DOCSLIB.ORG

C-Terminal Region (ARP58987 P050) Data Sheet

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
C-Terminal Region (ARP58987 P050) Data Sheet CASP3 antibody - C-terminal region (ARP58987_P050) Data Sheet Product Number ARP58987_P050 Product Name CASP3 antibody - C-terminal region (ARP58987_P050) Size 50ug Gene Symbol CASP3 Alias Symbols CPP32; CPP32B; SCA-1 Nucleotide Accession# NM_032991 Protein Size (# AA) 277 amino acids Molecular Weight 12kDa Product Format Lyophilized powder NCBI Gene Id 836 Host Rabbit Clonality Polyclonal Official Gene Full Name Caspase 3, apoptosis-related cysteine peptidase Gene Family CASP This is a rabbit polyclonal antibody against CASP3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, Description of Target large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. AR, ATN1, ATXN3, BIRC3, BIRC6, HTT, NDUFS1, NEO1, PARP1, PLEKHO1, XIAP, BIRC6, CFLAR, PSEN1, RB1, XIAP, ACIN1, ADD1, AIFM1, AKAP8, AKT1, APAF1, APP, AR, ARHGDIB, ATN1, BCAP31, BCAR1, BCL2, BID, BIRC2, BIRC3, BIRC5, BIRC6, BIRC7, BLM, BMX, BRCA1, CAD, CASP10, CASP3, CASP4, CASP6, CASP8, CASP9, CAST, CDC27, CDC42, CDH1, CDK11A, CDK11B, CDKN1A, CFLAR, CTNNB1, DCC, DCTN1, DEDD, DFFA, DSG3, EIF2AK2, EIF2S1, EIF3J, EIF4B, EIF4G2, FYN, GATA1, GOLGA3, GORASP1, GRIPAP1, GSN, GZMB, HCLS1, HIP1, HMGB1, HNRNPU, HSPD1, HSPE1, HTT, IL16, IL18, Partner Proteins KCNIP3, KRT18, LMNB1, LYN, MAP4K1, MAPK8IP3, MAPT, MCL1, MDM2, MDM4, MEF2A, MET, MLH1, MYL3, NEDD4, NFE2L2, NMT2, PAK2, PARG, PDE10A, PDE5A, PICALM, PIP5K1A, PKN1, PKN2, PLA2G4A, PPP3CA, PRKCQ, PRKCZ, PRKDC, PSEN1, PSEN2, PSIP1, PSME3, PTBP1, PTMA, PXN, RABEP1, RAC1, RAD51, RASA1, RB1, RFC1, ROCK1, SARS2, SLK, SP1, SPTAN1, SREBF2, SRF, SRP72, STK24, STK3, STK4, TFAP2A, TGM2, TOP1, TRAF1, TRAF3, UBE4B, USO1, VAV1, VIM, WEE1, XIAP, YWHAE, BCL2, BID, BIRC2, BIRC3, BIRC5, BIRC7, BLM, BMX, CASP10, CASP2, CASP3, CASP6, CASP8, CFLAR, CFLAR, CTTN, DBNL, DCC, GORASP1, GRIPAP1, HCLS1, HSPD1, HSPE1, MAP3K14, MCL1, NDUFS1, PARG, SREBF2, SRP72, TNS4, TRAF3, USO1, XIAP Reconstitution and Add 50 ul of distilled water. Final anti-CASP3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-CASP3 antibody is Catalog # AAP58987 (Previous Catalog # AAPP44954) Immunogen The immunogen for anti-CASP3 antibody: synthetic peptide directed towards the C terminal of human CASP3 Swissprot Id P42574 Protein Name Caspase-3 Protein Accession # NP_116786 Purification Affinity Purified Species Reactivity Human, Pig, Rabbit, Rat, Horse, Dog, Bovine, Guinea pig, Goat, Sheep, Mouse Application IHC, WB Predicted Homology Based on Immunogen Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 91%; Goat: 86%; Mouse: 86%; Sheep: 86%; Guinea pig: 86% Sequence Human Macrophage Image 1 Human Macrophage Human THP1 WB Suggested Anti-CASP3 Antibody Titration: 0.2-1 ug/ml Image 2 ELISA Titer: 1:1562500 Positive Control: THP-1 cell lysate __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Load more

Recommended publications
  • Epigenetic Reprogramming Sensitizes CML Stem Cells to Combined EZH2 and Tyrosine
    Published OnlineFirst September 14, 2016; DOI: 10.1158/2159-8290.CD-16-0263 RESEARCH BRIEF Epigenetic Reprogramming Sensitizes CML Stem Cells to Combined EZH2 and Tyrosine Kinase Inhibition Mary T. Scott 1 , 2 , Koorosh Korfi 1 , 2 , Peter Saffrey 1 , Lisa E.M. Hopcroft 2 , Ross Kinstrie 1 , Francesca Pellicano 2 , Carla Guenther 1 , 2 , Paolo Gallipoli 2 , Michelle Cruz 1 , Karen Dunn 2 , Heather G. Jorgensen 2 , Jennifer E. Cassels 2 , Ashley Hamilton 2 , Andrew Crossan 1 , Amy Sinclair 2 , Tessa L. Holyoake 2 , and David Vetrie 1 ABSTRACT A major obstacle to curing chronic myeloid leukemia (CML) is residual disease main- tained by tyrosine kinase inhibitor (TKI)–persistent leukemic stem cells (LSC). These are BCR–ABL1 kinase independent, refractory to apoptosis, and serve as a reservoir to drive relapse or TKI resistance. We demonstrate that Polycomb Repressive Complex 2 is misregulated in chronic phase CML LSCs. This is associated with extensive reprogramming of H3K27me3 targets in LSCs, thus sensi- tizing them to apoptosis upon treatment with an EZH2-specifi c inhibitor (EZH2i). EZH2i does not impair normal hematopoietic stem cell survival. Strikingly, treatment of primary CML cells with either EZH2i or TKI alone caused signifi cant upregulation of H3K27me3 targets, and combined treatment further potentiated these effects and resulted in signifi cant loss of LSCs compared to TKI alone, in vitro , and in long-term bone marrow murine xenografts. Our fi ndings point to a promising epigenetic-based thera- peutic strategy to more effectively target LSCs in patients with CML receiving TKIs. SIGNIFICANCE: In CML, TKI-persistent LSCs remain an obstacle to cure, and approaches to eradicate them remain a signifi cant unmet clinical need.
    [Show full text]
  • Gene Essentiality Landscape and Druggable Oncogenic Dependencies in Herpesviral Primary Effusion Lymphoma
    ARTICLE DOI: 10.1038/s41467-018-05506-9 OPEN Gene essentiality landscape and druggable oncogenic dependencies in herpesviral primary effusion lymphoma Mark Manzano1, Ajinkya Patil1, Alexander Waldrop2, Sandeep S. Dave2, Amir Behdad3 & Eva Gottwein1 Primary effusion lymphoma (PEL) is caused by Kaposi’s sarcoma-associated herpesvirus. Our understanding of PEL is poor and therefore treatment strategies are lacking. To address this 1234567890():,; need, we conducted genome-wide CRISPR/Cas9 knockout screens in eight PEL cell lines. Integration with data from unrelated cancers identifies 210 genes as PEL-specific oncogenic dependencies. Genetic requirements of PEL cell lines are largely independent of Epstein-Barr virus co-infection. Genes of the NF-κB pathway are individually non-essential. Instead, we demonstrate requirements for IRF4 and MDM2. PEL cell lines depend on cellular cyclin D2 and c-FLIP despite expression of viral homologs. Moreover, PEL cell lines are addicted to high levels of MCL1 expression, which are also evident in PEL tumors. Strong dependencies on cyclin D2 and MCL1 render PEL cell lines highly sensitive to palbociclib and S63845. In summary, this work comprehensively identifies genetic dependencies in PEL cell lines and identifies novel strategies for therapeutic intervention. 1 Department of Microbiology-Immunology, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA. 2 Duke Cancer Institute and Center for Genomic and Computational Biology, Duke University, Durham, NC 27708, USA. 3 Department of Pathology, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA. Correspondence and requests for materials should be addressed to E.G. (email: [email protected]) NATURE COMMUNICATIONS | (2018) 9:3263 | DOI: 10.1038/s41467-018-05506-9 | www.nature.com/naturecommunications 1 ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/s41467-018-05506-9 he human oncogenic γ-herpesvirus Kaposi’s sarcoma- (IRF4), a critical oncogene in multiple myeloma33.
    [Show full text]
  • DEDD (NM 001039712) Human Untagged Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC310813 DEDD (NM_001039712) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: DEDD (NM_001039712) Human Untagged Clone Tag: Tag Free Symbol: DEDD Synonyms: CASP8IP1; DEDD1; DEFT; FLDED1; KE05 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin Fully Sequenced ORF: >NCBI ORF sequence for NM_001039712, the custom clone sequence may differ by one or more nucleotides ATGGCGGGCCTAAAGCGGCGGGCAAGCCAGGTGTGGCCAGAAGAGCATGGTGAGCAGGAACATGGGCTGT ACAGCCTGCACCGCATGTTTGACATCGTGGGCACTCATCTGACACACAGAGATGTGCGCGTGCTTTCTTT CCTCTTTGTTGATGTCATTGATGACCACGAGCGTGGACTCATCCGAAATGGACGTGACTTCTTATTGGCA CTGGAGCGCCAGGGCCGCTGTGATGAAAGTAACTTTCGCCAGGTGCTGCAGCTGCTGCGCATCATCACTC GCCACGACCTGCTGCCCTACGTCACCCTCAAGAGGAGACGGGCTGTGTGCCCTGATCTTGTAGACAAGTA TCTGGAGGAGACATCAATTCGCTATGTGACCCCCAGAGCCCTCAGTGATCCAGAACCAAGGCCTCCCCAG CCCTCTAAAACAGTGCCTCCCCACTATCCTGTGGTGTGTTGCCCCACTTCGGGTCCTCAGATGTGTAGCA AGCGGCCAGCCCGAGGGAGAGCCACACTTGGGAGCCAGCGAAAACGCCGGAAGTCAGTGACACCAGATCC CAAGGAGAAGCAGACATGTGACATCAGACTGCGGGTTCGGGCTGAATACTGCCAGCATGAGACTGCTCTG CAGGGCAATGTCTTCTCTAACAAGCAGGACCCACTTGAGCGCCAGTTTGAGCGCTTTAACCAGGCCAACA CCATCCTCAAGTCCCGGGACCTGGGCTCCATCATCTGTGACATCAAGTTCTCTGAGCTCACCTACCTCGA TGCATTCTGGCGTGACTACATCAATGGCTCTTTATTAGAGGCACTTAAAGGTGTCTTCATCACAGACTCC CTCAAGCAAGCTGTGGGCCATGAAGCCATCAAGCTGCTGGTAAATGTAGACGAGGAGGACTATGAGCTGG
    [Show full text]
  • Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice
    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia.
    [Show full text]
  • Supplementary Material and Methods
    Supplementary material and methods Generation of cultured human epidermal sheets Normal human epidermal keratinocytes were isolated from human breast skin. Keratinocytes were grown on a feeder layer of irradiated human fibroblasts pre-seeded at 4000 cells /cm² in keratinocyte culture medium (KCM) containing a mix of 3:1 DMEM and HAM’s F12 (Invitrogen, Carlsbad, USA), supplemented with 10% FCS, 10ng/ml epidermal growth factor (EGF; R&D systems, Minneapolis, MN, USA), 0.12 IU/ml insulin (Lilly, Saint- Cloud, France), 0.4 mg/ml hydrocortisone (UpJohn, St Quentin en Yvelelines, France) , 5 mg/ml triiodo-L- thyronine (Sigma, St Quentin Fallavier, France), 24.3 mg/ml adenine (Sigma), isoproterenol (Isuprel, Hospira France, Meudon, France) and antibiotics (20 mg/ml gentamicin (Phanpharma, Fougères, France), 100 IU/ml penicillin (Phanpharma), and 1 mg/ml amphotericin B (Phanpharma)). The medium was changed every two days. NHEK were then cultured over a period of 13 days according to the protocol currently used at the Bank of Tissues and Cells for the generation of clinical grade epidermal sheets used for the treatment of severe extended burns (Ref). When needed, cells were harvested with trypsin-EDTA 0.05% (Thermo Fisher Scientific, Waltham, MA, USA) and collected for analysis. Clonogenic assay Keratinocytes were seeded on a feeder layer of irradiated fibroblasts, at a clonal density of 10-20 cells/cm² and cultivated for 10 to 14 days. Three flasks per tested condition were fixed and colored in a single 30 mns step using rhodamine B (Sigma) diluted at 0.01 g/ml in 4% paraformaldehyde. In each tested condition, cells from 3 other flasks were numerated after detachment by trypsin treatment.
    [Show full text]
  • Elabscience®
    Tel:240-252-7368(USA) Fax:240-252-7376(USA) www.elabscience.com ® E-mail:[email protected] Elabscience Elabscience Biotechnology Inc. DEDD Polyclonal Antibody Catalog No. E-AB-67706 Reactivity H,M,R Storage Store at -20°C. Avoid freeze / thaw cycles. Host Rabbit Applications IHC Isotype IgG Note: Centrifuge before opening to ensure complete recovery of vial contents. Images Immunogen Information Immunogen Recombinant fusion protein of human DEDD (NP_001034801.1). GeneID 9191 Swissprot O75618 Synonyms DEDD,CASP8IP1,DEDD1,DEFT,FLDED1,KE05 Immunohistochemistry of paraffin- Product Information embedded Rat lung using DEDD Buffer PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Polyclonal Antibody at dilution of Purify Affinity purification 1:100 (40x lens). Dilution IHC 1:50-1:100 Background This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, Immunohistochemistry of paraffin- regulators and executors of the programmed cell death pathway. embedded Human esophagus using Overexpression of this gene was shown to induce weak apoptosis. Upon DEDD Polyclonal Antibody at dilution stimulation, this protein was found to translocate from cytoplasm to of 1:100 (40x lens). nucleus and colocalize with UBTF, a basal factor required for RNA polymerase I transcription, in the nucleolus. At least three transcript variants encoding the same protein have been found for this gene. Immunohistochemistry of paraffin- embedded Mouse kidney using DEDD Polyclonal Antibody at dilution of 1:100 (40x lens). For Research Use Only Focus on your research Thank you for your recent purchase. If you would like to learn more about antibodies,please visit www.elabscience.com.
    [Show full text]
  • The Human Cytomegalovirus–Encoded Chemokine Receptor US28 Promotes Angiogenesis and Tumor Formation Via Cyclooxygenase-2
    Published OnlineFirst March 24, 2009; DOI: 10.1158/0008-5472.CAN-08-2487 Research Article The Human Cytomegalovirus–Encoded Chemokine Receptor US28 Promotes Angiogenesis and Tumor Formation via Cyclooxygenase-2 David Maussang,1 Ellen Langemeijer,1 Carlos P. Fitzsimons,1 Marijke Stigter-van Walsum,2 Remco Dijkman,3 Martin K. Borg,3 Erik Slinger,1 Andreas Schreiber,4 Detlef Michel,4 Cornelis P. Tensen,3 Guus A.M.S. van Dongen,2 Rob Leurs,1 and Martine J. Smit1 1Leiden/Amsterdam Center for Drug Research, Division of Medicinal Chemistry, Faculty of Sciences, Vrije Universiteit Amsterdam; 2Department of Otolaryngology/Head and Neck Surgery, Vrije Universiteit Medical Center, Amsterdam, the Netherlands; 3Department of Dermatology, Leiden University Medical Center, Leiden, the Netherlands; and 4Institute of Virology, University Clinic Ulm, Ulm, Germany Abstract considered an oncogenic herpesvirus (5), but it has been suggested The human cytomegalovirus (HCMV), potentially associated to act as an oncomodulator (6). The presence of HCMV proteins with the development of malignancies, encodes the constitu- has been detected in several malignancies, such as colon cancer (7), tively active chemokine receptor US28. Previously, we have malignant glioblastoma (8), and breast cancer (9). Importantly, shown that US28 expression induces an oncogenic phenotype HCMV preferably infects tumor cells, leading to enhanced cell both in vitro and in vivo. Microarray analysis revealed proliferation, angiogenesis, and resistance to apoptosis (6, 10). differential expression of genes involved in oncogenic signal- Of interest, most herpesviruses contain one or more genes that ing in US28-expressing NIH-3T3 cells. In particular, the encode for constitutively active G-protein coupled receptors (1).
    [Show full text]
  • MIND Bomb 2 Prevents RIPK1 Kinase Activity-Dependent and -Independent Apoptosis Through Ubiquitylation of Cflipl
    ARTICLE https://doi.org/10.1038/s42003-020-01603-y OPEN MIND bomb 2 prevents RIPK1 kinase activity-dependent and -independent apoptosis through ubiquitylation of cFLIPL Osamu Nakabayashi 1, Hirotaka Takahashi2, Kenta Moriwaki1, Sachiko Komazawa-Sakon1, Fumiaki Ohtake3, 1234567890():,; Shin Murai 1, Yuichi Tsuchiya1, Yuki Koyahara1, Yasushi Saeki 4, Yukiko Yoshida4, Soh Yamazaki1, ✉ Fuminori Tokunaga 5, Tatsuya Sawasaki 2 & Hiroyasu Nakano 1 Mind bomb 2 (MIB2) is an E3 ligase involved in Notch signalling and attenuates TNF-induced apoptosis through ubiquitylation of receptor-interacting protein kinase 1 (RIPK1) and cylin- dromatosis. Here we show that MIB2 bound and conjugated K48– and K63–linked poly- ubiquitin chains to a long-form of cellular FLICE-inhibitory protein (cFLIPL), a catalytically inactive homologue of caspase 8. Deletion of MIB2 did not impair the TNF-induced complex I formation that mediates NF-κB activation but significantly enhanced formation of cytosolic death-inducing signalling complex II. TNF-induced RIPK1 Ser166 phosphorylation, a hallmark of RIPK1 death-inducing activity, was enhanced in MIB2 knockout cells, as was RIPK1 kinase activity-dependent and -independent apoptosis. Moreover, RIPK1 kinase activity-independent apoptosis was induced in cells expressing cFLIPL mutants lacking MIB2-dependent ubiqui- tylation. Together, these results suggest that MIB2 suppresses both RIPK1 kinase activity- dependent and -independent apoptosis, through suppression of RIPK1 kinase activity and ubiquitylation of cFLIPL, respectively. 1 Department of Biochemistry, Toho University School of Medicine, 5-21-16 Omori-Nishi, Ota-ku, Tokyo 143-8540, Japan. 2 Division of Cell-Free Sciences, Proteo-Science Center (PROS), 3 Bunkyo-cho, Matsuyama, Ehime 790-8577, Japan.
    [Show full text]
  • The Pseudo-Caspase FLIP(L) Regulates Cell Fate Following P53 Activation
    The pseudo-caspase FLIP(L) regulates cell fate following p53 activation Andrea Leesa,1, Alexander J. McIntyrea,1, Nyree T. Crawforda, Fiammetta Falconea, Christopher McCanna, Caitriona Holohana, Gerard P. Quinna, Jamie Z. Robertsa, Tamas Sesslera, Peter F. Gallaghera, Gemma M. A. Gregga, Katherine McAllistera, Kirsty M. McLaughlina, Wendy L. Allena, Laurence J. Eganb, Aideen E. Ryanb,c, Melissa J. Labonte-Wilsona, Philip D. Dunnea, Mark Wappetta, Vicky M. Coylea, Patrick G. Johnstona, Emma M. Kerra, Daniel B. Longleya,2,3, and Simon S. McDadea,2,3 aPatrick G Johnston Centre for Cancer Research, Queen’s University Belfast, Belfast, Northern Ireland BT9 7BL, United Kingdom; bDiscipline of Pharmacology & Therapeutics, Lambe Institute for Translational Research, School of Medicine, College of Medicine, Nursing and Health Sciences, National University of Ireland Galway, Galway, Ireland; and cRegenerative Medicine Institute, College of Medicine, Nursing and Health Sciences, National University of Ireland Galway, Galway, Ireland Edited by Karen H. Vousden, Francis Crick Institute, London, United Kingdom, and approved June 8, 2020 (received for review February 12, 2020) p53 is the most frequently mutated, well-studied tumor-suppressor switch from cell-cycle arrest to cell death induction remain gene, yet the molecular basis of the switch from p53-induced cell- poorly understood, although p53-mediated transcriptional up- cycle arrest to apoptosis remains poorly understood. Using a combi- regulation of PUMA has been suggested to be crucial in a nation of transcriptomics and functional genomics, we unexpectedly number of studies (10, 11). identified a nodal role for the caspase-8 paralog and only human Despite p53/TP53 being the most frequently mutated gene in pseudo-caspase, FLIP(L), in regulating this switch.
    [Show full text]
  • The Human Gene Connectome As a Map of Short Cuts for Morbid Allele Discovery
    The human gene connectome as a map of short cuts for morbid allele discovery Yuval Itana,1, Shen-Ying Zhanga,b, Guillaume Vogta,b, Avinash Abhyankara, Melina Hermana, Patrick Nitschkec, Dror Friedd, Lluis Quintana-Murcie, Laurent Abela,b, and Jean-Laurent Casanovaa,b,f aSt. Giles Laboratory of Human Genetics of Infectious Diseases, Rockefeller Branch, The Rockefeller University, New York, NY 10065; bLaboratory of Human Genetics of Infectious Diseases, Necker Branch, Paris Descartes University, Institut National de la Santé et de la Recherche Médicale U980, Necker Medical School, 75015 Paris, France; cPlateforme Bioinformatique, Université Paris Descartes, 75116 Paris, France; dDepartment of Computer Science, Ben-Gurion University of the Negev, Beer-Sheva 84105, Israel; eUnit of Human Evolutionary Genetics, Centre National de la Recherche Scientifique, Unité de Recherche Associée 3012, Institut Pasteur, F-75015 Paris, France; and fPediatric Immunology-Hematology Unit, Necker Hospital for Sick Children, 75015 Paris, France Edited* by Bruce Beutler, University of Texas Southwestern Medical Center, Dallas, TX, and approved February 15, 2013 (received for review October 19, 2012) High-throughput genomic data reveal thousands of gene variants to detect a single mutated gene, with the other polymorphic genes per patient, and it is often difficult to determine which of these being of less interest. This goes some way to explaining why, variants underlies disease in a given individual. However, at the despite the abundance of NGS data, the discovery of disease- population level, there may be some degree of phenotypic homo- causing alleles from such data remains somewhat limited. geneity, with alterations of specific physiological pathways under- We developed the human gene connectome (HGC) to over- come this problem.
    [Show full text]
  • MCL1 and DEDD Promote Urothelial Carcinoma Progression
    Author Manuscript Published OnlineFirst on February 18, 2019; DOI: 10.1158/1541-7786.MCR-18-0963 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. MCL1 and DEDD promote urothelial carcinoma progression Andrew L. Hong1,2,3, Jennifer L. Guerriero2, Mihir B. Doshi3, Bryan D. Kynnap2, Won Jun Kim2, Anna C. Schinzel2, Rebecca Modiste2, Amy J. Schlauch2, Rosalyn M. Adam1, David J. Kwiatkowski2,4, Rameen Beroukhim2,3, Anthony Letai2, Jonathan E. Rosenberg5,6,7, William C. Hahn2,3,4,7 1Boston Children’s Hospital, 300 Longwood Avenue, Boston, Massachusetts, 02115, USA 2Dana-Farber Cancer Institute, 450 Brookline Avenue, Boston, Massachusetts, 02215 USA 3Broad Institute of Harvard and MIT, 415 Main Street, Cambridge, Massachusetts, 02142 USA 4Brigham and Women’s Hospital, 75 Francis Street, Boston, Massachusetts, 02115 USA 5Memorial Sloan Kettering Cancer Center, 1275 York Avenue, New York, New York 10065, USA. 6Weill Cornell Medical College, 1300 York Avenue, New York, NY 10065, USA. 7These authors jointly directed this work. Running title: MCL1 and DEDD promote urothelial carcinoma progression The authors declare the following competing financial interests: J.L.G. receives sponsored research support from Eli Lilly and GlaxoSmithKline and is a paid consultant for GlaxoSmithKline. D.J.K. is a consultant for Genentech, AADi, and Novartis. R.B. receives 1 Downloaded from mcr.aacrjournals.org on September 24, 2021. © 2019 American Association for Cancer Research. Author Manuscript Published OnlineFirst on February 18, 2019; DOI: 10.1158/1541-7786.MCR-18-0963 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited.
    [Show full text]
  • NIK Controls Classical and Alternative NF-Kb Activation and Is Necessary for the Survival of Human T-Cell Lymphoma Cells
    Published OnlineFirst March 27, 2013; DOI: 10.1158/1078-0432.CCR-12-3151 Clinical Cancer Human Cancer Biology Research NIK Controls Classical and Alternative NF-kB Activation and Is Necessary for the Survival of Human T-cell Lymphoma Cells Lina Odqvist1, Margarita Sanchez-Beato 1,3, Santiago Montes-Moreno1,10, Esperanza Martín-Sanchez 1, Raquel Pajares2, Lydia Sanchez-Verde 2, Pablo L. Ortiz-Romero4, Jose Rodriguez5, Socorro M. Rodríguez-Pinilla1,6, Francisca Iniesta-Martínez9, Juan Carlos Solera-Arroyo11, Rafael Ramos-Asensio12, Teresa Flores13, Javier Menarguez Palanca7, Federico García Bragado14, Purificacion Domínguez Franjo8, and Miguel A. Piris1,10 Abstract Purpose: Peripheral T-cell lymphomas (PTCL) are a heterogeneous entity of neoplasms with poor prognosis, a lack of effective therapies, and a largely unknown molecular pathology. Deregulated NF-kB activity has been associated with several lymphoproliferative diseases, but its importance in T-cell lymphomagenesis is poorly understood. We investigated the function of the NF-kB–inducing kinase (NIK), in this pathway and its role as a potential molecular target in T-cell lymphomas. Experimental Design: We used immunohistochemistry to analyze the expression of different NF-kB members in primary human PTCL samples and to study its clinical impact. With the aim of inhibiting the pathway, we used genetic silencing of NIK in several T-cell lymphoma cell lines and observed its effect on downstream targets and cell viability. Results: We showed that the NF-kB pathway was activated in a subset of PTCLs associated with poor overall survival. NIK was overexpressed in a number of PTCL cell lines and primary samples, and a pivotal role for NIK in the survival of these tumor cells was unveiled.
    [Show full text]