
CASP3 antibody - C-terminal region (ARP58987_P050) Data Sheet Product Number ARP58987_P050 Product Name CASP3 antibody - C-terminal region (ARP58987_P050) Size 50ug Gene Symbol CASP3 Alias Symbols CPP32; CPP32B; SCA-1 Nucleotide Accession# NM_032991 Protein Size (# AA) 277 amino acids Molecular Weight 12kDa Product Format Lyophilized powder NCBI Gene Id 836 Host Rabbit Clonality Polyclonal Official Gene Full Name Caspase 3, apoptosis-related cysteine peptidase Gene Family CASP This is a rabbit polyclonal antibody against CASP3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, Description of Target large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. AR, ATN1, ATXN3, BIRC3, BIRC6, HTT, NDUFS1, NEO1, PARP1, PLEKHO1, XIAP, BIRC6, CFLAR, PSEN1, RB1, XIAP, ACIN1, ADD1, AIFM1, AKAP8, AKT1, APAF1, APP, AR, ARHGDIB, ATN1, BCAP31, BCAR1, BCL2, BID, BIRC2, BIRC3, BIRC5, BIRC6, BIRC7, BLM, BMX, BRCA1, CAD, CASP10, CASP3, CASP4, CASP6, CASP8, CASP9, CAST, CDC27, CDC42, CDH1, CDK11A, CDK11B, CDKN1A, CFLAR, CTNNB1, DCC, DCTN1, DEDD, DFFA, DSG3, EIF2AK2, EIF2S1, EIF3J, EIF4B, EIF4G2, FYN, GATA1, GOLGA3, GORASP1, GRIPAP1, GSN, GZMB, HCLS1, HIP1, HMGB1, HNRNPU, HSPD1, HSPE1, HTT, IL16, IL18, Partner Proteins KCNIP3, KRT18, LMNB1, LYN, MAP4K1, MAPK8IP3, MAPT, MCL1, MDM2, MDM4, MEF2A, MET, MLH1, MYL3, NEDD4, NFE2L2, NMT2, PAK2, PARG, PDE10A, PDE5A, PICALM, PIP5K1A, PKN1, PKN2, PLA2G4A, PPP3CA, PRKCQ, PRKCZ, PRKDC, PSEN1, PSEN2, PSIP1, PSME3, PTBP1, PTMA, PXN, RABEP1, RAC1, RAD51, RASA1, RB1, RFC1, ROCK1, SARS2, SLK, SP1, SPTAN1, SREBF2, SRF, SRP72, STK24, STK3, STK4, TFAP2A, TGM2, TOP1, TRAF1, TRAF3, UBE4B, USO1, VAV1, VIM, WEE1, XIAP, YWHAE, BCL2, BID, BIRC2, BIRC3, BIRC5, BIRC7, BLM, BMX, CASP10, CASP2, CASP3, CASP6, CASP8, CFLAR, CFLAR, CTTN, DBNL, DCC, GORASP1, GRIPAP1, HCLS1, HSPD1, HSPE1, MAP3K14, MCL1, NDUFS1, PARG, SREBF2, SRP72, TNS4, TRAF3, USO1, XIAP Reconstitution and Add 50 ul of distilled water. Final anti-CASP3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-CASP3 antibody is Catalog # AAP58987 (Previous Catalog # AAPP44954) Immunogen The immunogen for anti-CASP3 antibody: synthetic peptide directed towards the C terminal of human CASP3 Swissprot Id P42574 Protein Name Caspase-3 Protein Accession # NP_116786 Purification Affinity Purified Species Reactivity Human, Pig, Rabbit, Rat, Horse, Dog, Bovine, Guinea pig, Goat, Sheep, Mouse Application IHC, WB Predicted Homology Based on Immunogen Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 91%; Goat: 86%; Mouse: 86%; Sheep: 86%; Guinea pig: 86% Sequence Human Macrophage Image 1 Human Macrophage Human THP1 WB Suggested Anti-CASP3 Antibody Titration: 0.2-1 ug/ml Image 2 ELISA Titer: 1:1562500 Positive Control: THP-1 cell lysate __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-