DOCSLIB.ORG

The Pseudo-Caspase FLIP(L) Regulates Cell Fate Following P53 Activation

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Pseudo-Caspase FLIP(L) Regulates Cell Fate Following P53 Activation The pseudo-caspase FLIP(L) regulates cell fate following p53 activation Andrea Leesa,1, Alexander J. McIntyrea,1, Nyree T. Crawforda, Fiammetta Falconea, Christopher McCanna, Caitriona Holohana, Gerard P. Quinna, Jamie Z. Robertsa, Tamas Sesslera, Peter F. Gallaghera, Gemma M. A. Gregga, Katherine McAllistera, Kirsty M. McLaughlina, Wendy L. Allena, Laurence J. Eganb, Aideen E. Ryanb,c, Melissa J. Labonte-Wilsona, Philip D. Dunnea, Mark Wappetta, Vicky M. Coylea, Patrick G. Johnstona, Emma M. Kerra, Daniel B. Longleya,2,3, and Simon S. McDadea,2,3 aPatrick G Johnston Centre for Cancer Research, Queen’s University Belfast, Belfast, Northern Ireland BT9 7BL, United Kingdom; bDiscipline of Pharmacology & Therapeutics, Lambe Institute for Translational Research, School of Medicine, College of Medicine, Nursing and Health Sciences, National University of Ireland Galway, Galway, Ireland; and cRegenerative Medicine Institute, College of Medicine, Nursing and Health Sciences, National University of Ireland Galway, Galway, Ireland Edited by Karen H. Vousden, Francis Crick Institute, London, United Kingdom, and approved June 8, 2020 (received for review February 12, 2020) p53 is the most frequently mutated, well-studied tumor-suppressor switch from cell-cycle arrest to cell death induction remain gene, yet the molecular basis of the switch from p53-induced cell- poorly understood, although p53-mediated transcriptional up- cycle arrest to apoptosis remains poorly understood. Using a combi- regulation of PUMA has been suggested to be crucial in a nation of transcriptomics and functional genomics, we unexpectedly number of studies (10, 11). identified a nodal role for the caspase-8 paralog and only human Despite p53/TP53 being the most frequently mutated gene in pseudo-caspase, FLIP(L), in regulating this switch. Moreover, we iden- cancer, ∼50% of all tumors retain wild-type p53 (WT-p53) and tify FLIP(L) as a direct p53 transcriptional target gene that is rapidly typically circumvent or suppress p53’s functions through alter- up-regulated in response to Nutlin-3A, an MDM2 inhibitor that po- native nonmutational mechanisms (12). Reawakening the latent tently activates p53. Genetically or pharmacologically inhibiting ex- tumor suppressive functions in cancers retaining WT-p53 pression of FLIP(L) using siRNA or entinostat (a clinically relevant class- I HDAC inhibitor) efficiently promoted apoptosis in colorectal cancer therefore is an attractive clinical concept (12). Targeting the cells in response to Nutlin-3A, which otherwise predominantly in- p53-MDM2 interaction has received significant attention and duced cell-cycle arrest. Enhanced apoptosis was also observed when entinostat was combined with clinically relevant, p53-activating che- Significance motherapy in vitro, and this translated into enhanced in vivo efficacy. Mechanistically, FLIP(L) inhibited p53-induced apoptosis by blocking p53 is the most frequently mutated, well-studied tumor- activation of caspase-8 by the TRAIL-R2/DR5 death receptor; notably, suppressor gene, yet the switch from p53-induced cell-cycle this activation was not dependent on receptor engagement by its arrest to apoptosis remains poorly understood. We un- ligand, TRAIL. In the absence of caspase-8, another of its paralogs, expectedly identify a critical role for the only human pseudo- caspase-10 (also transcriptionally up-regulated by p53), induced apo- caspase FLIP(L) in regulating this switch. Genetically or phar- ptosis in Nutlin-3A-treated, FLIP(L)-depleted cells, albeit to a lesser macologically inhibiting expression of FLIP(L), which we iden- extent than in caspase-8-proficient cells. FLIP(L) depletion also modu- tify as a new p53 transcriptional target, promoted apoptosis lated transcription of canonical p53 target genes, suppressing p53- over cell-cycle arrest in response to p53 activation. Mechanis- induced expression of the cell-cycle regulator p21 and enhancing tically, FLIP(L) inhibited p53-induced apoptosis by blocking p53-induced up-regulation of proapoptotic PUMA. Thus, even in the ligand-independent activation of caspase-8 by the TRAIL-R2/ absence of caspase-8/10, FLIP(L) silencing promoted p53-induced ap- DR5 death receptor. Notably, FLIP(L) also modulated tran- optosis by enhancing PUMA expression. Thus, we report unexpected, scription of canonical p53 target genes: increasing expression therapeutically relevant roles for FLIP(L) in determining cell fate of cell-cycle regulator p21 and suppressing upregulation of following p53 activation. apoptosis-inducing PUMA. Thus, we report unexpected, ther- apeutically exploitable roles for FLIP(L) in regulating the switch p53 | apoptosis | FLIP | TRAIL-R2 | entinostat from p53-induced cell-cycle arrest to apoptosis. he mechanisms through which p53 activation differentially Author contributions: A.L., A.J.M., M.J.L.-W., P.D.D., V.M.C., P.G.J., E.M.K., D.B.L., and S.S.M. designed research; A.L., A.J.M., N.T.C., F.F., C.M., C.H., J.Z.R., T.S., P.F.G., Tregulates cell survival (by initiating cell-cycle arrest and DNA G.M.A.G., K.M., K.M.M., and E.M.K. performed research; G.P.Q., L.J.E., A.E.R., and M.W. damage repair) and cell death (by promoting apoptosis) remain contributed new reagents/analytic tools; A.L., A.J.M., N.T.C., F.F., C.H., J.Z.R., T.S., P.F.G., enigmatic (1). Canonically, phosphorylation of the p53 N ter- G.M.A.G., K.M., W.L.A., E.M.K., and S.S.M. analyzed data; and A.L., M.J.L.-W., P.D.D., minus blocks its interaction with the E3 ubiquitin ligase Mouse D.B.L., and S.S.M. wrote the paper. Double Minute 2 (MDM2) (2) reducing ubiquitination of the C The authors declare no competing interest. terminus and stabilizing p53. Stabilized p53 directly activates This article is a PNAS Direct Submission. target genes to induce cell-cycle arrest mediated by the cyclin- Published under the PNAS license. dependent kinase inhibitor p21/CDKN1A and other effectors (3, Data deposition: The raw data and RNA-Seq analyses discussed in this publication have been deposited in the National Center for Biotechnology Information (NCBI) Gene Ex- 4). In the event of sustained stress and/or irreparable DNA pression Omnibus (GEO) database and linked sequence read archive files, which are ac- damage, sequential posttranslational modification of p53 is cessible at accession no. GSE113682. thought to direct p53 activity toward proapoptotic target genes, 1A.L. and A.J.M. contributed equally to this work. including those encoding BAX, PUMA, and NOXA (5, 6) and 2D.B.L., and S.S.M. contributed equally to this work. the death receptor TRAIL receptor 2 (TRAIL-R2 also known as 3To whom correspondence may be addressed. Email: [email protected] or S.McDade@ death receptor-5, DR5) (7). We and others have contributed to qub.ac.uk. progress in identifying direct and indirect p53 target genes using This article contains supporting information online at https://www.pnas.org/lookup/suppl/ chromatin immunoprecipitation sequencing (ChIP-Seq) (8) doi:10.1073/pnas.2001520117/-/DCSupplemental. (summarized in ref. 9); however, the mechanisms underlying the First published July 13, 2020. 17808–17819 | PNAS | July 28, 2020 | vol. 117 | no. 30 www.pnas.org/cgi/doi/10.1073/pnas.2001520117 Downloaded by guest on September 25, 2021 has led to the development of the selective small molecule in- Fig. S1G). In the extrinsic pathway, crosstalk between caspase-8 hibitors of MDM2 (MDM2i) such as Nutlin-3A (13). While and the mitochondria is mediated by the BH3 protein BID, highly effective at stabilizing p53 (12), such agents promote which when cleaved by caspase-8 to its truncated form (tBID) variable cellular fates depending on cell type in all but MDM2- translocates to the mitochondria and promotes mitochondrial amplified cells, in which they induce cell death (14). The ob- outer membrane permeabilization (MOMP). In line with this, servation that potent p53 stabilization elicited by MDM2i is of- the mechanism of apoptosis induced by Nutlin-3A/siFLIP(L) was ten insufficient to induce cell death suggests the existence of significantly attenuated, although not completely prevented, in fundamental mechanisms that regulate the cell death-inducing BID knockout cells (Fig. 1 J and K). By comparison, the effects effects of stabilized p53. Strategies targeting such p53-mediated of the direct extrinsic apoptosis pathway activator isoleucine cell death inhibitory mechanisms have potential to not only en- zipper-TRAIL (IZ-TRAIL) were completely abrogated by BID hance MDM2i-induced cell death, but also to augment the ef- deletion, confirming this model as apoptotically type-2 (Fig. 1 J ficacy of p53-induced cell death induced by radiotherapy and and K). DNA damaging chemotherapies. In this study, we unexpectedly identify a critical role for the FLIP(L) Is a Direct, Acetylation-Dependent p53-Target Gene. From the apoptosis regulator and only human pseudo-caspase FLIP(L) Western blot analyses in Fig. 1, it was apparent that Nutlin-3A (Fas-associated death domain [FADD]-like interleukin-1β-con- treatment up-regulated expression FLIP(L) in p53-WT CRC verting enzyme inhibitory protein) in regulating the switch from cells. Reanalysis of previous ChIP-Seq data from our group in p53-induced cell-cycle arrest to apoptosis. Importantly, this bi- human foreskin keratinocytes treated with cisplatin (8) or pub- ology is therapeutically exploitable using class-I HDAC inhibi- licly available ChIP-Seq data from p53-WT MCF7 breast cancer tors, which prevent p53-mediated transcriptional up-regulation cells treated with Nutlin-3A (22) identified direct, treatment- of FLIP(L) leading to synergistic inductions of apoptosis when induced binding of p53 to the CFLAR/FLIP promoter (SI Ap- these agents are combined with Nutlin-3A or DNA damaging pendix, Fig. S2A), and we confirmed this in HCT116 cells fol- chemotherapy. lowing treatment with Nutlin-3A (Fig. 2A).
Load more

Recommended publications
  • Epigenetic Reprogramming Sensitizes CML Stem Cells to Combined EZH2 and Tyrosine
    Published OnlineFirst September 14, 2016; DOI: 10.1158/2159-8290.CD-16-0263 RESEARCH BRIEF Epigenetic Reprogramming Sensitizes CML Stem Cells to Combined EZH2 and Tyrosine Kinase Inhibition Mary T. Scott 1 , 2 , Koorosh Korfi 1 , 2 , Peter Saffrey 1 , Lisa E.M. Hopcroft 2 , Ross Kinstrie 1 , Francesca Pellicano 2 , Carla Guenther 1 , 2 , Paolo Gallipoli 2 , Michelle Cruz 1 , Karen Dunn 2 , Heather G. Jorgensen 2 , Jennifer E. Cassels 2 , Ashley Hamilton 2 , Andrew Crossan 1 , Amy Sinclair 2 , Tessa L. Holyoake 2 , and David Vetrie 1 ABSTRACT A major obstacle to curing chronic myeloid leukemia (CML) is residual disease main- tained by tyrosine kinase inhibitor (TKI)–persistent leukemic stem cells (LSC). These are BCR–ABL1 kinase independent, refractory to apoptosis, and serve as a reservoir to drive relapse or TKI resistance. We demonstrate that Polycomb Repressive Complex 2 is misregulated in chronic phase CML LSCs. This is associated with extensive reprogramming of H3K27me3 targets in LSCs, thus sensi- tizing them to apoptosis upon treatment with an EZH2-specifi c inhibitor (EZH2i). EZH2i does not impair normal hematopoietic stem cell survival. Strikingly, treatment of primary CML cells with either EZH2i or TKI alone caused signifi cant upregulation of H3K27me3 targets, and combined treatment further potentiated these effects and resulted in signifi cant loss of LSCs compared to TKI alone, in vitro , and in long-term bone marrow murine xenografts. Our fi ndings point to a promising epigenetic-based thera- peutic strategy to more effectively target LSCs in patients with CML receiving TKIs. SIGNIFICANCE: In CML, TKI-persistent LSCs remain an obstacle to cure, and approaches to eradicate them remain a signifi cant unmet clinical need.
    [Show full text]
  • Gene Essentiality Landscape and Druggable Oncogenic Dependencies in Herpesviral Primary Effusion Lymphoma
    ARTICLE DOI: 10.1038/s41467-018-05506-9 OPEN Gene essentiality landscape and druggable oncogenic dependencies in herpesviral primary effusion lymphoma Mark Manzano1, Ajinkya Patil1, Alexander Waldrop2, Sandeep S. Dave2, Amir Behdad3 & Eva Gottwein1 Primary effusion lymphoma (PEL) is caused by Kaposi’s sarcoma-associated herpesvirus. Our understanding of PEL is poor and therefore treatment strategies are lacking. To address this 1234567890():,; need, we conducted genome-wide CRISPR/Cas9 knockout screens in eight PEL cell lines. Integration with data from unrelated cancers identifies 210 genes as PEL-specific oncogenic dependencies. Genetic requirements of PEL cell lines are largely independent of Epstein-Barr virus co-infection. Genes of the NF-κB pathway are individually non-essential. Instead, we demonstrate requirements for IRF4 and MDM2. PEL cell lines depend on cellular cyclin D2 and c-FLIP despite expression of viral homologs. Moreover, PEL cell lines are addicted to high levels of MCL1 expression, which are also evident in PEL tumors. Strong dependencies on cyclin D2 and MCL1 render PEL cell lines highly sensitive to palbociclib and S63845. In summary, this work comprehensively identifies genetic dependencies in PEL cell lines and identifies novel strategies for therapeutic intervention. 1 Department of Microbiology-Immunology, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA. 2 Duke Cancer Institute and Center for Genomic and Computational Biology, Duke University, Durham, NC 27708, USA. 3 Department of Pathology, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA. Correspondence and requests for materials should be addressed to E.G. (email: [email protected]) NATURE COMMUNICATIONS | (2018) 9:3263 | DOI: 10.1038/s41467-018-05506-9 | www.nature.com/naturecommunications 1 ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/s41467-018-05506-9 he human oncogenic γ-herpesvirus Kaposi’s sarcoma- (IRF4), a critical oncogene in multiple myeloma33.
    [Show full text]
  • Induced Apoptosis
    APOPTOSIS INDUCTION AND IMMUNOTHERAPY-HOW TO IMPROVE RESULTS OF IMMUNOTHERAPY C/ Professor Peter Hersey University of Newcastle NSW Australia IMMUNOTHERAPY DEPENDS ON INDUCTION OF APOPTOSIS! • IF WE UNDERSTAND THE RESISTANCE MECHANISMS AGAINST APOPTOSIS WE CAN TARGET THESE AND IMPROVE THE RESULTS OF IMMUNOTHERAPY CELL KILLING MECHANISMS USED BY LYMPHOCYTES DEPEND ON INDUCTION OF APOPTOSIS 1. Granzyme – Perforin Mediated Killing CD8 CTL (CD4 CTL) NK Cells and ADCC 2.Death Ligand Mediated Killing TRAIL, FasL, TNF CD4 T Cells Monocytes, Dendritic Cells CURRENTCURRENT CONCEPTSCONCEPTS ININ APOPTOSISAPOPTOSIS TRAIL, Granz B P53.-NOXA, BID CYTOSKELETON PUMA,BAD,BID BIM,BMF Bcl-2,Bcl-xL.Mcl-1 ER Stress, Bik,PUMA,Noxa Bax,Bak Mitochondria Smac,Omi Cyto c, Casp 9 IAPs Classical Pathway Effector Caspases 3,7 MITOCHONDRIAL PATHWAYS TO APOPTOSIS ARE REGULATED BY BCL-2 FAMILY PROTEINS • Pro-apoptotic BH3 only damage sensor proteins (Bid, Bik,Bim, Bmf, Noxa,Puma,Bad,Hrk) • Pro-apoptotic multidomain proteins: BAX, BAK • Anti-apoptotic proteins: BCL-2, BCL-Xl, MCL-1, Bcl-W,A1 WE ALREADY HAVE AGENTS THAT TARGET THE ANTI APOPTOTIC PROTEINS! Targetting Anti Apoptotic Proteins • Genasense against Bcl-2. • Inhibition of production of the IAP protein Survivin YM155 (Astellas Pharm • BH3 mimics that bind Bcl-2 proteins(Abbott ABT-737) Targetting Anti-Apoptotic Proteins • AT-101 (Gossypol) Oral inhibitor of Bcl-2 Bcl- XL,Mcl-1 . Ascenta Therapeutics • TW37- Small mw mimic of Bim that inhibits Bcl-2, Bcl-XL,Mcl-1. Univ Michigan • Obatoclax (GX015-070) Small mw BH3 mimic . Inhibits Bcl-2,Bcl-XL,Mcl-1. (Gemin X) TRAIL INDUCED KILLING REQUIRES DEATH RECEPTORS! TRAIL Induces Apoptosis in the Majority of Melanoma Cell Lines 100 90 80 70 60 50 40 30 % Apoptotic Cells % Apoptotic 20 10 0 1 2 3 4 5 6 7 8 9 101112131415161718192021222324252627282930 Melanoma Cell Lines TRAIL-R1 & R2 Expression Correlates with Degree of Apoptosis L I A 120 120 R T 100 100 y b 80 80 d e 60 60 c u d 40 40 n I s 20 20 si o 0 0 t p -20 o -20 p A -10 10 30 50 70 90 -10 10 30 50 70 90 % TRAIL-R1 TRAIL-R2 Zhang et al.
    [Show full text]
  • Biochemical Society Focused Meetings Proteases A
    ORE Open Research Exeter TITLE Proteases and caspase-like activity in the yeast Saccharomyces cerevisiae. AUTHORS Wilkinson, D; Ramsdale, M JOURNAL Biochemical Society Transactions DEPOSITED IN ORE 18 November 2013 This version available at http://hdl.handle.net/10871/13957 COPYRIGHT AND REUSE Open Research Exeter makes this work available in accordance with publisher policies. A NOTE ON VERSIONS The version presented here may differ from the published version. If citing, you are advised to consult the published version for pagination, volume/issue and date of publication Biochemical Society Transactions (2011) XX, (XX-XX) (Printed in Great Britain) Biochemical Society Focused Meetings Proteases and caspase-like activity in the yeast Saccharomyces cerevisiae Derek Wilkinson and Mark Ramsdale1 Biosciences, University of Exeter, Geoffrey Pope Building, Stocker Road, Exeter, EX4 4QD Key words: Programmed cell death, apoptosis, necrosis, proteases, caspases, Saccharomyces cerevisiae. Abbreviations used: PCD, programmed cell death; ROS, reactive oxygen species; GAPDH, glyceraldehyde-3-phosphate dehydrogenase; ER, endoplasmic reticulum; MS, mass spectrometry. 1email [email protected] Abstract A variety of proteases have been implicated in yeast PCD including the metacaspase, Mca1 and the separase Esp1, the HtrA-like serine protease Nma111, the cathepsin-like serine carboxypeptideases and a range of vacuolar proteases. Proteasomal activity is also shown to have an important role in determining cell fate, with both pro- and anti-apoptotic roles. Caspase-3, -6- and -8 like activities are detected upon stimulation of yeast PCD, but not all of this activity is associated with Mca1, implicating other proteases with caspase-like activity in the yeast cell death response.
    [Show full text]
  • Inhibitor of Apoptosis Proteins As Therapeutic Targets in Multiple Myeloma
    Leukemia (2014) 28, 1519–1528 & 2014 Macmillan Publishers Limited All rights reserved 0887-6924/14 www.nature.com/leu ORIGINAL ARTICLE Inhibitor of apoptosis proteins as therapeutic targets in multiple myeloma V Ramakrishnan1, U Painuly1,2, T Kimlinger1, J Haug1, SV Rajkumar1 and S Kumar1 The inhibitor of apoptosis (IAP) proteins have a critical role in the control of apoptotic machinery, and has been explored as a therapeutic target. Here, we have examined the functional importance of IAPs in multiple myeloma (MM) by using a Smac (second mitochondria-derived activator of caspases)-mimetic LCL161. We observed that LCL161 was able to potently induce apoptosis in some MM cell lines but not in others. Examining the levels of X-linked inhibitor of apoptosis protein (XIAP), cellular inhibitor of apoptosis protein 1 (cIAP1) and cellular inhibitor of apoptosis protein 2 (cIAP2) post LCL161 treatment indicated clear downregulation of both XIAP activity and cIAP1 levels in both the sensitive and less sensitive (resistant) cell lines. cIAP2, however, was not downregulated in the cell line resistant to the drug. Small interfering RNA-mediated silencing of cIAP2 significantly enhanced the effect of LCL161, indicating the importance of downregulation of all IAPs simultaneously for induction of apoptosis in MM cells. LCL161 induced marked up regulation of the Jak2/Stat3 pathway in the resistant MM cell lines. Combining LCL161 with a Jak2-specific inhibitor resulted in synergistic cell death in MM cell lines and patient cells. In addition, combining LCL161 with death- inducing ligands clearly showed that LCL161 sensitized MM cells to both Fas-ligand and TRAIL.
    [Show full text]
  • Serine Proteases with Altered Sensitivity to Activity-Modulating
    (19) & (11) EP 2 045 321 A2 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 08.04.2009 Bulletin 2009/15 C12N 9/00 (2006.01) C12N 15/00 (2006.01) C12Q 1/37 (2006.01) (21) Application number: 09150549.5 (22) Date of filing: 26.05.2006 (84) Designated Contracting States: • Haupts, Ulrich AT BE BG CH CY CZ DE DK EE ES FI FR GB GR 51519 Odenthal (DE) HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI • Coco, Wayne SK TR 50737 Köln (DE) •Tebbe, Jan (30) Priority: 27.05.2005 EP 05104543 50733 Köln (DE) • Votsmeier, Christian (62) Document number(s) of the earlier application(s) in 50259 Pulheim (DE) accordance with Art. 76 EPC: • Scheidig, Andreas 06763303.2 / 1 883 696 50823 Köln (DE) (71) Applicant: Direvo Biotech AG (74) Representative: von Kreisler Selting Werner 50829 Köln (DE) Patentanwälte P.O. Box 10 22 41 (72) Inventors: 50462 Köln (DE) • Koltermann, André 82057 Icking (DE) Remarks: • Kettling, Ulrich This application was filed on 14-01-2009 as a 81477 München (DE) divisional application to the application mentioned under INID code 62. (54) Serine proteases with altered sensitivity to activity-modulating substances (57) The present invention provides variants of ser- screening of the library in the presence of one or several ine proteases of the S1 class with altered sensitivity to activity-modulating substances, selection of variants with one or more activity-modulating substances. A method altered sensitivity to one or several activity-modulating for the generation of such proteases is disclosed, com- substances and isolation of those polynucleotide se- prising the provision of a protease library encoding poly- quences that encode for the selected variants.
    [Show full text]
  • C-Terminal Region (ARP58987 P050) Data Sheet
    CASP3 antibody - C-terminal region (ARP58987_P050) Data Sheet Product Number ARP58987_P050 Product Name CASP3 antibody - C-terminal region (ARP58987_P050) Size 50ug Gene Symbol CASP3 Alias Symbols CPP32; CPP32B; SCA-1 Nucleotide Accession# NM_032991 Protein Size (# AA) 277 amino acids Molecular Weight 12kDa Product Format Lyophilized powder NCBI Gene Id 836 Host Rabbit Clonality Polyclonal Official Gene Full Name Caspase 3, apoptosis-related cysteine peptidase Gene Family CASP This is a rabbit polyclonal antibody against CASP3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, Description of Target large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.
    [Show full text]
  • The Role of Caspase-2 in Regulating Cell Fate
    cells Review The Role of Caspase-2 in Regulating Cell Fate Vasanthy Vigneswara and Zubair Ahmed * Neuroscience and Ophthalmology, Institute of Inflammation and Ageing, University of Birmingham, Birmingham B15 2TT, UK; [email protected] * Correspondence: [email protected] Received: 15 April 2020; Accepted: 12 May 2020; Published: 19 May 2020 Abstract: Caspase-2 is the most evolutionarily conserved member of the mammalian caspase family and has been implicated in both apoptotic and non-apoptotic signaling pathways, including tumor suppression, cell cycle regulation, and DNA repair. A myriad of signaling molecules is associated with the tight regulation of caspase-2 to mediate multiple cellular processes far beyond apoptotic cell death. This review provides a comprehensive overview of the literature pertaining to possible sophisticated molecular mechanisms underlying the multifaceted process of caspase-2 activation and to highlight its interplay between factors that promote or suppress apoptosis in a complicated regulatory network that determines the fate of a cell from its birth and throughout its life. Keywords: caspase-2; procaspase; apoptosis; splice variants; activation; intrinsic; extrinsic; neurons 1. Introduction Apoptosis, or programmed cell death (PCD), plays a pivotal role during embryonic development through to adulthood in multi-cellular organisms to eliminate excessive and potentially compromised cells under physiological conditions to maintain cellular homeostasis [1]. However, dysregulation of the apoptotic signaling pathway is implicated in a variety of pathological conditions. For example, excessive apoptosis can lead to neurodegenerative diseases such as Alzheimer’s and Parkinson’s disease, whilst insufficient apoptosis results in cancer and autoimmune disorders [2,3]. Apoptosis is mediated by two well-known classical signaling pathways, namely the extrinsic or death receptor-dependent pathway and the intrinsic or mitochondria-dependent pathway.
    [Show full text]
  • 505.Full.Pdf
    Pseudomonas aeruginosa Delays Kupffer Cell Death via Stabilization of the X-Chromosome-Linked Inhibitor of Apoptosis Protein This information is current as of September 26, 2021. Alix Ashare, Martha M. Monick, Amanda B. Nymon, John M. Morrison, Matthew Noble, Linda S. Powers, Timur O. Yarovinsky, Timothy L. Yahr and Gary W. Hunninghake J Immunol 2007; 179:505-513; ; doi: 10.4049/jimmunol.179.1.505 Downloaded from http://www.jimmunol.org/content/179/1/505 References This article cites 44 articles, 21 of which you can access for free at: http://www.jimmunol.org/ http://www.jimmunol.org/content/179/1/505.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists by guest on September 26, 2021 • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2007 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Pseudomonas aeruginosa Delays Kupffer Cell Death via Stabilization of the X-Chromosome-Linked Inhibitor of Apoptosis Protein1 Alix Ashare,2* Martha M.
    [Show full text]
  • EMBO Facts & Figures
    excellence in life sciences Reykjavik Helsinki Oslo Stockholm Tallinn EMBO facts & figures & EMBO facts Copenhagen Dublin Amsterdam Berlin Warsaw London Brussels Prague Luxembourg Paris Vienna Bratislava Budapest Bern Ljubljana Zagreb Rome Madrid Ankara Lisbon Athens Jerusalem EMBO facts & figures HIGHLIGHTS CONTACT EMBO & EMBC EMBO Long-Term Fellowships Five Advanced Fellows are selected (page ). Long-Term and Short-Term Fellowships are awarded. The Fellows’ EMBO Young Investigators Meeting is held in Heidelberg in June . EMBO Installation Grants New EMBO Members & EMBO elects new members (page ), selects Young EMBO Women in Science Young Investigators Investigators (page ) and eight Installation Grantees Gerlind Wallon EMBO Scientific Publications (page ). Programme Manager Bernd Pulverer S Maria Leptin Deputy Director Head A EMBO Science Policy Issues report on quotas in academia to assure gender balance. R EMBO Director + + A Conducts workshops on emerging biotechnologies and on H T cognitive genomics. Gives invited talks at US National Academy E IC of Sciences, International Summit on Human Genome Editing, I H 5 D MAN 201 O N Washington, DC.; World Congress on Research Integrity, Rio de A M Janeiro; International Scienti c Advisory Board for the Centre for Eilish Craddock IT 2 015 Mammalian Synthetic Biology, Edinburgh. Personal Assistant to EMBO Fellowships EMBO Scientific Publications EMBO Gold Medal Sarah Teichmann and Ido Amit receive the EMBO Gold the EMBO Director David del Álamo Thomas Lemberger Medal (page ). + Programme Manager Deputy Head EMBO Global Activities India and Singapore sign agreements to become EMBC Associate + + Member States. EMBO Courses & Workshops More than , participants from countries attend 6th scienti c events (page ); participants attend EMBO Laboratory Management Courses (page ); rst online course EMBO Courses & Workshops recorded in collaboration with iBiology.
    [Show full text]
  • Blockade of BCL-2 Proteins Efficiently Induces Apoptosis in Progenitor
    Leukemia (2016) 30, 112–123 © 2016 Macmillan Publishers Limited All rights reserved 0887-6924/16 www.nature.com/leu ORIGINAL ARTICLE Blockade of BCL-2 proteins efficiently induces apoptosis in progenitor cells of high-risk myelodysplastic syndromes patients S Jilg1, V Reidel1, C Müller-Thomas1, J König1, J Schauwecker2, U Höckendorf1, C Huberle1, O Gorka3, B Schmidt4, R Burgkart2, J Ruland3, H-J Kolb1, C Peschel1, RAJ Oostendorp1, KS Götze1 and PJ Jost1 Deregulated apoptosis is an identifying feature of myelodysplastic syndromes (MDS). Whereas apoptosis is increased in the bone marrow (BM) of low-risk MDS patients, progression to high-risk MDS correlates with an acquired resistance to apoptosis and an aberrant expression of BCL-2 proteins. To overcome the acquired apoptotic resistance in high-risk MDS, we investigated the induction of apoptosis by inhibition of pro-survival BCL-2 proteins using the BCL-2/-XL/-W inhibitor ABT-737 or the BCL-2-selective inhibitor ABT-199. We characterized a cohort of 124 primary human BM samples from MDS/secondary acute myeloid leukemia (sAML) patients and 57 healthy, age-matched controls. Inhibition of anti-apoptotic BCL-2 proteins was specifically toxic for BM cells from high-risk MDS and sAML patients, whereas low-risk MDS or healthy controls remained unaffected. Notably, ABT-737 or ABT-199 treatment was capable of targeting the MDS stem/progenitor compartment in high-risk MDS/sAML samples as shown by the reduction in CD34+ cells and the decreased colony-forming capacity. Elevated expression of MCL-1 conveyed resistance against both compounds. Protection by stromal cells only partially inhibited induction of apoptosis.
    [Show full text]
  • PDCD5 Interacts with P53 and Functions As a Regulator of P53 Dynamics in the DNA Damage Response
    i \Zhuge-BJ" | 2018/6/13 | 5:45 | page 1 | #1 i i i Biophysical Journal Volume: 00 Month Year 1{12 1 PDCD5 interacts with p53 and functions as a regulator of p53 dynamics in the DNA damage response Changjing Zhugea, Xiaojuan Sunb, Yingyu Chenc, Jinzhi Leid a College of Sciences, Beijing Forestry University, 35 Tsinghua East Road, Beijing 100083, China; b School of Science, Beijing University of Posts and Telecommunications, 10 Xitucheng Road, Beijing 100876, China; c Laboratory of Medical Immunology, School of Basic Medical Science, Peking University, 38 Xueyuan Road, Beijing 100083, China; d MOE Key Laboratory of Bioinformatics, Zhou Pei-Yuan Center for Applied Mathematics, Tsinghua University, Beijing 100084, China Abstract The tumor suppressor p53 plays a central role in cell fate decisions after DNA damage. Programmed Cell Death 5 (PDCD5) is known to interact with the p53 pathway to promote cell apoptosis. Recombinant human PDCD5 can significantly sensitize different cancers to chemotherapies. In the present paper, we construct a computational model that includes PDCD5 interactions in the p53 signaling network and study the effects of PDCD5 on p53- mediated cell fate decisions during the DNA damage response. Our results revealed that PDCD5 functions as a co-activator of p53 that regulates p53-dependent cell fate decisions via the mediation of p53 dynamics. The effects of PDCD5 are dose-dependent such that p53 can display either sustained or pulsed dynamics at different PDCD5 levels. Moreover, PDCD5 regulates caspase-3 activation via two mechanisms during the two phases of sustained and pulsed p53 dynamics. This study provides insights regarding how PDCD5 functions as a regulator of the p53 pathway and might be helpful for increasing our understanding of the molecular mechanisms by which PDCD5 can be used to treat cancers.
    [Show full text]