DOCSLIB.ORG

Sulfation Through the Looking Glass—Recent Advances in Sulfotransferase Research for the Curious

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Sulfation Through the Looking Glass—Recent Advances in Sulfotransferase Research for the Curious The Pharmacogenomics Journal (2002) 2, 297–308 & 2002 Nature Publishing Group All rights reserved 1470-269X/02 $25.00 www.nature.com/tpj REVIEW Sulfation through the looking glass—recent advances in sulfotransferase research for the curious MWH Coughtrie ABSTRACT Members of the cytosolic sulfotransferase (SULT) superfamily catalyse the Department of Molecular & Cellular Pathology, sulfation of a multitude of xenobiotics, hormones and neurotransmitters. University of Dundee, Ninewells Hospital & Humans have at least 10 functional SULT genes, and a number of recent Medical School, Dundee, Scotland, UK advances reviewed here have furthered our understanding of SULT function. Correspondence: Analysis of expression patterns has shown that sulfotransferases are highly MWH Coughtrie, Department of expressed in the fetus, and SULTs may in fact be a major detoxification Molecular & Cellular Pathology, University enzyme system in the developing human. The X-ray crystal structures of of Dundee, Ninewells Hospital and three SULTs have been solved and combined with mutagenesis experiments Medical School, Dundee DD1 9SY, Scotland, UK. and molecular modelling, they have provided the first clues as to the factors Tel: +44 (0)1382 632510 that govern the unique substrate specificities of some of these enzymes. In Fax: +44 (0)1382 640320 the future these and other studies will facilitate prediction of the fate of E-mail: [email protected] chemicals metabolised by sulfation. Variation in sulfation capacity may be important in determining an individual’s response to xenobiotics, and there has been an explosion in information on sulfotransferase polymorphisms and their functional consequences, including the influence of SULT1A1 genotype on susceptibility to colorectal and breast cancer. Finally, the first gene knockout experiments with SULTs have recently been described, with the generation of estrogen sulfotransferase deficient mice in which reproductive capacity is compromised. Our improved understanding of these enzymes will have significant benefits in such diverse areas as drug design and develop- ment, cancer susceptibility, reproduction and development. The Pharmacogenomics Journal (2002) 2, 297–308. doi:10.1038/sj.tpj.6500117 Keywords: sulfotransferase; sulfation; pharmacogenetics; structural biology; development Sulfation of a vast array of natural and synthetic chemicals as well as many biomolecules occurs widely in nature, from bacteria to humans. This article concerns the formation of sulfate conjugates of xenobiotic and endogenous (endobiotic) small molecules by members of the cytosolic sulfotransferase (SULT) enzyme family. The process was first discovered in the late 1870s by Eugen Baumann, who isolated and characterised the sulfate conjugate of phenol from urine of a patient treated with carbolic acid as an antiseptic. It would be another 80 years, however, before the mechanistic basis of sulfate conjugation could be identified, with the discovery of so-called ‘active sulfate’ by Lipmann’s group.1 This compound, that we now call PAPS (30-phosphoadenosine 50-phosphosul- fate), is the sulfuryl donor for the vast majority of sulfation reactions2 (Box 1). Recent research in this field that will be highlighted here, has uncovered some important aspects of the function of sulfation. The relative importance of sulfation in humans has perhaps been underestimated in the past, and one of the main reasons for this is that there are major inter-species differences in the function of sulfation—in particular relating to its role in modulating the function of Received: 28 February 2002 Revised: 28 March 2002 hormones and neurotransmitters. Importantly, catecholamines, estrogens, Accepted: 4 April 2002 iodothyronines and dehydroepiandrosterone (DHEA) exist in the human Recent advances in sulfotransferase research MWH Coughtrie 298 Box 1 - Sulfotransferase Reaction and Co-substrate Synthesis Paracetamol Paracetamol Sulfate NH CH NH CH3 3 Sulfotransferase O O HO HO 3S 2 APS PAPS PAP ATP 1 ATP ADP PPi SO4-- The sulfotransferase reaction relies on the co-substrate PAPS as sulfuryl donor. PAPS is synthesised from inorganic sulfate and 2 molecules of ATP - it is therefore an "expensive" commodity for cells to produce, and is present at relatively low concentrations, typically no more than 20 or 30µM. Low PAPS levels and rapid depletion is believed to limit the capacity of sulfation compared to e.g. glucuronidation, where the co-substrate (UDP-glucuronic acid) is in more plentiful supply. In animals, synthesis of PAPS is the responsibility of a single bifunctional enzyme called PAPS synthetase (PAPSS) that contains both the ATP sulfurylase (1) and APS kinase (2) catalytic activities. In humans and mice, 2 isoforms of PAPSS exist that are the products of the PAPSS1 and PAPSS2 genes. Mutations in PAPSS2 are responsible for rare inherited connective tissue disorders in mouse (brachymorphism) and humans (spondyloepimetaphyseal dysplasia). It is postulated that interindividual variation in the ability to synthesise PAPS, arising from genetic and/or environmental effects on PAPSS, may influence sulfation capacity. circulation predominantly or significantly as the sulfated SULTs related to the mammalian cytosolic enzymes, that are form, whereas this is not the case for rodents or many other involved in flavonol and brassinosteroid metabolism.16 ‘experimental’ animals.3 This is reflected in the different Other model organisms whose genomes have been (or are SULT isoenzyme profiles that exist in various species. For being) sequenced possess various SULTs—the zebrafish example, to date human is the only species in which a (Danio rerio) and amphibian (Xenopus laevis, Silurana tropi- catecholamine-specific SULT isoform (SULT1A3) has been calis) sequence databases contain numerous cytosolic SULT identified, consistent with the high circulating levels of sequences with orthologs in mammalian species, although catecholamine sulfates found in humans and other pri- the Drosophila melanogaster, Caenorhabditis elegans and mates.3,4 Rodents have multiple isoforms of the hydroxyster- Saccharomyces cerevisiae databanks are almost devoid of such oid SULT subfamily 2A,5–7 whereas so far only a single sequences. A new nomenclature system for the cytosolic SULT2A enzyme has been identified and characterised in SULTs has recently been developed* which will (hopefully) humans.8 Also, it is now clear that SULTs are abundantly help to clarify the relationships between the various SULTs expressed in the human fetus9–13—other ‘drug metabolising for novices and aficionados alike. The nomenclature used enzymes’ such as the cytochromes P450 (CYPs), UDP- here follows this new system. glucuronosyltransferases (UGTs) etc are, in general not The SULT1 and SULT2 families are the largest, and expressed at significant levels until after birth14,15—thus probably the most important for xenobiotic and endobiotic SULTs may represent a front line of chemical defence in the metabolism. At present the human SULT enzyme family, developing human. which is the best characterised, comprises of 11 isoforms This article aims to provide the reader with an up-to-date representing the SULT1, SULT2 and SULT4 families. These overview of sulfation in humans, and to highlight some enzymes are the products of 10 genes (SULTs 2B1a and 2B1b important recent research that has impacted significantly on are generated by alternate splicing of the first exon of our knowledge and understanding of this important meta- SULT2B1) that share many common structural features bolic system. (reviewed in17). The properties of the various human SULTs are summarised in Table 1. The results of many studies show THE SULFOTRANSFERASE SUPERFAMILY— clearly that the expression of SULTs in humans is carefully ORGANISATION AND FUNCTION regulated with respect to tissue type, development and As with many drug metabolising enzymes, the cytosolic hormonal influences, supporting proposed functional roles SULTs are derived from a large superfamily of genes. Full- for some of the enzymes. A number of examples are worth length cDNAs encoding more than 50 mammalian and avian cytosolic SULTs have been cloned and sequenced, and *Raftogianis RB et al, submitted for publication. In particular, the many of the expressed proteins characterised. The majority new nomenclature for the SULT1C enzymes may cause some of these enzymes sulfate small molecule xenobiotics and/or confusion. The human SULT1C2 referred to here was called endogenous hormones and neurotransmitters, and based on SULT1C1 or SULT1C sulfotransferase 1 in the original descrip- amino acid sequence analysis can be subdivided into six tions,18,19,75 and the human SULT1C4 referred to here was originally families (Box 2). In addition plants possess a number of called SULT1C2 or SULT1C sulfotransferase.19,75 The Pharmacogenomics Journal Recent advances in sulfotransferase research MWH Coughtrie 299 considering further: SULTs 1C2 and 1C4 appear to be most 17b-estradiol, suggesting an important role for this enzyme highly expressed in fetal tissues,13 although RNA dot blots in modulating estrogen action.21 Indeed, the enzyme is indicated the adult stomach and kidney (SULT1C2) and expressed in the endometrium and is exquisitely regulated ovary (SULT1C4) may be sites of expression.18,19 However during the menstrual cycle22,23 (probably under the primary the function of these enzymes in humans is not clear. The influence of progesterone24,25) where it is postulated to catecholamine sulfotransferase
Load more

Recommended publications
  • Gene Expression Profiles in Testis of Pigs with Extreme High and Low
    BMC Genomics BioMed Central Research article Open Access Gene expression profiles in testis of pigs with extreme high and low levels of androstenone Maren Moe*1,2, Theo Meuwissen2,3, Sigbjørn Lien2,3, Christian Bendixen4, Xuefei Wang4, Lene Nagstrup Conley4, Ingunn Berget3,5, Håvard Tajet1,2 and Eli Grindflek1,3 Address: 1The Norwegian Pig Breeders Association (NORSVIN), Hamar, Norway., 2Department of Animal and Aquacultural Sciences, Norwegian University of Life Sciences, Ås, Norway., 3Centre for Integrative Genetics (CIGENE), Norwegian University of Life Sciences, Ås, Norway., 4Faculty of Agricultural Sciences, University of Aarhus, Tjele, Denmark. and 5MATFORSK, Osloveien 1, Ås, Norway. Email: Maren Moe* - [email protected]; Theo Meuwissen - [email protected]; Sigbjørn Lien - [email protected]; Christian Bendixen - [email protected]; Xuefei Wang - [email protected]; Lene Nagstrup Conley - [email protected]; Ingunn Berget - [email protected]; Håvard Tajet - [email protected]; Eli Grindflek - [email protected] * Corresponding author Published: 7 November 2007 Received: 3 July 2007 Accepted: 7 November 2007 BMC Genomics 2007, 8:405 doi:10.1186/1471-2164-8-405 This article is available from: http://www.biomedcentral.com/1471-2164/8/405 © 2007 Moe et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Boar taint is a major obstacle when using uncastrated male pigs for swine production. One of the main compounds causing this taint is androstenone, a pheromone produced in porcine testis.
    [Show full text]
  • 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 SULT2B1 Purified Mouse Monoclonal Antibody (Mab) Catalog # AM8716b Specification SULT2B1 - Product Information Application WB,E Primary Accession O00204 Reactivity Human Predicted Human Host Mouse Clonality monoclonal Isotype IgG1,κ Calculated MW 41308 SULT2B1 - Additional Information Gene ID 6820 Other Names Sulfotransferase family cytosolic 2B member 1, ST2B1, Sulfotransferase 2B1, All lanes : Anti-SULT2B1 at 1:2000 dilution 2.8.2.2, Alcohol sulfotransferase, Lane 1: MCF-7 whole cell lysate Lane 2: Hydroxysteroid sulfotransferase 2, MDA-MB-468 whole cell lysate SULT2B1, HSST2 Lysates/proteins at 20 µg per lane. Secondary Goat Anti-mouse IgG, (H+L), Target/Specificity Peroxidase conjugated at 1/10000 dilution. This antibody is generated from a mouse Predicted band size : 41 kDa immunized with a reconbinant protein from Blocking/Dilution buffer: 5% NFDM/TBST. human. Dilution WB~~1:8000 Format Purified monoclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein G column, followed by dialysis against PBS. Storage Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. Precautions SULT2B1 is for research use only and not for use in diagnostic or therapeutic Anti-SULT2B1 at 1:8000 dilution + MCF-7 procedures. whole cell lysate Lysates/proteins at 20 µg per lane. Secondary Goat Anti-mouse IgG, Page 1/3 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 (H+L), Peroxidase conjugated at 1/10000 SULT2B1 - Protein Information dilution.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • An Intracrine View of Sex Steroids, Immunity, and Metabolic Regulation
    Review An intracrine view of sex steroids, immunity, and metabolic regulation Katya B. Rubinow ABSTRACT Background: Over the past two decades, parallel recognition has grown of the importance of both sex steroids and immune activity in metabolic regulation. More recently, these discrete areas have been integrated in studies examining the metabolic effects of sex steroid immunomodulation. Implicit in these studies has been a traditional, endocrine model of sex steroid delivery from the gonads to target cells, including immune cells. Thus, research to date has focused on the metabolic effects of sex steroid receptor signaling in immune cells. This endocrine model, however, overlooks the extensive capacity of immune cells to generate and metabolize sex steroids, enabling the production of sex steroids for intracrine signaling e that is, sex steroid production for signaling within the cell of origin. Intracrine function allows highly cell-autonomous regulation of sex steroid exposure, and sex steroid secretion by immune cells could confer paracrine signaling effects in neighboring cells within metabolic tissues. In this review, immune cell intracrinology will denote sex steroid production within immune cells for either intracrine or paracrine signaling. This intracrine capacity of immune cells has been well established, and prior work has supported its importance in autoimmune disorders, trauma, and cancer. The potential relevance of immune cell intracrine function to the regulation of energy balance, body weight, body composition, and insulin sensitivity has yet to be explored. Scope of review: The following review will detail findings to date regarding the steroidogenic and steroid metabolizing capacity of immune cells, the regulation of immune cell intracrine function, and the biological effects of immune-derived sex steroids, including the clinical relevance of immune cell intracrinology in fields other than metabolism.
    [Show full text]
  • Chaps 4 & 5: Receptors As Drug Targets, Structure, Function & Signal Transduction
    Chaps 4 & 5: Receptors as drug targets, structure, function & signal transduction Cell signaling is part of a complex system of communication that governs basic cellular activities and coordinates cell actions. Communication allows cells to perceive and correctly respond to their microenvironment for proper development, tissue repair, and immunity and normal tissue function. Errors in cellular information processing are responsible for diseases such as cancer, autoimmunity, diabetes and more. Understanding cell signaling is crucial for treating diseases effectively. signals neighbor receptors (neurotransmitters) self talk talk cell 1 signals cell 2 cell 1 cell 2 cell 3 etc. synapse synapse synapse signals signals receptor a (hormones) (hormones) receptor b cell 2 cell 3 The same signal can deliver different cell 1 messages to different tissues (histamine). cell 5 cell 4 receptor c signals signals (hormones) (hormones) receptor d Important functions of receptors: 1. Globular proteins (receptors) acting as a cell’s ‘letter boxes’ 2. Located mostly in the cell membrane 3. Receive messages from chemical messengers coming from other cells 4. Transmit a message into the cell leading to a cellular effect 5. Different receptors specific for different chemical messengers 6. Each cell has a range of receptors in the cell membrane making it responsive to different chemical messengers 1 © Oxford University Press, 2013 Signals can be divided into the 5 catagories below. Signal carriers (S) have to reach the proper receptors (R) for the message to be recieved. Intracrine signals are produced by the target cell that stay within the target cell. cell a S = signal S R R = receptor Autocrine signals are produced by the target cell, are secreted, and affect the target cell itself via receptors.
    [Show full text]
  • Transcriptional Recapitulation and Subversion Of
    Open Access Research2007KaiseretVolume al. 8, Issue 7, Article R131 Transcriptional recapitulation and subversion of embryonic colon comment development by mouse colon tumor models and human colon cancer Sergio Kaiser¤*, Young-Kyu Park¤†, Jeffrey L Franklin†, Richard B Halberg‡, Ming Yu§, Walter J Jessen*, Johannes Freudenberg*, Xiaodi Chen‡, Kevin Haigis¶, Anil G Jegga*, Sue Kong*, Bhuvaneswari Sakthivel*, Huan Xu*, Timothy Reichling¥, Mohammad Azhar#, Gregory P Boivin**, reviews Reade B Roberts§, Anika C Bissahoyo§, Fausto Gonzales††, Greg C Bloom††, Steven Eschrich††, Scott L Carter‡‡, Jeremy E Aronow*, John Kleimeyer*, Michael Kleimeyer*, Vivek Ramaswamy*, Stephen H Settle†, Braden Boone†, Shawn Levy†, Jonathan M Graff§§, Thomas Doetschman#, Joanna Groden¥, William F Dove‡, David W Threadgill§, Timothy J Yeatman††, reports Robert J Coffey Jr† and Bruce J Aronow* Addresses: *Biomedical Informatics, Cincinnati Children's Hospital Medical Center, Cincinnati, OH 45229, USA. †Departments of Medicine, and Cell and Developmental Biology, Vanderbilt University and Department of Veterans Affairs Medical Center, Nashville, TN 37232, USA. ‡McArdle Laboratory for Cancer Research, University of Wisconsin, Madison, WI 53706, USA. §Department of Genetics and Lineberger Cancer Center, University of North Carolina, Chapel Hill, NC 27599, USA. ¶Molecular Pathology Unit and Center for Cancer Research, Massachusetts deposited research General Hospital, Charlestown, MA 02129, USA. ¥Division of Human Cancer Genetics, The Ohio State University College of Medicine, Columbus, Ohio 43210-2207, USA. #Institute for Collaborative BioResearch, University of Arizona, Tucson, AZ 85721-0036, USA. **University of Cincinnati, Department of Pathology and Laboratory Medicine, Cincinnati, OH 45267, USA. ††H Lee Moffitt Cancer Center and Research Institute, Tampa, FL 33612, USA. ‡‡Children's Hospital Informatics Program at the Harvard-MIT Division of Health Sciences and Technology (CHIP@HST), Harvard Medical School, Boston, Massachusetts 02115, USA.
    [Show full text]
  • Cell Plasticity and Prostate Cancer: the Role of Epithelial–Mesenchymal Transition in Tumor Progression, Invasion, Metastasis and Cancer Therapy Resistance
    cancers Review Cell Plasticity and Prostate Cancer: The Role of Epithelial–Mesenchymal Transition in Tumor Progression, Invasion, Metastasis and Cancer Therapy Resistance Sofia Papanikolaou, Aikaterini Vourda, Spyros Syggelos and Kostis Gyftopoulos * Department of Anatomy, University of Patras School of Medicine, Rion, 26504 Patras, Greece; [email protected] (S.P.); [email protected] (A.V.); [email protected] (S.S.) * Correspondence: [email protected] Simple Summary: Although epithelial-to-mesenchymal transition (EMT) is a well-known cellular process involved during normal embryogenesis and wound healing, it also has a dark side; it is a complex process that provides tumor cells with a more aggressive phenotype, facilitating tumor metastasis and even resistance to therapy. This review focuses on the key pathways of EMT in the pathogenesis of prostate cancer and the development of metastases and evasion of currently available treatments. Abstract: Prostate cancer, the second most common malignancy in men, is characterized by high heterogeneity that poses several therapeutic challenges. Epithelial–mesenchymal transition (EMT) is a dynamic, reversible cellular process which is essential in normal embryonic morphogenesis and Citation: Papanikolaou, S.; Vourda, wound healing. However, the cellular changes that are induced by EMT suggest that it may also A.; Syggelos, S.; Gyftopoulos, K. Cell play a central role in tumor progression, invasion, metastasis, and resistance to current therapeutic Plasticity and Prostate Cancer: The options. These changes include enhanced motility and loss of cell–cell adhesion that form a more Role of Epithelial–Mesenchymal aggressive cellular phenotype. Moreover, the reverse process (MET) is a necessary element of the Transition in Tumor Progression, Invasion, Metastasis and Cancer metastatic tumor process.
    [Show full text]
  • SULT2B1 (NM 177973) Human Mass Spec Standard Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH304478 SULT2B1 (NM_177973) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: SULT2B1 MS Standard C13 and N15-labeled recombinant protein (NP_814444) Species: Human Expression Host: HEK293 Expression cDNA Clone RC204478 or AA Sequence: Predicted MW: 41.3 kDa Protein Sequence: >RC204478 protein sequence Red=Cloning site Green=Tags(s) MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS PSPGQASETPHPRPS myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq: NP_814444 RefSeq Size: 1228 RefSeq ORF: 1095 Synonyms: ARCI14; HSST2 Locus ID: 6820 UniProt ID: O00204 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 SULT2B1 (NM_177973) Human Mass Spec Standard – PH304478 Cytogenetics: 19q13.33 Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members.
    [Show full text]
  • The Enigmatic Processing and Secretion of Interleukin-33
    Cellular & Molecular Immunology (2010) 7, 260–262 ß 2010 CSI and USTC. All rights reserved 1672-7681/10 $32.00 www.nature.com/cmi MINI REVIEW The enigmatic processing and secretion of interleukin-33 Weihua Zhao and Zhiqing Hu Interleukin-33 (IL-33) is the most attractive novel cytokine identified as an IL-1 family member. IL-33 was first named NF-HEV (nuclear factor from high endothelial venules), as it was known to interact with nuclear chromatin although its exact intracellular functions are still to be clarified. IL-33 is now recognized as the specific ligand for the orphan IL-1 receptor family member ST2 and to be involved in polarization of T cells towards T helper 2 cell phenotype and in activation of mast cells, bosophils, eosinophils and natural killer cells. It is essential for IL-33 to be extracellularly released in order to bind to the ST2 receptor and consequently play a crucial role in inflammatory, infectious and autoimmune diseases. However, like the IL-1 family members, IL-1b and IL-18, IL-33 mRNA is translated without a signal sequence for secretion. Additionally, IL-33 cannot be released by the processing and secretion mechanism shared by IL-1b and IL-18 as IL-33 is not a substrate of caspase-1 and does not require proteolysis for activation. In contrast, IL-33 can be inactivated by apoptotic caspases. Accordingly, IL-33 is proposed to be released as an alarmin from necrotic cells but to be deleted during apoptosis. Besides the known autocrine, paracrine, intracrine, juxtacrine and retrocrine mechanisms of cellular interaction with cytokines, release by necrotic cells is another pathway for a cytokine to display its function, which we suggest might be called ‘necrocrine’.
    [Show full text]
  • Thirty Years of Intracrinology
    The Ochsner Journal 14:673–680, 2014 Ó Academic Division of Ochsner Clinic Foundation Thirty Years of Intracrinology Richard N. Re, MD Research Division, Ochsner Health System, New Orleans, LA lular signaling molecules and could also act in the ABSTRACT intracellular space: these varied factors displayed Background: Intracrinology is the study of the intracellular intracrine functionality. Surprisingly, included among actions, regulation, trafficking, and interactions of extracellular these proteins were growth factors, cytokines, tran- signaling peptides/proteins. scription factors, DNA binding proteins, and en- 1-9 Methods: We describe the development of intracrine biology zymes. since the term was defined in 1984. We developed the basic principles of intracrine action based on observing the functionality of various Results: Intracrine biology plays a role in many normal and intracrines.10-43 For example, many intracrines upre- pathological processes and represents a fertile field for the gulate either their own synthesis or the synthesis of development of novel therapeutics. elements of their signaling cascades. Intracrines can Conclusion: Although 30 years old, the field of intracrinology is operate in positive feedback loops—that is, in what only now becoming widely accepted. Intracrine principles can has been termed a feed-forward mode. For example, be applied to the investigation of physiological processes and angiotensin II action at the nucleus can upregulate the to the development of new therapies. transcription of renin and angiotensinogen. Investiga- tors have reported that high glucose levels stimulate the synthesis of intracellular angiotensin II and establish a feed-forward loop in which angiotensin II INTRODUCTION upregulates angiotensinogen.35,38 This feed-forward In 1984, this laboratory introduced the term loop appears to play a role in diabetes-related intracrine, meaning the action of a peptide hormone pathology and in particular diabetic cardiomyopathy.
    [Show full text]
  • 2971.Full-Text.Pdf
    Published OnlineFirst March 28, 2014; DOI: 10.1158/1078-0432.CCR-13-2567 Clinical Cancer Imaging, Diagnosis, Prognosis Research Steroidogenic Germline Polymorphism Predictors of Prostate Cancer Progression in the Estradiol Pathway Eric Levesque 1,2, Isabelle Laverdiere 1, Etienne Audet-Walsh1, Patrick Caron1,Melanie Rouleau1, Yves Fradet2, Louis Lacombe2, and Chantal Guillemette1 Abstract Purpose: Reliable biomarkers that predict prostate cancer outcomes are urgently needed to improve and personalize treatment approaches. With this goal in mind, we individually and collectively appraised common genetic polymorphisms related to estradiol metabolic pathways to find prostate cancer prognostic markers. Methods: The genetic profiles of 526 men with organ-confined prostate cancer were examined to find common genetic polymorphisms related to estradiol metabolic pathways and these findings were replicated in a cohort of 213 men with more advanced disease (follow-up time for both cohorts, >7.4 years). Specifically, we examined 71 single-nucleotide polymorphisms (SNP) in SULT2A1, SULT2B1, CYP1B1, COMT, CYP3A4, CYP3A5, CYP3A43, NQO1, and NQO2 and assessed the impact of the SNPs alone and in combination on prostate cancer progression and on circulating hormone levels. Results: According to a multivariate analysis, CYP1B1 (rs1800440), COMT (rs16982844), and SULT2B1 (rs12460535, rs2665582, rs10426628) were significantly associated with prostate cancer progression and hormone levels. Remarkably, by combining the SNP information with previously identified HSD17B2
    [Show full text]
  • Investigating Neural Stem and Progenitor Cell Intracrine Signaling Presented in Partial Fulfilment of the Requirements the Maste
    Investigating Neural Stem and Progenitor Cell Intracrine Signaling Presented in Partial Fulfilment of the Requirements the Master of Arts in the Psychology Graduate Program of The Ohio State University By Tyler Dause B.S. Graduate Program in Psychology Thesis Committee Elizabeth Kirby Ph.D., Advisor Kathryn Lenz Ph.D. Jonathan Godbout Ph.D. Copyrighted by Tyler Dause 2019 ii Abstract In the adult mammalian brain, there are two regions where neural stem and progenitor cells reside and proliferate throughout life: the subventricular zone (SVZ) and the dentate gyrus (DG) of the hippocampus. While much of the current research focuses on these cells’ ability to create new neurons, a process known as neurogenesis, new findings indicate that neural stem and progenitor cells (NSPCs) may influence their niches through the secretion of growth factors. Our previous work indicates that NSPCs express 1/3 of the vascular endothelial growth factor (VEGF) in the DG. While global VEGF has been shown to support the proliferation and maturation of adult-born DG neurons, the role of NSPC-derived VEGF is not entirely understood. Our data suggest that VEGF plays a role in regulating NSPC stemness in the DG. Currently, we aim to investigate the role of a VEGF/VEGFR2 intracellular autocrine (i.e. intracrine) signaling pathway in regulating NSPC stemness and maintenance. This thesis contributes to our ongoing work by investigating the immediate effects of VEGF knockdown on NSPC stemness in vitro and modeling VEGF knockdown to determine the NSPC-derived VEGF signaling pathway in vivo. My results suggest NSPC-derived VEGF knockdown increases NSPC proliferation, which is indicative of impaired stemness, in vitro.
    [Show full text]