 M… Mn 2 ThresholD LOD Scores = log(1/p) 1 Support Region genotype individuals 0 at Genomic Markers 0 50 100 * 150 200 (cM) extract DNA 4 3/2/20 QTL: region of the genome affecting LG/J X SM/J quantitative traits chr1 (qH2.3-qH3) 1qA1 qA3 1qA5 1qB qC1.1 C2 1qC3 C4 qC5 1qD E2.1 1qE2.3 1qE4 1qF H3 H4 H5 qH6 F1 LGxSM polymorphisms My Track RefSeq Genes Nuf2 Rgs4 Hsd17b7 Uap1 Olfml2b Dusp12 Fcgr3 Nr1i3 Nit1 Itln1 Rgs5 Ddr2 Sh2d1b1 Atf6 Fcgr4 Apoa2 Pvrl4 Cd244 1700084C01Rik Uhmk1 Fcrlb Sdhc Ufc1 F11r Ly9 Sh2d1b2 Fcrla Mpz Dedd Refbp2 1700015E13Rik Fcrla Pcp4l1 Pfdn2 Nos1ap Fcrla Tomm40l Pvrl4 Nos1ap Fcgr2b Fcer1g Usf1 Attribute F Fcgr2b Ndufs2 Tstd1 2 1700009P17Rik Ppox variation in Adamts4 B4galt3 phenotypes to SS LS LL Usp21 Dedd variation in QTL Klhdc9 Arhgap30 genotypes 30-Way Multiz Alignment & Conservation Mammal Cons Fn Fn Fn Fn Fn Fn Fn Fn Interbreeding Leads to Accumulation of Recombination (variation at loci) 5 3/2/20 Modified Quantitative Hybrid Complementation Test Identifying Genes and X Variants LG SM KO WT Identifying QTL LG KO LG WT SM KO SM WT QTL Limitations History of Mouse Genetics The population used defines the genetic variation ÞWe cannot find loci that are not variable Late 1940s George Snell develops ÞLocation: the actual gene may be far away congenic strains of mice by breeding for differences only at the H2 locus. ÞSome loci we find might be confounded (correlation with other traits) ÞInteraction effects: if the effect of a locus differs due to interactions with other loci, environment or phenotype, it can cancel out ÞGenetic background! Consomic and Congenic Strains T2dm1: A Fasting Plasma Glucose QTL on Chromosome 16 Parentals • Identify an interval of - LOD = 4.4 (p=3e-5) interest. F1 Offspring - Accounts for ~13% of • Backcross to generate variance in the F2 population F1 Gametes congenic strains carrying “Backcross” the interval of interest. - B6 |B6 and BTBR | BTBR homozygotes differ by ~120 mg/dl glucose F2 : Stoehr et al., (2000) Diabetes : Fn 6 3/2/20 Generation of Consomic Mice Figure 1. Chromosome 16 of BTBR mice contains diabetogenic alleles. 16 16 X B6 (receiver) BBTBR (donor) Repeated Backcrossing to Receiver Strain 16 B6.16BT Bhatnagar et al., (2013) PLOS Genetics Generation of Congenic Mice Figure 3. Effect on insulin secretion of introgressing 1.6 Mb of BTBR Chr 16 into B6 mice. 16 16 X B6 (receiver) BTBR (donor) Repeated Backcrossing to Receiver Strain 16 16 16 Bhatnagar et al., (2013) PLOS Genetics B6.16BT24-37 B6.16BT36-38 B6.16BT37-55 Figure 4. Plasma insulin and glucose levels in the B6.16BT36–38 male mice. Figure 6. Insulin secretion defective region narrowed to 0.94 Mb on mouse chromosome 16 containing 13 genes. Bhatnagar et al., (2013) PLOS Genetics Bhatnagar et al., (2013) PLOS Genetics 7 3/2/20 Genome Tagged Mice Heterogeneous Stock Eight strains - C57BL/6J, BALB/c, RIII, AKR, DBA/2, I, A, and C3H/2 Maintained for >60 generations Average recombination distance <4Mb The Collaborative Cross: Multi-parental Recombinant Inbred The Collaborative Cross Population “Funnel” mating scheme Eight strains - A/J, C57BL/6J, 129Sv/ImJ, NOD/LtJ, NZO/H1J, CAST/EiJ, PWK/PhJ, and WSB/EiJ Spans 90% of segregating variation in laboratory mice. Churchill et al., Nature Genetics 2004 Diversity Outbred Breeding Schemes for Outbred Populations Solberg-Woods, Physiological Genomics 2014 8 3/2/20 CC Recombinant Intercross (ccRIX) Panel Overcoming Loss Hybrid Mouse Diversity Panel of Heterozygosity •Panel of 100 strains •including ‘classic’ inbred strains and RI lines •Select strains based on experimental needs •Detailed genomic and phenotypic information for all strains is publically available Churchill et al., Nature Genetics 2004 Variation in Insulin Resistance Among Strains in HMD Differences in Resolution of GWAS of HDL Cholesterol Panel Parks et al., Cell Metabolism 2015 Flint and Eskin Nature Genetics 2012 History of Mouse Genetics Mouse Genome Statistics: Genes, Genome Features and Maps • 20 haploid chromosome (19, X, Y) • Diploid DNA content: 2.7x109 bp 2001-02 Sequencing of ‘the’ mouse genome is completed • 8-10% repetitive sequence • 47,116 Genes with nucleotide sequence data • 24,211 Genes with protein sequence data • 18,415 Genes with expression assay results • 150,339 Mapped genes/markers 9 3/2/20 Mouse Genomic Sequence Reveals Great www.informatics.jax.org/humanDisease.shtml Similarity with the Human Genome Extremely high conservation: 560,000 “anchors” Mouse-Human Comparison both genomes 2.5-3 billion bp long > 99% of genes have homologs > 95% of genome “syntenic” Whole Genome Sequences Can Inform Quantitative Trait Gene Identifying Variants in Apoa2 To Follow-up Identification Apoa2 Wang et al. Genome Research (2009) SM M K L L A M V A L L V T I C S L E G A L V K R Q A D G Q D M Q S L F T Q Y F Q S M T D Y G K D L M E K A K T S E I Q S Q A K A Y F E K T H E Q L T P L V R S A G T S L V N F F S S L M N L E E K P A P A A K AKR M K L L A M V A L L V T I C S L E G A L V K R Q A D G P D M Q S L F T Q Y F Q S M T E Y G K D L V E K A K T S E I Q S Q A K A Y F E K T H E Q L T P L V R S A G T S L V N F F S S L M N L E E K P A P A A K A_J M K L L A M V A L L V T I C S L E G A L V K R Q A D G Q D M Q S L F T Q Y F Q S M T E Y G K D L V E K A K T S E I Q S Q A K A Y F E K T H E Q L T P L V R S A G T S L V N F F S S L M N L E E K P A P A A K C57BL M K L L A M V A L L V T I C S L E G A L V K R Q A D G P D M Q S L F T Q Y F Q S M T D Y G K D L M E K A K T S E I Q S Q A K A Y F E K T H E Q L T P L V R S A G T S L V N F F S S L M N L E E K P A P A A K CAST M K L L A M V A L L V T I C S L E G A L V K R Q A D G P D M Q S L F T Q Y F Q S M T D Y G K D L M E K A K
Recommended publications
  • Role of Tomm40'523 – Apoe Haplotypes in Alzheimer's Disease Etiology

    Role of Tomm40'523 – Apoe Haplotypes in Alzheimer's Disease Etiology

    ROLE OF TOMM40’523 – APOE HAPLOTYPES IN ALZHEIMER’S DISEASE ETIOLOGY – FROM CLINICS TO MITOCHONDRIA RÈMY CARDOSO Tese para obtenção do grau de Doutor em EnvelHecimento e Doenças Crónicas Doutoramento em associação entre: Universidade NOVA de Lisboa (Faculdade de Ciências Médicas | NOVA Medical ScHool - FCM|NMS/UNL) Universidade de Coimbra (Faculdade de Medicina - FM/UC) Universidade do MinHo (Escola de Medicina - EMed/UM) Novembro, 2020 ROLE OF TOMM40’523 – APOE HAPLOTYPES IN ALZHEIMER’S DISEASE ETIOLOGY – FROM CLINICS TO MITOCHONDRIA Rèmy Cardoso Professora Doutora Catarina Resende Oliveira, Professora Catedrática Jubilada da FM/UC Professor Doutor Duarte Barral, Professor Associado da FCM|NMS/UNL Tese para obtenção do grau de Doutor em EnvelHecimento e Doenças Crónicas Doutoramento em associação entre: Universidade NOVA de Lisboa (Faculdade de Ciências Médicas | NOVA Medical ScHool - FCM|NMS/UNL) Universidade de Coimbra (Faculdade de Medicina - FM/UC) Universidade do MinHo (Escola de Medicina - EMed/UM) Novembro, 2020 This thesis was conducted at the Center for Neuroscience and Cell Biology (CNC.CIBB) of University of Coimbra and Coimbra University Hospital (CHUC) and was a collaboration of the following laboratories and departments with the supervision of Catarina Resende Oliveira MD, PhD, Full Professor of FM/UC and the co-supervision of Duarte Barral PhD, Associated professor of Nova Medical School, Universidade Nova de Lisboa: • Neurogenetics laboratory (CNC.CIBB) headed by Maria Rosário Almeida PhD • Neurochemistry laboratory (CHUC)
  • Establishing the Pathogenicity of Novel Mitochondrial DNA Sequence Variations: a Cell and Molecular Biology Approach

    Establishing the Pathogenicity of Novel Mitochondrial DNA Sequence Variations: a Cell and Molecular Biology Approach

    Mafalda Rita Avó Bacalhau Establishing the Pathogenicity of Novel Mitochondrial DNA Sequence Variations: a Cell and Molecular Biology Approach Tese de doutoramento do Programa de Doutoramento em Ciências da Saúde, ramo de Ciências Biomédicas, orientada pela Professora Doutora Maria Manuela Monteiro Grazina e co-orientada pelo Professor Doutor Henrique Manuel Paixão dos Santos Girão e pela Professora Doutora Lee-Jun C. Wong e apresentada à Faculdade de Medicina da Universidade de Coimbra Julho 2017 Faculty of Medicine Establishing the pathogenicity of novel mitochondrial DNA sequence variations: a cell and molecular biology approach Mafalda Rita Avó Bacalhau Tese de doutoramento do programa em Ciências da Saúde, ramo de Ciências Biomédicas, realizada sob a orientação científica da Professora Doutora Maria Manuela Monteiro Grazina; e co-orientação do Professor Doutor Henrique Manuel Paixão dos Santos Girão e da Professora Doutora Lee-Jun C. Wong, apresentada à Faculdade de Medicina da Universidade de Coimbra. Julho, 2017 Copyright© Mafalda Bacalhau e Manuela Grazina, 2017 Esta cópia da tese é fornecida na condição de que quem a consulta reconhece que os direitos de autor são pertença do autor da tese e do orientador científico e que nenhuma citação ou informação obtida a partir dela pode ser publicada sem a referência apropriada e autorização. This copy of the thesis has been supplied on the condition that anyone who consults it recognizes that its copyright belongs to its author and scientific supervisor and that no quotation from the
  • Analysis of Gene Expression Data for Gene Ontology

    Analysis of Gene Expression Data for Gene Ontology

    ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION A Thesis Presented to The Graduate Faculty of The University of Akron In Partial Fulfillment of the Requirements for the Degree Master of Science Robert Daniel Macholan May 2011 ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION Robert Daniel Macholan Thesis Approved: Accepted: _______________________________ _______________________________ Advisor Department Chair Dr. Zhong-Hui Duan Dr. Chien-Chung Chan _______________________________ _______________________________ Committee Member Dean of the College Dr. Chien-Chung Chan Dr. Chand K. Midha _______________________________ _______________________________ Committee Member Dean of the Graduate School Dr. Yingcai Xiao Dr. George R. Newkome _______________________________ Date ii ABSTRACT A tremendous increase in genomic data has encouraged biologists to turn to bioinformatics in order to assist in its interpretation and processing. One of the present challenges that need to be overcome in order to understand this data more completely is the development of a reliable method to accurately predict the function of a protein from its genomic information. This study focuses on developing an effective algorithm for protein function prediction. The algorithm is based on proteins that have similar expression patterns. The similarity of the expression data is determined using a novel measure, the slope matrix. The slope matrix introduces a normalized method for the comparison of expression levels throughout a proteome. The algorithm is tested using real microarray gene expression data. Their functions are characterized using gene ontology annotations. The results of the case study indicate the protein function prediction algorithm developed is comparable to the prediction algorithms that are based on the annotations of homologous proteins.
  • DEDD (NM 001039712) Human Untagged Clone Product Data

    DEDD (NM 001039712) Human Untagged Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC310813 DEDD (NM_001039712) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: DEDD (NM_001039712) Human Untagged Clone Tag: Tag Free Symbol: DEDD Synonyms: CASP8IP1; DEDD1; DEFT; FLDED1; KE05 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin Fully Sequenced ORF: >NCBI ORF sequence for NM_001039712, the custom clone sequence may differ by one or more nucleotides ATGGCGGGCCTAAAGCGGCGGGCAAGCCAGGTGTGGCCAGAAGAGCATGGTGAGCAGGAACATGGGCTGT ACAGCCTGCACCGCATGTTTGACATCGTGGGCACTCATCTGACACACAGAGATGTGCGCGTGCTTTCTTT CCTCTTTGTTGATGTCATTGATGACCACGAGCGTGGACTCATCCGAAATGGACGTGACTTCTTATTGGCA CTGGAGCGCCAGGGCCGCTGTGATGAAAGTAACTTTCGCCAGGTGCTGCAGCTGCTGCGCATCATCACTC GCCACGACCTGCTGCCCTACGTCACCCTCAAGAGGAGACGGGCTGTGTGCCCTGATCTTGTAGACAAGTA TCTGGAGGAGACATCAATTCGCTATGTGACCCCCAGAGCCCTCAGTGATCCAGAACCAAGGCCTCCCCAG CCCTCTAAAACAGTGCCTCCCCACTATCCTGTGGTGTGTTGCCCCACTTCGGGTCCTCAGATGTGTAGCA AGCGGCCAGCCCGAGGGAGAGCCACACTTGGGAGCCAGCGAAAACGCCGGAAGTCAGTGACACCAGATCC CAAGGAGAAGCAGACATGTGACATCAGACTGCGGGTTCGGGCTGAATACTGCCAGCATGAGACTGCTCTG CAGGGCAATGTCTTCTCTAACAAGCAGGACCCACTTGAGCGCCAGTTTGAGCGCTTTAACCAGGCCAACA CCATCCTCAAGTCCCGGGACCTGGGCTCCATCATCTGTGACATCAAGTTCTCTGAGCTCACCTACCTCGA TGCATTCTGGCGTGACTACATCAATGGCTCTTTATTAGAGGCACTTAAAGGTGTCTTCATCACAGACTCC CTCAAGCAAGCTGTGGGCCATGAAGCCATCAAGCTGCTGGTAAATGTAGACGAGGAGGACTATGAGCTGG
  • Characterization of Genomic Copy Number Variation in Mus Musculus Associated with the Germline of Inbred and Wild Mouse Populations, Normal Development, and Cancer

    Characterization of Genomic Copy Number Variation in Mus Musculus Associated with the Germline of Inbred and Wild Mouse Populations, Normal Development, and Cancer

    Western University Scholarship@Western Electronic Thesis and Dissertation Repository 4-18-2019 2:00 PM Characterization of genomic copy number variation in Mus musculus associated with the germline of inbred and wild mouse populations, normal development, and cancer Maja Milojevic The University of Western Ontario Supervisor Hill, Kathleen A. The University of Western Ontario Graduate Program in Biology A thesis submitted in partial fulfillment of the equirr ements for the degree in Doctor of Philosophy © Maja Milojevic 2019 Follow this and additional works at: https://ir.lib.uwo.ca/etd Part of the Genetics and Genomics Commons Recommended Citation Milojevic, Maja, "Characterization of genomic copy number variation in Mus musculus associated with the germline of inbred and wild mouse populations, normal development, and cancer" (2019). Electronic Thesis and Dissertation Repository. 6146. https://ir.lib.uwo.ca/etd/6146 This Dissertation/Thesis is brought to you for free and open access by Scholarship@Western. It has been accepted for inclusion in Electronic Thesis and Dissertation Repository by an authorized administrator of Scholarship@Western. For more information, please contact [email protected]. Abstract Mus musculus is a human commensal species and an important model of human development and disease with a need for approaches to determine the contribution of copy number variants (CNVs) to genetic variation in laboratory and wild mice, and arising with normal mouse development and disease. Here, the Mouse Diversity Genotyping array (MDGA)-approach to CNV detection is developed to characterize CNV differences between laboratory and wild mice, between multiple normal tissues of the same mouse, and between primary mammary gland tumours and metastatic lung tissue.
  • Detailed Analysis of Focal Chromosome Arm 1Q

    Detailed Analysis of Focal Chromosome Arm 1Q

    Detailed Analysis of Focal Chromosome Arm 1q and 6p Amplifications in Urothelial Carcinoma Reveals Complex Genomic Events on 1q, and SOX4 as a Possible Auxiliary Target on 6p. Eriksson, Pontus; Aine, Mattias; Sjödahl, Gottfrid; Staaf, Johan; Lindgren, David; Höglund, Mattias Published in: PLoS ONE DOI: 10.1371/journal.pone.0067222 2013 Link to publication Citation for published version (APA): Eriksson, P., Aine, M., Sjödahl, G., Staaf, J., Lindgren, D., & Höglund, M. (2013). Detailed Analysis of Focal Chromosome Arm 1q and 6p Amplifications in Urothelial Carcinoma Reveals Complex Genomic Events on 1q, and SOX4 as a Possible Auxiliary Target on 6p. PLoS ONE, 8(6), [e67222]. https://doi.org/10.1371/journal.pone.0067222 Total number of authors: 6 General rights Unless other specific re-use rights are stated the following general rights apply: Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the public portal Read more about Creative commons licenses: https://creativecommons.org/licenses/ Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim.
  • The Genomic Organization and Expression Pattern of the Low-Affinity Fc Gamma Receptors (Fcγr) in the Göttingen Minipig

    The Genomic Organization and Expression Pattern of the Low-Affinity Fc Gamma Receptors (Fcγr) in the Göttingen Minipig

    Immunogenetics (2019) 71:123–136 https://doi.org/10.1007/s00251-018-01099-1 ORIGINAL ARTICLE The genomic organization and expression pattern of the low-affinity Fc gamma receptors (FcγR) in the Göttingen minipig Jerome Egli1 & Roland Schmucki1 & Benjamin Loos1 & Stephan Reichl1 & Nils Grabole1 & Andreas Roller1 & Martin Ebeling1 & Alex Odermatt2 & Antonio Iglesias1 Received: 9 August 2018 /Accepted: 24 November 2018 /Published online: 18 December 2018 # The Author(s) 2018 Abstract Safety and efficacy of therapeutic antibodies are often dependent on their interaction with Fc receptors for IgG (FcγRs). The Göttingen minipig represents a valuable species for biomedical research but its use in preclinical studies with therapeutic antibodies is hampered by the lack of knowledge about the porcine FcγRs. Genome analysis and sequencing now enabled the localization of the previously described FcγRIIIa in the orthologous location to human FCGR3A. In addition, we identified nearby the gene coding for the hitherto undescribed putative porcine FcγRIIa. The 1′241 bp long FCGR2A cDNA translates to a 274aa transmembrane protein containing an extracellular region with high similarity to human and cattle FcγRIIa. Like in cattle, the intracellular part does not contain an immunoreceptor tyrosine-based activation motif (ITAM) as in human FcγRIIa. Flow cytometry of the whole blood and single-cell RNA sequencing of peripheral blood mononuclear cells (PBMCs) of Göttingen minipigs revealed the expression profile of all porcine FcγRs which is compared to human and mouse. The new FcγRIIa is mainly expressed on platelets making the minipig a good model to study IgG-mediated platelet activation and aggregation. In contrast to humans, minipig blood monocytes were found to express inhibitory FcγRIIb that could lead to the underestimation of FcγR-mediated effects of monocytes observed in minipig studies with therapeutic antibodies.
  • Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice

    Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice

    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia.
  • Chuanxiong Rhizoma Compound on HIF-VEGF Pathway and Cerebral Ischemia-Reperfusion Injury’S Biological Network Based on Systematic Pharmacology

    Chuanxiong Rhizoma Compound on HIF-VEGF Pathway and Cerebral Ischemia-Reperfusion Injury’S Biological Network Based on Systematic Pharmacology

    ORIGINAL RESEARCH published: 25 June 2021 doi: 10.3389/fphar.2021.601846 Exploring the Regulatory Mechanism of Hedysarum Multijugum Maxim.-Chuanxiong Rhizoma Compound on HIF-VEGF Pathway and Cerebral Ischemia-Reperfusion Injury’s Biological Network Based on Systematic Pharmacology Kailin Yang 1†, Liuting Zeng 1†, Anqi Ge 2†, Yi Chen 1†, Shanshan Wang 1†, Xiaofei Zhu 1,3† and Jinwen Ge 1,4* Edited by: 1 Takashi Sato, Key Laboratory of Hunan Province for Integrated Traditional Chinese and Western Medicine on Prevention and Treatment of 2 Tokyo University of Pharmacy and Life Cardio-Cerebral Diseases, Hunan University of Chinese Medicine, Changsha, China, Galactophore Department, The First 3 Sciences, Japan Hospital of Hunan University of Chinese Medicine, Changsha, China, School of Graduate, Central South University, Changsha, China, 4Shaoyang University, Shaoyang, China Reviewed by: Hui Zhao, Capital Medical University, China Background: Clinical research found that Hedysarum Multijugum Maxim.-Chuanxiong Maria Luisa Del Moral, fi University of Jaén, Spain Rhizoma Compound (HCC) has de nite curative effect on cerebral ischemic diseases, *Correspondence: such as ischemic stroke and cerebral ischemia-reperfusion injury (CIR). However, its Jinwen Ge mechanism for treating cerebral ischemia is still not fully explained. [email protected] †These authors share first authorship Methods: The traditional Chinese medicine related database were utilized to obtain the components of HCC. The Pharmmapper were used to predict HCC’s potential targets. Specialty section: The CIR genes were obtained from Genecards and OMIM and the protein-protein This article was submitted to interaction (PPI) data of HCC’s targets and IS genes were obtained from String Ethnopharmacology, a section of the journal database.
  • Real-Time Dynamics of Plasmodium NDC80 Reveals Unusual Modes of Chromosome Segregation During Parasite Proliferation Mohammad Zeeshan1,*, Rajan Pandey1,*, David J

    Real-Time Dynamics of Plasmodium NDC80 Reveals Unusual Modes of Chromosome Segregation During Parasite Proliferation Mohammad Zeeshan1,*, Rajan Pandey1,*, David J

    © 2020. Published by The Company of Biologists Ltd | Journal of Cell Science (2021) 134, jcs245753. doi:10.1242/jcs.245753 RESEARCH ARTICLE SPECIAL ISSUE: CELL BIOLOGY OF HOST–PATHOGEN INTERACTIONS Real-time dynamics of Plasmodium NDC80 reveals unusual modes of chromosome segregation during parasite proliferation Mohammad Zeeshan1,*, Rajan Pandey1,*, David J. P. Ferguson2,3, Eelco C. Tromer4, Robert Markus1, Steven Abel5, Declan Brady1, Emilie Daniel1, Rebecca Limenitakis6, Andrew R. Bottrill7, Karine G. Le Roch5, Anthony A. Holder8, Ross F. Waller4, David S. Guttery9 and Rita Tewari1,‡ ABSTRACT eukaryotic organisms to proliferate, propagate and survive. During Eukaryotic cell proliferation requires chromosome replication and these processes, microtubular spindles form to facilitate an equal precise segregation to ensure daughter cells have identical genomic segregation of duplicated chromosomes to the spindle poles. copies. Species of the genus Plasmodium, the causative agents of Chromosome attachment to spindle microtubules (MTs) is malaria, display remarkable aspects of nuclear division throughout their mediated by kinetochores, which are large multiprotein complexes life cycle to meet some peculiar and unique challenges to DNA assembled on centromeres located at the constriction point of sister replication and chromosome segregation. The parasite undergoes chromatids (Cheeseman, 2014; McKinley and Cheeseman, 2016; atypical endomitosis and endoreduplication with an intact nuclear Musacchio and Desai, 2017; Vader and Musacchio, 2017). Each membrane and intranuclear mitotic spindle. To understand these diverse sister chromatid has its own kinetochore, oriented to facilitate modes of Plasmodium cell division, we have studied the behaviour movement to opposite poles of the spindle apparatus. During and composition of the outer kinetochore NDC80 complex, a key part of anaphase, the spindle elongates and the sister chromatids separate, the mitotic apparatus that attaches the centromere of chromosomes to resulting in segregation of the two genomes during telophase.
  • C-Terminal Region (ARP58987 P050) Data Sheet

    C-Terminal Region (ARP58987 P050) Data Sheet

    CASP3 antibody - C-terminal region (ARP58987_P050) Data Sheet Product Number ARP58987_P050 Product Name CASP3 antibody - C-terminal region (ARP58987_P050) Size 50ug Gene Symbol CASP3 Alias Symbols CPP32; CPP32B; SCA-1 Nucleotide Accession# NM_032991 Protein Size (# AA) 277 amino acids Molecular Weight 12kDa Product Format Lyophilized powder NCBI Gene Id 836 Host Rabbit Clonality Polyclonal Official Gene Full Name Caspase 3, apoptosis-related cysteine peptidase Gene Family CASP This is a rabbit polyclonal antibody against CASP3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, Description of Target large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?

    Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?

    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.