DOCSLIB.ORG

Disease Candidate Gene Identification and Gene Regulatory Network Building Through Medical Literature Mining

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Disease Candidate Gene Identification and Gene Regulatory Network Building Through Medical Literature Mining Disease Candidate Gene Identification and Gene Regulatory Network Building Through Medical Literature Mining Yong Wang, Chenyang Jiang, Jinbiao Cheng and Xiaoqun Wang Abstract Finding key genes associated with diseases is an essential problem of disease diagnosis and treatment, and drug design. Bioinformatics takes advantage of computer technology to analyze biomedical data to help finding the information about these genes. Biomedical literatures, which consists of original experimental data and results, are attracting more attention from bio-informatics researchers because literature mining technology can extract knowledge more efficiently. This paper designs an algorithm to estimate the association degree between genes according to their co-citations in biomedical literatures from PubMed database, and to further predict the causative genes associated with a disease. The paper also uses hierarchical clustering algorithm to build a specific genes regulation network. Experiments on uterine cancer shows that the proposed algorithm can identify pathogenic genes of uterine cancer accurately and rapidly. Keywords Literature mining · Co-citation · Pathogenic gene · Gene regulatory network · Hierarchical clustering Y. Wang (B) · C. Jiang · J. Cheng School of Software, Beijing Institute of Technology, Beijing 100081, China e-mail: [email protected] C. Jiang e-mail: [email protected] J. Cheng e-mail: [email protected] X. Wang Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101, China e-mail: [email protected] © Springer International Publishing Switzerland 2017 453 V.E. Balas et al. (eds.), Information Technology and Intelligent Transportation Systems, Advances in Intelligent Systems and Computing 455, DOI 10.1007/978-3-319-38771-0_44 454 Y. Wang et al. 1 Introduction Finding genes critical to the formation and development of a disease from disease candidate genes are of significance to diagnosis and treatment of diseases, which is an important goal of bioinformatics [1]. Bioinformatics technologies are used to manage and analyze mass data generated by biomedical experiments, and to give some predictions or directive conclusions for researchers further works. In recent years, a new branch of bioinformatics, literature mining [2] is more and more used to partially replace biomedical experiments, and finally to accelerate the whole research process. Literature is the most important way to publish experimental data, experi- mental results and experimental conclusion, so it contains a lot of original knowledge that has been proved in experiments. Literature mining can automatically analyze the huge amount of biomedical literature, if combined with artificial verification, then the researchers can not only save a lot of manpower by greatly narrowing down the scope of artificial reading, but also can extract and discover knowledge more efficiently and can give reliable guide to biomedical experiments. AI. Mubaid et al. [3] explore the relationship between genes and diseases by studying cooccurrence of genes and they find 6 candidate genes, all of which can be verified by PubMed literatures. Chun et al. [4] developed a named entity recogni- tion and mining system based on maximum entropy for automatic identification of prostate cancer related genes, then apply it to Medline database with the accuracy of 92.1%. Some researchers [5] take advantage of Protein–Protein Interaction (PPI) networks to predict disease related genes. So there are many PPI databases, such as HPRD (Human Protein Reference Database) [6], DIP (the Database of Interact- ing Proteins) [7] and OPHID (Online Predicted Human Interaction Database) [8]. Some researchers don’t use these well-built databases, rather build their own gene networks. Ozgur et al. built a prostate cancer related gene network based on some seed genes through text mining, and only one candidate gene cannot be supported by literatures [9]. Many different algorithms have been proposed to evaluate gene networks, such as shortest path [10, 11], similarity assisted [12, 13] and centrality based [9, 14]. In this paper, we design an algorithm to predicate disease candidate genes by doing text mining on the PubMed biomedical literature database combined with human gene ontology database. We first compute the degree of the association between genes, and then predict the causative genes associated with diseases. Further, we use hierarchical clustering algorithm to build specific genes regulation network and analyze the network by taking the results of text mining into consideration. The experimental results show that the proposed algorithm can identify pathogenic genes of uterine cancer accurately and rapidly. Those less referenced genes (low-frequency genes) should get more attention in future research. This work can provide a good guide for the study in the field of biomedical area, and show the broad application prospects of text mining in the biomedical field as well. Disease Candidate Gene Identification and Gene Regulatory … 455 2 System Design and Implementation 2.1 Getting Literature Data Source First, we download the data of more than 20,000 genes encoding proteins in the human genome (exons) from NCBI Gene database (ftp://ftp.ncbi.nih.gov/gene/). The data contains the ontology of each gene and the corresponding gene ID, saved as CSV files. Then write a Java program to read the CSV file for each gene ontology symbol, and set the searching parameters through URL, and then search the literature which relate to genes ontology in the database through the E-utilities API, and finally retrieve XML flies from search results. For each gene, parse the XML files, retrieve the PMID of top 100 most related papers. Remove duplicate PMID and then add the PMIDs to a set. For each PMID, search and retrieve the XML files of corresponding literature in PubMed, parse these files to get the titles, abstracts and keywords. Finally we store them into a local MySQL database, and take each literature’s PMID as the primary key. The article’s title, abstract and keywords are data source for the following text mining. 2.2 Processing Literature Data Identifying the gene ontologies. We use word segmentation method to retrieve gene ontologies in data source. There are many ways to represent gene ontologies in these literatures and some representations in early papers are nonstandard, so we need a collection of standard gene ontologies for reference before segmentation. In order to identify gene ontologies more easily, we make the following special preprocessing to the data source before segmenting it. First, read CSV files of all IDs of gene ontolo- gies that describe human genome, then read CSV files of the corresponding gene ontologies and genes alias from NCBI GENE database. Store these files into mem- ory, and add these files to a hash table named HashMap<String,String> sym2id, the key can be gene ontology or gene’s alias, and the value is a standard gene ontology. This hash table will be referenced in following steps. When segment the data source, we first replace special symbols, such as ‘(’, ‘)’, ‘+’, ‘,’, ‘.’, ‘[’, ‘]’, ‘<’, ‘>’, ‘?’, ‘/’, ‘\’, ‘&’ with space. Then process some fuzzy words, for example, spaces before and after was, an, and met should be removed. Remove “T cells” or “T cell” to pre- vent confusion in segmentation. For each segmented word, lookup in the hash table sym2id to determine whether the word is a certain gene, namely whether it is a gene ontology symbol (a standard gene ontology symbol or alias). If it is, it will be the only standard symbol of the gene ontology mapping for the gene, and will be stored in hash table, waiting for further processing. To evaluate the above identification algorithm, we select 100 papers randomly from the local database and identify gene ontolo- gies in them, then evaluate the precision rate by manual verification. The accuracy (F1-Measure) of algorithm reaches more than 97% as shown in Table 1. At the aspect 456 Y. Wang et al. Table 1 Gene Ontology Identification Evaluation Results No. The number The total The total Precision Recall F1-measure of correct number of number of all rate (PR) rate (RR) gene identified gene ontologies ontology gene in selected identification ontologies papers 1 698 707 731 0.987 0.955 0.971 2 1002 1007 1025 0.995 0.977 0.986 3 423 423 442 1 0.957 0.978 4 486 486 499 1 0.974 0.987 5 769 774 786 0.994 0.978 0.986 6 553 559 571 0.989 0.968 0.979 7 673 673 695 1 0.968 0.984 8 733 733 741 1 0.989 0.995 9 529 533 552 0.992 0.958 0.975 10 638 638 653 1 0.977 0.989 of performance, the whole process of identify gene ontologies in 20,000 papers only takes about 5 s. In which, PR, RR and F1-Measure (the harmonic mean of PR and RR) are com- puted as in (1), (2) and (3) respectively. the number of correct gene ontology identi f ication PR = (1) the total number of identi f ied gene ontologies the number of correct gene ontology identi f ication RR = (2) the total number of gene ontologies in sample papers PR+ RR 0 < F1 − Measure = < 1(3) 2 Calculating the correlation degree between genes. Both identifying candidate genes of diseases and building gene regulation networks need analyze specific genes correlation, so we design an algorithm based on co-occurrence of two genes in the same literatures to calculate quantitative correlation between genes. First, calculate the eigenvalue of the nth gene ontology in the mth paper, i.e. TFIDFmn, which represents the importance of each gene in each literature and the focus of a paper as well. TFIDFmn can be calculated as in (4), (5) and be normalized as in (6). In which, IDF (Inverse Document Frequency) represents the distribution of a gene ontology in a document, TF (Term Frequency) represents the frequency of a gene ontology in a literature.
Load more

Recommended publications
  • Gene Expression Profiles in Testis of Pigs with Extreme High and Low
    BMC Genomics BioMed Central Research article Open Access Gene expression profiles in testis of pigs with extreme high and low levels of androstenone Maren Moe*1,2, Theo Meuwissen2,3, Sigbjørn Lien2,3, Christian Bendixen4, Xuefei Wang4, Lene Nagstrup Conley4, Ingunn Berget3,5, Håvard Tajet1,2 and Eli Grindflek1,3 Address: 1The Norwegian Pig Breeders Association (NORSVIN), Hamar, Norway., 2Department of Animal and Aquacultural Sciences, Norwegian University of Life Sciences, Ås, Norway., 3Centre for Integrative Genetics (CIGENE), Norwegian University of Life Sciences, Ås, Norway., 4Faculty of Agricultural Sciences, University of Aarhus, Tjele, Denmark. and 5MATFORSK, Osloveien 1, Ås, Norway. Email: Maren Moe* - [email protected]; Theo Meuwissen - [email protected]; Sigbjørn Lien - [email protected]; Christian Bendixen - [email protected]; Xuefei Wang - [email protected]; Lene Nagstrup Conley - [email protected]; Ingunn Berget - [email protected]; Håvard Tajet - [email protected]; Eli Grindflek - [email protected] * Corresponding author Published: 7 November 2007 Received: 3 July 2007 Accepted: 7 November 2007 BMC Genomics 2007, 8:405 doi:10.1186/1471-2164-8-405 This article is available from: http://www.biomedcentral.com/1471-2164/8/405 © 2007 Moe et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Boar taint is a major obstacle when using uncastrated male pigs for swine production. One of the main compounds causing this taint is androstenone, a pheromone produced in porcine testis.
    [Show full text]
  • 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 SULT2B1 Purified Mouse Monoclonal Antibody (Mab) Catalog # AM8716b Specification SULT2B1 - Product Information Application WB,E Primary Accession O00204 Reactivity Human Predicted Human Host Mouse Clonality monoclonal Isotype IgG1,κ Calculated MW 41308 SULT2B1 - Additional Information Gene ID 6820 Other Names Sulfotransferase family cytosolic 2B member 1, ST2B1, Sulfotransferase 2B1, All lanes : Anti-SULT2B1 at 1:2000 dilution 2.8.2.2, Alcohol sulfotransferase, Lane 1: MCF-7 whole cell lysate Lane 2: Hydroxysteroid sulfotransferase 2, MDA-MB-468 whole cell lysate SULT2B1, HSST2 Lysates/proteins at 20 µg per lane. Secondary Goat Anti-mouse IgG, (H+L), Target/Specificity Peroxidase conjugated at 1/10000 dilution. This antibody is generated from a mouse Predicted band size : 41 kDa immunized with a reconbinant protein from Blocking/Dilution buffer: 5% NFDM/TBST. human. Dilution WB~~1:8000 Format Purified monoclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein G column, followed by dialysis against PBS. Storage Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. Precautions SULT2B1 is for research use only and not for use in diagnostic or therapeutic Anti-SULT2B1 at 1:8000 dilution + MCF-7 procedures. whole cell lysate Lysates/proteins at 20 µg per lane. Secondary Goat Anti-mouse IgG, Page 1/3 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 (H+L), Peroxidase conjugated at 1/10000 SULT2B1 - Protein Information dilution.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • Sulfation Through the Looking Glass—Recent Advances in Sulfotransferase Research for the Curious
    The Pharmacogenomics Journal (2002) 2, 297–308 & 2002 Nature Publishing Group All rights reserved 1470-269X/02 $25.00 www.nature.com/tpj REVIEW Sulfation through the looking glass—recent advances in sulfotransferase research for the curious MWH Coughtrie ABSTRACT Members of the cytosolic sulfotransferase (SULT) superfamily catalyse the Department of Molecular & Cellular Pathology, sulfation of a multitude of xenobiotics, hormones and neurotransmitters. University of Dundee, Ninewells Hospital & Humans have at least 10 functional SULT genes, and a number of recent Medical School, Dundee, Scotland, UK advances reviewed here have furthered our understanding of SULT function. Correspondence: Analysis of expression patterns has shown that sulfotransferases are highly MWH Coughtrie, Department of expressed in the fetus, and SULTs may in fact be a major detoxification Molecular & Cellular Pathology, University enzyme system in the developing human. The X-ray crystal structures of of Dundee, Ninewells Hospital and three SULTs have been solved and combined with mutagenesis experiments Medical School, Dundee DD1 9SY, Scotland, UK. and molecular modelling, they have provided the first clues as to the factors Tel: +44 (0)1382 632510 that govern the unique substrate specificities of some of these enzymes. In Fax: +44 (0)1382 640320 the future these and other studies will facilitate prediction of the fate of E-mail: [email protected] chemicals metabolised by sulfation. Variation in sulfation capacity may be important in determining an individual’s response to xenobiotics, and there has been an explosion in information on sulfotransferase polymorphisms and their functional consequences, including the influence of SULT1A1 genotype on susceptibility to colorectal and breast cancer.
    [Show full text]
  • Transcriptional Recapitulation and Subversion Of
    Open Access Research2007KaiseretVolume al. 8, Issue 7, Article R131 Transcriptional recapitulation and subversion of embryonic colon comment development by mouse colon tumor models and human colon cancer Sergio Kaiser¤*, Young-Kyu Park¤†, Jeffrey L Franklin†, Richard B Halberg‡, Ming Yu§, Walter J Jessen*, Johannes Freudenberg*, Xiaodi Chen‡, Kevin Haigis¶, Anil G Jegga*, Sue Kong*, Bhuvaneswari Sakthivel*, Huan Xu*, Timothy Reichling¥, Mohammad Azhar#, Gregory P Boivin**, reviews Reade B Roberts§, Anika C Bissahoyo§, Fausto Gonzales††, Greg C Bloom††, Steven Eschrich††, Scott L Carter‡‡, Jeremy E Aronow*, John Kleimeyer*, Michael Kleimeyer*, Vivek Ramaswamy*, Stephen H Settle†, Braden Boone†, Shawn Levy†, Jonathan M Graff§§, Thomas Doetschman#, Joanna Groden¥, William F Dove‡, David W Threadgill§, Timothy J Yeatman††, reports Robert J Coffey Jr† and Bruce J Aronow* Addresses: *Biomedical Informatics, Cincinnati Children's Hospital Medical Center, Cincinnati, OH 45229, USA. †Departments of Medicine, and Cell and Developmental Biology, Vanderbilt University and Department of Veterans Affairs Medical Center, Nashville, TN 37232, USA. ‡McArdle Laboratory for Cancer Research, University of Wisconsin, Madison, WI 53706, USA. §Department of Genetics and Lineberger Cancer Center, University of North Carolina, Chapel Hill, NC 27599, USA. ¶Molecular Pathology Unit and Center for Cancer Research, Massachusetts deposited research General Hospital, Charlestown, MA 02129, USA. ¥Division of Human Cancer Genetics, The Ohio State University College of Medicine, Columbus, Ohio 43210-2207, USA. #Institute for Collaborative BioResearch, University of Arizona, Tucson, AZ 85721-0036, USA. **University of Cincinnati, Department of Pathology and Laboratory Medicine, Cincinnati, OH 45267, USA. ††H Lee Moffitt Cancer Center and Research Institute, Tampa, FL 33612, USA. ‡‡Children's Hospital Informatics Program at the Harvard-MIT Division of Health Sciences and Technology (CHIP@HST), Harvard Medical School, Boston, Massachusetts 02115, USA.
    [Show full text]
  • SULT2B1 (NM 177973) Human Mass Spec Standard Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH304478 SULT2B1 (NM_177973) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: SULT2B1 MS Standard C13 and N15-labeled recombinant protein (NP_814444) Species: Human Expression Host: HEK293 Expression cDNA Clone RC204478 or AA Sequence: Predicted MW: 41.3 kDa Protein Sequence: >RC204478 protein sequence Red=Cloning site Green=Tags(s) MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS PSPGQASETPHPRPS myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq: NP_814444 RefSeq Size: 1228 RefSeq ORF: 1095 Synonyms: ARCI14; HSST2 Locus ID: 6820 UniProt ID: O00204 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 SULT2B1 (NM_177973) Human Mass Spec Standard – PH304478 Cytogenetics: 19q13.33 Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members.
    [Show full text]
  • 2971.Full-Text.Pdf
    Published OnlineFirst March 28, 2014; DOI: 10.1158/1078-0432.CCR-13-2567 Clinical Cancer Imaging, Diagnosis, Prognosis Research Steroidogenic Germline Polymorphism Predictors of Prostate Cancer Progression in the Estradiol Pathway Eric Levesque 1,2, Isabelle Laverdiere 1, Etienne Audet-Walsh1, Patrick Caron1,Melanie Rouleau1, Yves Fradet2, Louis Lacombe2, and Chantal Guillemette1 Abstract Purpose: Reliable biomarkers that predict prostate cancer outcomes are urgently needed to improve and personalize treatment approaches. With this goal in mind, we individually and collectively appraised common genetic polymorphisms related to estradiol metabolic pathways to find prostate cancer prognostic markers. Methods: The genetic profiles of 526 men with organ-confined prostate cancer were examined to find common genetic polymorphisms related to estradiol metabolic pathways and these findings were replicated in a cohort of 213 men with more advanced disease (follow-up time for both cohorts, >7.4 years). Specifically, we examined 71 single-nucleotide polymorphisms (SNP) in SULT2A1, SULT2B1, CYP1B1, COMT, CYP3A4, CYP3A5, CYP3A43, NQO1, and NQO2 and assessed the impact of the SNPs alone and in combination on prostate cancer progression and on circulating hormone levels. Results: According to a multivariate analysis, CYP1B1 (rs1800440), COMT (rs16982844), and SULT2B1 (rs12460535, rs2665582, rs10426628) were significantly associated with prostate cancer progression and hormone levels. Remarkably, by combining the SNP information with previously identified HSD17B2
    [Show full text]
  • Intratumoral Estrogen Sulfotransferase Induction Contributes to the Anti-Breast Cancer Effects of the Dithiocarbamate Derivative TM208
    npg Acta Pharmacologica Sinica (2015) 36: 1246–1255 © 2015 CPS and SIMM All rights reserved 1671-4083/15 www.nature.com/aps Original Article Intratumoral estrogen sulfotransferase induction contributes to the anti-breast cancer effects of the dithiocarbamate derivative TM208 Xi-wei JI 1, 2, Guang-ping CHEN4, Yan SONG5, Ming HUA1, Li-jie WANG1, Liang LI1, Yin YUAN1, Si-yuan WANG1, Tian-yan ZHOU1, 3, *, Wei LU1, 3 1Department of Pharmaceutics, School of Pharmaceutical Sciences, Peking University, Beijing 100191, China; 2Institute of Clinical Pharmacology, Peking University First Hospital, Beijing 100191, China; 3State Key Laboratory of Natural and Biomimetic Drugs, Peking University, Beijing 100191, China; 4Department of Physiological Sciences, Center for Veterinary Health Sciences, Oklahoma State University, Stillwater, OK 74078, USA; 5Department of Molecular and Cellular Pharmacology, School of Pharmaceutical Sciences, Peking University, Beijing 100191, China Aim: Sulfotransferase-catalyzed sulfation is the most important pathway for inactivating estrogens. Thus, activation of estrogen sulfotransferase (EST) may be an alternative approach for the treatment of estrogen-dependent breast cancer. In this study we investigated the involvement of EST in anti-breast cancer effects of the dithiocarbamate derivative TM208 in vitro and in vivo. Methods: The viability of human breast cancer MCF-7 cells was determined using a SBB assay. Nude mice bearing MCF-7 cells were orally administered TM208 (50 and 150 mg·kg-1·d-1) for 18 days. The xenograft tumors and uteri were collected. The mRNA expression of EST was examined with real-time PCR. EST protein was detected with Western blot, ELISA or immunohistochemical staining assays. A radioactive assay was used to measure the EST activity.
    [Show full text]
  • A Grainyhead-Like 2/Ovo-Like 2 Pathway Regulates Renal Epithelial Barrier Function and Lumen Expansion
    BASIC RESEARCH www.jasn.org A Grainyhead-Like 2/Ovo-Like 2 Pathway Regulates Renal Epithelial Barrier Function and Lumen Expansion † ‡ | Annekatrin Aue,* Christian Hinze,* Katharina Walentin,* Janett Ruffert,* Yesim Yurtdas,*§ | Max Werth,* Wei Chen,* Anja Rabien,§ Ergin Kilic,¶ Jörg-Dieter Schulzke,** †‡ Michael Schumann,** and Kai M. Schmidt-Ott* *Max Delbrueck Center for Molecular Medicine, Berlin, Germany; †Experimental and Clinical Research Center, and Departments of ‡Nephrology, §Urology, ¶Pathology, and **Gastroenterology, Charité Medical University, Berlin, Germany; and |Berlin Institute of Urologic Research, Berlin, Germany ABSTRACT Grainyhead transcription factors control epithelial barriers, tissue morphogenesis, and differentiation, but their role in the kidney is poorly understood. Here, we report that nephric duct, ureteric bud, and collecting duct epithelia express high levels of grainyhead-like homolog 2 (Grhl2) and that nephric duct lumen expansion is defective in Grhl2-deficient mice. In collecting duct epithelial cells, Grhl2 inactivation impaired epithelial barrier formation and inhibited lumen expansion. Molecular analyses showed that GRHL2 acts as a transcrip- tional activator and strongly associates with histone H3 lysine 4 trimethylation. Integrating genome-wide GRHL2 binding as well as H3 lysine 4 trimethylation chromatin immunoprecipitation sequencing and gene expression data allowed us to derive a high-confidence GRHL2 target set. GRHL2 transactivated a group of genes including Ovol2, encoding the ovo-like 2 zinc finger transcription factor, as well as E-cadherin, claudin 4 (Cldn4), and the small GTPase Rab25. Ovol2 induction alone was sufficient to bypass the requirement of Grhl2 for E-cadherin, Cldn4,andRab25 expression. Re-expression of either Ovol2 or a combination of Cldn4 and Rab25 was sufficient to rescue lumen expansion and barrier formation in Grhl2-deficient collecting duct cells.
    [Show full text]
  • Characterization of Cytosolic Sulfotransferase Expression and Regulation in Human Liver and Intestine
    Wayne State University Wayne State University Dissertations January 2019 Characterization Of Cytosolic Sulfotransferase Expression And Regulation In Human Liver And Intestine Sarah Talal Dubaisi Wayne State University, [email protected] Follow this and additional works at: https://digitalcommons.wayne.edu/oa_dissertations Part of the Molecular Biology Commons, and the Pharmacology Commons Recommended Citation Dubaisi, Sarah Talal, "Characterization Of Cytosolic Sulfotransferase Expression And Regulation In Human Liver And Intestine" (2019). Wayne State University Dissertations. 2158. https://digitalcommons.wayne.edu/oa_dissertations/2158 This Open Access Dissertation is brought to you for free and open access by DigitalCommons@WayneState. It has been accepted for inclusion in Wayne State University Dissertations by an authorized administrator of DigitalCommons@WayneState. CHARACTERIZATION OF CYTOSOLIC SULFOTRANSFERASE EXPRESSION AND REGULATION IN HUMAN LIVER AND INTESTINE by SARAH DUBAISI DISSERTATION Submitted to the Graduate School of Wayne State University, Detroit, Michigan in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY 2018 MAJOR: PHARMACOLOGY Approved By: ________________________________________ Advisor Date ________________________________________ ________________________________________ ________________________________________ ________________________________________ DEDICATION To Mom and Dad for their love, support, and guidance To my husband for being by my side and motivating me during this journey ii ACKNOWLEDGEMENTS I would like to thank my mentors, Dr. Melissa Runge-Morris and Dr. Thomas Kocarek, for their tremendous support, guidance, and patience and for helping me develop or improve the skills that I will need to be an independent researcher. I also want to thank them for allowing me to explore new ideas and present my work at national conferences. I am very grateful to my committee members: Dr.
    [Show full text]
  • Anti-SULT2B1 Antibody (ARG56370)
    Product datasheet [email protected] ARG56370 Package: 100 μl anti-SULT2B1 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes SULT2B1 Tested Reactivity Hu, Ms, Rat Tested Application WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name SULT2B1 Antigen Species Human Immunogen Recombinant protein of Human SULT2B1 Conjugation Un-conjugated Alternate Names Hydroxysteroid sulfotransferase 2; Alcohol sulfotransferase; Sulfotransferase 2B1; EC 2.8.2.2; HSST2; ST2B1; Sulfotransferase family cytosolic 2B member 1 Application Instructions Application table Application Dilution WB 1:500 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control BT474 Calculated Mw 41 kDa Properties Form Liquid Purification Affinity purification with immunogen. Buffer PBS (pH 7.3), 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/2 Bioinformation Gene Symbol SULT2B1 Gene Full Name sulfotransferase family, cytosolic, 2B, member 1 Background Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members.
    [Show full text]
  • SULT2B1 Rabbit Pab
    Leader in Biomolecular Solutions for Life Science SULT2B1 Rabbit pAb Catalog No.: A7736 Basic Information Background Catalog No. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, A7736 neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure Observed MW (number and length of exons) is similar among family members. This gene sulfates 41kDa dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode Calculated MW different isoforms have been described. 39kDa/41kDa Category Primary antibody Applications WB, IHC, IF Cross-Reactivity Human, Mouse, Rat Recommended Dilutions Immunogen Information WB 1:500 - 1:2000 Gene ID Swiss Prot 6820 O00204 IHC 1:50 - 1:200 Immunogen 1:50 - 1:100 IF Recombinant fusion protein containing a sequence corresponding to amino acids 1-365 of human SULT2B1 (NP_814444.1). Synonyms SULT2B1;HSST2 Contact Product Information www.abclonal.com Source Isotype Purification Rabbit IgG Affinity purification Storage Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. Validation Data Western blot analysis of extracts of various cell lines, using SULT2B1 antibody (A7736) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. Immunohistochemistry of paraffin- Immunohistochemistry of paraffin- Immunohistochemistry of paraffin- embedded human liver cancer using embedded human kidney cancer using embedded mouse lung using SULT2B1 SULT2B1 antibody (A7736) at dilution of SULT2B1 antibody (A7736) at dilution of antibody (A7736) at dilution of 1:100 (40x 1:100 (40x lens).
    [Show full text]