DOCSLIB.ORG

Download (PDF)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Download (PDF) SEQ_ID GeneID fold change Gene name Description AhR-related genes Aryl hydrocarbon receptor nuclear translocator-like protein 1 (Brain and muscle NM_024362 29657 6.102 Arntl ARNT-like 1)(Tic) [Source:UniProtKB/Swiss-Prot;Acc:Q9EPW1] PhaseⅠdrug metabolic enzymes NADP-dependent malic enzyme (NADP-ME)(EC 1.1.1.40)(Malic enzyme 1) NM_012600 24552 2.321 Me1 [Source:UniProtKB/Swiss-Prot;Acc:P13697] Cytochrome P450 4A10 (CYPIVA10)(Lauric acid omega-hydroxylase)(EC NM_153307 50549 2.680 Cyp4a1、Cyp4a10 1.14.15.3)(Cytochrome P450-LA-omega 1)(Cytochrome P452) [Source:UniProtKB/Swiss-Prot;Acc:P08516] XM_001080197 308190 2.338 Cyp26c1 Cyp26c1 cytochrome P450, family 26, subfamily C, polypeptide 1 [ Rattus XM_001077204 502387 2.366 LOC502387 similar to cytochrome P450 2C66; CYP2C66 [ Rattus norvegicus ] Cytochrome P450 2B15 (EC 1.14.14.1)(CYPIIB15) [Source:UniProtKB/Swiss- XM_001077552 687215 2.048 Cyp2b31 Prot;Acc:Q64583] PhaseⅢdrug metabolic enzymes ATP-binding cassette, sub-family G (WHITE), member 4 [Source:RefSeq XM_001066633 300664 2.187 Abcg4 peptide;Acc:NP_001100286] NM_001015012 308821 2.271 Rab30 RAB30, member RAS oncogene family [Source:RefSeq DNA damage-and/or cell cycle related genes Proto-oncogene serine/threonine-protein kinase pim-1 (EC 2.7.11.1) NM_017034 24649 2.528 Pim1 [Source:UniProtKB/Swiss-Prot;Acc:P26794] Growth arrest and DNA damage-inducible protein GADD45 alpha (DNA damage- NM_024127 25112 2.503 Gadd45a inducible transcript 1 protein)(DDIT-1) [Source:UniProtKB/Swiss- NM_080782 114851 7.312 Cdkn1a cyclin-dependent kinase inhibitor 1A [Source:RefSeq peptide;Acc:NP_542960] Growth arrest and DNA damage-inducible protein GADD45 gamma NM_001077640 291005 12.757 Gadd45g [Source:UniProtKB/Swiss-Prot;Acc:Q9WTQ7] XM_001064075 362485 2.299 Ccne2 cyclin E2 [Source:RefSeq peptide;Acc:NP_001102126] oxidatiev stress related genes XM_001054329 679752 2.224 LOC679752 similar to Glutaredoxin-1 (Thioltransferase-1) (TTase-1) [ Rattus norvegicus ] XM_001056352 680255 2.180 LOC680255 similar to Glutaredoxin-1 (Thioltransferase-1) (TTase-1) [ Rattus norvegicus ] XM_001081076 688082 4.086 LOC688082 similar to glutaredoxin 1 (thioltransferase) [ Rattus norvegicus ] Others Ephrin type-B receptor 1 Precursor (EC 2.7.10.1)(Tyrosine-protein kinase receptor XM_001059882 24338 2.523 Ephb1 EPH-2)(ELK) [Source:UniProtKB/Swiss-Prot;Acc:P09759] NM_012591 24508 2.416 Irf1 Interferon regulatory factor 1 (IRF-1) [Source:UniProtKB/Swiss-Prot;Acc:P23570] XM_001054999 24641 2.298 Flg filaggrin [ Rattus norvegicus ] NM_012630 24684 4.637 Prlr prolactin receptor [ Rattus norvegicus ] Glial cell line-derived neurotrophic factor Precursor (Astrocyte-derived trophic NM_019139 25453 2.155 Gdnf factor)(ATF) [Source:UniProtKB/Swiss-Prot;Acc:Q07731] Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)(Glutamine-dependent NM_013079 25612 2.082 Asns asparagine synthetase) [Source:UniProtKB/Swiss-Prot;Acc:P49088] NM_013092 25627 2.086 Cma1 chymase 1, mast cell [ Rattus norvegicus ] Glucose-6-phosphatase (G-6-Pase)(G6Pase)(EC 3.1.3.9) NM_013098 25634 2.176 G6pc [Source:UniProtKB/Swiss-Prot;Acc:P43428] Insulin-like growth factor-binding protein 1 Precursor (IGF-binding protein NM_013144 25685 10.786 Igfbp1 1)(IGFBP-1)(IBP-1) [Source:UniProtKB/Swiss-Prot;Acc:P21743] Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1-M)(EC 2.3.1.21)(Carnitine O-palmitoyltransferase I, muscle isoform)(CPTI-M)(CPT NM_013200 25756 2.029 Cpt1b I)(Carnitine palmitoyltransferase 1B)(Carnitine palmitoyltransferase I-like protein) [Source:UniProtKB/Swiss-Prot;Acc: NM_017115 29148 2.263 Myog Myogenin [Source:UniProtKB/Swiss-Prot;Acc:P20428] Choline kinase alpha (CK)(EC 2.7.1.32)(CHETK-alpha)(Ethanolamine kinase;)(EK)(EC NM_017127 29194 2.057 Chka 2.7.1.82) [Source:UniProtKB/Swiss-Prot;Acc:Q01134] XM_001076309 29376 2.060 Irs2 insulin receptor substrate 2 [Source:RefSeq peptide;Acc:NP_001162104] High mobility group protein B2 (High mobility group protein 2)(HMG-2) XM_573903 29395 2.317 Hmgb2 [Source:UniProtKB/Swiss-Prot;Acc:P52925] Eotaxin Precursor (C-C motif chemokine 11)(Small-inducible cytokine NM_019205 29397 2.766 Ccl11 A11)(Eosinophil chemotactic protein) [Source:UniProtKB/Swiss-Prot;Acc:P97545] Sodium- and chloride-dependent taurine transporter (Solute carrier family 6 NM_017206 29464 2.376 Slc6a6 member 6) [Source:UniProtKB/Swiss-Prot;Acc:P31643] Voltage-dependent T-type calcium channel subunit alpha-1G (Voltage-gated NM_031601 29717 2.263 Cacna1g calcium channel subunit alpha Cav3.1) [Source:UniProtKB/Swiss- Acetylcholinesterase collagenic tail peptide Precursor (AChE Q NM_019274 29755 2.424 Colq subunit)(Acetylcholinesterase-associated collagen) [Source:UniProtKB/Swiss- Prot;Acc:O35167] Solute carrier family 12 member 3 (Thiazide-sensitive sodium-chloride NM_019345 54300 2.076 Slc12a3 cotransporter)(Na-Cl symporter) [Source:UniProtKB/Swiss-Prot;Acc:P55018] Urea transporter 2 (Urea transporter, kidney)(Solute carrier family 14 member 2) NM_019347 54302 2.328 Slc14a2 [Source:UniProtKB/Swiss-Prot;Acc:Q62668] Prostatic acid phosphatase Precursor (EC 3.1.3.2) [Source:UniProtKB/Swiss- NM_020072 56780 2.377 Acpp Prot;Acc:P20646] Coagulation factor XIII A chain Precursor (Coagulation factor XIIIa)(EC NM_021698 60327 2.336 F13a1 2.3.2.13)(Protein-glutamine gamma-glutamyltransferase A chain)(Transglutaminase A chain) [Source:UniProtKB/Swiss-Prot;Acc:O08619] NM_022586 60337 2.760 Npff neuropeptide FF-amide peptide precursor [ Rattus norvegicus ] NM_022216 60667 2.035 Gpr20 G protein-coupled receptor 20 [ Rattus norvegicus ] Insulin-induced gene 1 protein (INSIG-1)(Insulin-induced growth response protein NM_022392 64194 2.722 Insig1 CL-6)(Immediate-early protein CL-6) [Source:UniProtKB/Swiss-Prot;Acc:Q08755] Prolactin-inducible protein homolog Precursor (Prolactin-induced protein) NM_022708 64673 2.086 Pip [Source:UniProtKB/Swiss-Prot;Acc:O70417] Complexin-1 (Complexin I)(CPX I)(Synaphin-2) [Source:UniProtKB/Swiss- NM_022864 64832 2.013 Cplx1 Prot;Acc:P63041] NM_031699 65129 4.058 Cldn1 Claudin-1 [Source:UniProtKB/Swiss-Prot;Acc:P56745] leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), NM_031713 65146 2.024 Lilrb3 member 3 [Source:RefSeq peptide;Acc:NP_113901] NM_023985 78969 2.114 Trib1 tribbles homolog 1 [Source:RefSeq peptide;Acc:NP_076475] NM_031016 81645 2.866 Chrm2 Muscarinic acetylcholine receptor M2 [Source:UniProtKB/Swiss- Fatty acid desaturase 2 (EC 1.14.19.-)(Delta(6) fatty acid desaturase)(Delta(6) NM_031344 83512 2.191 Fads2 desaturase)(D6D) [Source:UniProtKB/Swiss-Prot;Acc:Q9Z122] Cytokine-inducible SH2-containing protein Fragment (CIS)(CIS-1)(Suppressor of XM_001074104 83681 3.877 Cish cytokine signaling)(SOCS) [Source:UniProtKB/Swiss-Prot;Acc:O70512] NM_032074 84021 2.029 Irs3 insulin receptor substrate 3 [Source:RefSeq peptide;Acc:NP_114463] XM_001062733 84380 2.039 Dhh desert hedgehog [Source:RefSeq peptide;Acc:NP_445819] XM_001055504 84407 2.312 Cdh11 cadherin 11 [Source:RefSeq peptide;Acc:NP_445844] Sodium/potassium/calcium exchanger 2 Precursor (Na(+)/K(+)/Ca(2+)-exchange NM_031743 84550 2.231 Slc24a2 protein 2)(Retinal cone Na-Ca+K exchanger) [Source:UniProtKB/Swiss- Prot;Acc:O54701] Peroxisomal membrane protein 11A (Peroxin-11A)(Peroxisomal biogenesis factor 11A)(Protein PEX11 homolog alpha)(PEX11-alpha)(RnPEX11p)(28 kDa peroxisomal NM_053487 85249 2.040 Pex11a integral membrane protein)(PMP28)(Peroxisomal membrane protein 26)(Pmp26p)(Peroxisomal coatomer /.../ NM_053549 89811 2.184 Vegfb vascular endothelial growth factor B [Source:RefSeq peptide;Acc:NP_446001] NM_053551 89813 4.762 Pdk4 pyruvate dehydrogenase kinase, isozyme 4 Ephrin-A1 Precursor (EPH-related receptor tyrosine kinase ligand 1)(LERK- NM_053599 94268 2.213 Efna1 1)(Immediate early response protein B61) [Contains Ephrin-A1, secreted form] [Source:UniProtKB/Swiss-Prot;Acc:P97553] Nuclear protein 1 (Protein p8)(Candidate of metastasis 1) NM_053611 113900 3.571 Nupr1 [Source:UniProtKB/Swiss-Prot;Acc:O54842] P2X purinoceptor 5 (P2X5)(ATP receptor)(Purinergic receptor) NM_080780 113995 2.239 P2rx5 [Source:UniProtKB/Swiss-Prot;Acc:P51578] doublesex and mab-3 related transcription factor 1 [Source:RefSeq NM_053706 114498 2.053 Dmrt1 peptide;Acc:NP_446158] Nuclear factor interleukin-3-regulated protein (E4 promoter-binding protein 4) NM_053727 114519 3.104 Nfil3 [Source:UniProtKB/Swiss-Prot;Acc:Q6IMZ0] Alpha-1B-glycoprotein Precursor (Alpha-1-B glycoprotein)(Liver regeneration- NM_022258 140656 2.134 A1bg related protein 1)(C44) [Source:UniProtKB/Swiss-Prot;Acc:Q9EPH1] Tumor necrosis factor receptor superfamily member 1B Precursor (Tumor necrosis factor receptor 2)(TNF-R2)(Tumor necrosis factor receptor type II)(TNF- NM_130426 156767 2.171 Tnfrsf1b RII)(TNFR-II)(p75)(p80 TNF-alpha receptor)(CD120b antigen) [Source:UniProtKB/Swiss-Prot;Acc:Q80WY6] NM_130752 170580 3.388 Fgf21 fibroblast growth factor 21 [Source:RefSeq peptide;Acc:NP_570108] Fibroblast growth factor 12 (FGF-12)(Fibroblast growth factor homologous factor NM_130814 170630 2.048 Fgf12 1)(FHF-1) [Source:UniProtKB/Swiss-Prot;Acc:P61150] Olfactory receptor 51E2 (Olfactory receptor 59)(G-protein coupled receptor RA1c) NM_173293 170816 2.200 Olr59 [Source:UniProtKB/Swiss-Prot;Acc:O88628] Potassium voltage-gated channel subfamily H member 5 (Voltage-gated potassium NM_133610 171146 3.301 Kcnh5 channel subunit Kv10.2)(Ether-a-go-go potassium channel 2)(rEAG2) [Source:UniProtKB/Swiss-Prot;Acc:Q9EPI9] NM_134418 171459 2.269 Gp2 glycoprotein 2 (zymogen granule membrane) [ Rattus norvegicus ] NM_001007605 192239 2.443
Load more

Recommended publications
  • Differential Expression of Hydroxyurea Transporters in Normal and Polycythemia Vera Hematopoietic Stem and Progenitor Cell Subpopulations
    Zurich Open Repository and Archive University of Zurich Main Library Strickhofstrasse 39 CH-8057 Zurich www.zora.uzh.ch Year: 2021 Differential expression of hydroxyurea transporters in normal and polycythemia vera hematopoietic stem and progenitor cell subpopulations Tan, Ge ; Meier-Abt, Fabienne Abstract: Polycythemia vera (PV) is a myeloproliferative neoplasm marked by hyperproliferation of the myeloid lineages and the presence of an activating JAK2 mutation. Hydroxyurea (HU) is a standard treat- ment for high-risk patients with PV. Because disease-driving mechanisms are thought to arise in PV stem cells, effective treatments should target primarily the stem cell compartment. We tested for theantipro- liferative effect of patient treatment with HU in fluorescence-activated cell sorting-isolated hematopoietic stem/multipotent progenitor cells (HSC/MPPs) and more committed erythroid progenitors (common myeloid/megakaryocyte-erythrocyte progenitors [CMP/MEPs]) in PV using RNA-sequencing and gene set enrichment analysis. HU treatment led to significant downregulation of gene sets associated with cell proliferation in PV HSCs/MPPs, but not in PV CMP/MEPs. To explore the mechanism underlying this finding, we assessed for expression of solute carrier membrane transporters, which mediate trans- membrane movement of drugs such as HU into target cells. The active HU uptake transporter OCTN1 was upregulated in HSC/MPPs compared with CMP/MEPs of untreated patients with PV, and the HU diffusion facilitator urea transporter B (UTB) was downregulated in HSC/MPPs compared withCM- P/MEPs in all patient and control groups tested. These findings indicate a higher accumulation ofHU within PV HSC/MPPs compared with PV CMP/MEPs and provide an explanation for the differential effects of HU in HSC/MPPs and CMP/MEPs of patients with PV.
    [Show full text]
  • Abrothrix Olivacea)
    Received: 13 June 2017 | Revised: 30 May 2018 | Accepted: 31 May 2018 DOI: 10.1111/mec.14778 ORIGINAL ARTICLE An association between differential expression and genetic divergence in the Patagonian olive mouse (Abrothrix olivacea) Facundo M. Giorello1,2 | Matias Feijoo1 | Guillermo D'Elía3 | Daniel E. Naya1 | Lourdes Valdez3 | Juan C. Opazo3 | Enrique P. Lessa1 1Departamento de Ecología y Evolución, Facultad de Ciencias, Universidad de la Abstract República, Montevideo, Uruguay Recent molecular studies have found striking differences between desert‐adapted 2Espacio de Biología Vegetal del Noreste, species and model mammals regarding water conservation. In particular, aquaporin Centro Universitario de Tacuarembó, Universidad de la República, Tacuarembó, 4, a classical gene involved in water regulation of model species, is absent or not Uruguay expressed in the kidneys of desert‐adapted species. To further understand the 3Instituto de Ciencias Ambientales y Evolutivas, Universidad Austral de Chile, molecular response to water availability, we studied the Patagonian olive mouse Valdivia, Chile Abrothrix olivacea, a species with an unusually broad ecological tolerance that exhi- Correspondence bits a great urine concentration capability. The species is able to occupy both the Facundo M. Giorello, Departamento de arid Patagonian steppe and the Valdivian and Magellanic forests. We sampled 95 Ecología y Evolución, Facultad de Ciencias, Universidad de la República, Iguá 4225, olive mouse specimens from four localities (two in the steppe and two in the for- Montevideo 11400, Uruguay. ests) and analysed both phenotypic variables and transcriptomic data to investigate Email: [email protected] the response of this species to the contrasting environmental conditions. The rela- Funding information tive size of the kidney and the ratio of urine to plasma concentrations were, as Fondo Nacional de Desarrollo Científico y Tecnológico, Grant/Award Number: expected, negatively correlated with annual rainfall.
    [Show full text]
  • Structure and Permeation Mechanism of a Mammalian Urea Transporter
    Structure and permeation mechanism of a mammalian urea transporter Elena J. Levina,1, Yu Caoa,1, Giray Enkavib, Matthias Quickc, Yaping Pana, Emad Tajkhorshidb,2, and Ming Zhoua,2 aDepartment of Physiology and Cellular Biophysics, College of Physicians and Surgeons, Columbia University, 630 West 168th Street, New York, NY 10032; bCenter for Biophysics and Computational Biology, Department of Biochemistry, College of Medicine, and Beckman Institute for Advanced Science and Technology, University of Illinois at Urbana-Champaign, Urbana, IL 61801; and cDepartment of Psychiatry and Center for Molecular Recognition, Columbia University, 650 West 168th Street, New York, NY 10032 Edited by Christopher Miller, HHMI, Brandeis University, Waltham, MA, and approved June 1, 2012 (received for review May 3, 2012) As an adaptation to infrequent access to water, terrestrial mam- homolog (21), dvUT, which forms a trimer with a continuous mals produce urine that is hyperosmotic to plasma. To prevent membrane-spanning pore at the center of each protomer. How- osmotic diuresis by the large quantity of urea generated by protein ever, it remained unclear how similar this structure was to that catabolism, the kidney epithelia contain facilitative urea transpor- of the mammalian UTs, and the details of the permeation me- ters (UTs) that allow rapid equilibration between the urinary space chanism were unknown. To answer these questions, we solved and the hyperosmotic interstitium. Here we report the first X-ray the structure of a mammalian UT-B and investigated the permea- crystal structure of a mammalian UT, UT-B, at a resolution of 2.36 Å. tion mechanism with molecular dynamics simulations and func- UT-B is a homotrimer and each protomer contains a urea con- tional studies of UT-B mutants.
    [Show full text]
  • H00008170-Q01 規格 : [ 10 Ug ] [ 25 Ug ] List All
    SLC14A2 (Human) Recombinant Protein (Q01) Catalog # : H00008170-Q01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human SLC14A2 partial ORF ( NP_009094, 40 a.a. - 128 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCI protein) CLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ Antibody Production Host: Wheat Germ (in vitro) Protein Array Theoretical MW 35.53 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Applications Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array Page 1 of 2 2016/5/22 Gene Information Entrez GeneID: 8170 GeneBank NM_007163 Accession#: Protein NP_009094 Accession#: Gene Name: SLC14A2 Gene Alias: FLJ16167,HUT2,MGC119566,MGC119567,UT-A2,UT2,UTA,UTR,hUT- A6 Gene solute carrier family 14 (urea transporter), member 2 Description: Omim ID: 601611 Gene Ontology: Hyperlink Gene Summary: In mammalian cells, urea is the chief end-product of nitrogen catabolism and plays an important role in the urinary concentration
    [Show full text]
  • Computational Dissection of Human Episodic Memory Reveals Mental
    Computational dissection of human episodic memory PNAS PLUS reveals mental process-specific genetic profiles Gediminas Luksysa,1, Matthias Fastenratha, David Coynela, Virginie Freytagb, Leo Gschwindb, Angela Heckb, Frank Jessenc,d, Wolfgang Maierd,e, Annette Milnikb,f, Steffi G. Riedel-Hellerg, Martin Schererh, Klara Spaleka, Christian Voglerb,f, Michael Wagnerd,e, Steffen Wolfsgruberd,e, Andreas Papassotiropoulosb,f,i,j,1,2, and Dominique J.-F. de Quervaina,f,j,1,2 aDivision of Cognitive Neuroscience, Department of Psychology, University of Basel, CH-4055, Basel, Switzerland; bDivision of Molecular Neuroscience, Department of Psychology, University of Basel, CH-4055, Basel, Switzerland; cDepartment of Psychiatry, University of Cologne, D-50937, Cologne, Germany; dGerman Center for Neurodegenerative Diseases, D-53175, Bonn, Germany; eDepartment of Psychiatry, University of Bonn, D-53105, Bonn, Germany; fUniversity Psychiatric Clinics, University of Basel, CH-4012, Basel, Switzerland; gInstitute of Social Medicine, Occupational Health and Public Health, University of Leipzig, D-04103, Leipzig, Germany; hCenter for Psychosocial Medicine, Department of Primary Medical Care, University Medical Center Hamburg-Eppendorf, D-20246, Hamburg, Germany; iLife Sciences Training Facility, Biozentrum, University of Basel, CH-4056, Basel, Switzerland; and jTransfaculty Research Platform, University of Basel, CH-4055, Basel, Switzerland Edited by James L. McGaugh, University of California Irvine, CA, and approved July 9, 2015 (received for review January 18, 2015) Episodic memory performance is the result of distinct mental the model-based analysis approach has largely been missing from processes, such as learning, memory maintenance, and emotional studies of human episodic memory and genome-wide association modulation of memory strength. Such processes can be effectively studies (GWAS).
    [Show full text]
  • SPC-406 UT-A1 Polyclonal Antibody.Docx
    UT-A1 Antibody Rabbit Anti-Rat UT-A1 Antibody Polyclonal Discovery through partnership | Excellence through quality Catalog No. SPC-406 Overview Product Name Anti-UT-A1 Antibody Sizes Available 100 µg (Catalog No. SPC-406D) Species Reactivity Rat | Mouse Tested Applications WB | ICC/IF Antibody Dilution WB (1:1000); optimal dilutions for assays should be determined by the user. Produced against a synthetic peptide mapped to the C-terminal tail (amino acids 911-929) of rat UT-A1 Immunogen (antibody designation L194) Concentration 1 mg/ml Properties Storage Buffer PBS, 50% glycerol, 0.09% sodium azide Storage Conditions/ -20ºC; 1 year+ Avoid freeze/ thaw cycle. Shipping Temperature Blue Ice or 4ºC. Purification Affinity Purified Product Type Polyclonal Specificity Detects ~97 and 127kDa. 1 µg/ml of SPC-406 was sufficient for detection of UT-A1 in 20 µg of rat kidney tissue lysate by colorimetric Certificate of Analysis immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody. Biological Description SLC14A2 Antibody, FLJ16167 Antibody, hUT-A6 Antibody, HUT2 Antibody, kidney Antibody, MGC119566 Antibody, MGC119567 Antibody, Slc14a2 Antibody, Solute carrier family 14 (urea transporter) Antibody, Alternative Name(s) member 2 Antibody, Solute carrier family 14 member 2 Antibody, Urea transporter 2 Antibody, Urea transporter Antibody, Urea transporter kidney Antibody, UT-A2 Antibody, UT2 Antibody, UT2_HUMAN Antibody, UTA Antibody, UTR Antibody, UT1 Antibody, UTA1 Antibody Research Area(s) Neuroscience | Pumps/Transporters | Urea Transporters Cellular Localization N/A Sequence References Gene ID: 54302; Accession Number: NP_062220; Swiss Prot: Q62668 Function UT-A1, a kidney-specific urea transporter is expressed in the renal collecting duct where it mediates trans-epithelial urea transport and is a target for regulation by vasopressin.
    [Show full text]
  • Structure and Permeation Mechanism of a Mammalian Urea Transporter
    Structure and permeation mechanism of a mammalian urea transporter Elena J. Levina,1, Yu Caoa,1, Giray Enkavib, Matthias Quickc, Yaping Pana, Emad Tajkhorshidb,2, and Ming Zhoua,2 aDepartment of Physiology and Cellular Biophysics, College of Physicians and Surgeons, Columbia University, 630 West 168th Street, New York, NY 10032; bCenter for Biophysics and Computational Biology, Department of Biochemistry, College of Medicine, and Beckman Institute for Advanced Science and Technology, University of Illinois at Urbana-Champaign, Urbana, IL 61801; and cDepartment of Psychiatry and Center for Molecular Recognition, Columbia University, 650 West 168th Street, New York, NY 10032 Edited by Christopher Miller, HHMI, Brandeis University, Waltham, MA, and approved June 1, 2012 (received for review May 3, 2012) As an adaptation to infrequent access to water, terrestrial mam- homolog (21), dvUT, which forms a trimer with a continuous mals produce urine that is hyperosmotic to plasma. To prevent membrane-spanning pore at the center of each protomer. How- osmotic diuresis by the large quantity of urea generated by protein ever, it remained unclear how similar this structure was to that catabolism, the kidney epithelia contain facilitative urea transpor- of the mammalian UTs, and the details of the permeation me- ters (UTs) that allow rapid equilibration between the urinary space chanism were unknown. To answer these questions, we solved and the hyperosmotic interstitium. Here we report the first X-ray the structure of a mammalian UT-B and investigated the permea- crystal structure of a mammalian UT, UT-B, at a resolution of 2.36 Å. tion mechanism with molecular dynamics simulations and func- UT-B is a homotrimer and each protomer contains a urea conduc- tional studies of UT-B mutants.
    [Show full text]
  • Baoxue Yang Jeff M. Sands Editors Urea Transporters Subcellular Biochemistry
    Subcellular Biochemistry 73 Baoxue Yang Jeff M. Sands Editors Urea Transporters Subcellular Biochemistry Volume 73 Series editor Robin Harris, Northumberland, UK More information about this series at http://www.springer.com/series/6515 Baoxue Yang · Jeff M. Sands Editors Urea Transporters 1 3 Editors Baoxue Yang Jeff M. Sands Department of Pharmacology Renal Division, Department of Medicine School of Basic Medical Sciences and Department of Physiology Peking University Emory University School of Medicine Beijing Atlanta, GA China USA ISSN 0306-0225 ISBN 978-94-017-9342-1 ISBN 978-94-017-9343-8 (eBook) DOI 10.1007/978-94-017-9343-8 Library of Congress Control Number: 2014949493 Springer Dordrecht Heidelberg New York London © Springer Science Business Media Dordrecht 2014 This work is subject+ to copyright. All rights are reserved by the Publisher, whether the whole or part of the material is concerned, specifically the rights of translation, reprinting, reuse of illustrations, recitation, broadcasting, reproduction on microfilms or in any other physical way, and transmission or information storage and retrieval, electronic adaptation, computer software, or by similar or dissimilar methodology now known or hereafter developed. Exempted from this legal reservation are brief excerpts in connection with reviews or scholarly analysis or material supplied specifically for the purpose of being entered and executed on a computer system, for exclusive use by the purchaser of the work. Duplication of this publication or parts thereof is permitted only under the provisions of the Copyright Law of the Publisher’s location, in its current version, and permission for use must always be obtained from Springer.
    [Show full text]
  • Lithium Chloride and GSK3 Inhibition Reduce Aquaporin-2 Expression in Primary Cultured Inner Medullary Collecting Duct Cells Due to Independent Mechanisms
    cells Article Lithium Chloride and GSK3 Inhibition Reduce Aquaporin-2 Expression in Primary Cultured Inner Medullary Collecting Duct Cells Due to Independent Mechanisms Marc Kaiser 1 and Bayram Edemir 2,* 1 Medizinische Klinik D, Experimentelle Nephrologie, Universitätsklinikum Münster, 48143 Münster, Germany; [email protected] 2 Department of Medicine, Hematology and Oncology, Martin Luther University Halle-Wittenberg, 06120 Halle (Saale), Germany * Correspondence: [email protected]; Tel.: +49-345-557-4890; Fax: +49-345-557-2950 Received: 20 March 2020; Accepted: 19 April 2020; Published: 23 April 2020 Abstract: Lithium chloride (LiCl) is a widely used drug for the treatment of bipolar disorders, but as a side effect, 40% of the patients develop diabetes insipidus. LiCl affects the activity of the glycogen synthase kinase 3 (GSK3), and mice deficient for GSK3β showed a reduction in the urine concentration capability. The cellular and molecular mechanisms are not fully understood. We used primary cultured inner medullary collecting duct cells to analyze the underlying mechanisms. LiCl and the inhibitor of GSK3 (SB216763) induced a decrease in the aquaporin-2 (Aqp2) protein level. LiCl induced downregulation of Aqp2 mRNA expression while SB216763 had no effect and TWS119 led to increase in expression. The inhibition of the lysosomal activity with bafilomycin or chloroquine prevented both LiCl- and SB216763-mediated downregulation of Aqp2 protein expression. Bafilomycin and chloroquine induced the accumulation of Aqp2 in lysosomal structures, which was prevented in cells treated with dibutyryl cyclic adenosine monophosphate (dbcAMP), which led to phosphorylation and membrane localization of Aqp2. Downregulation of Aqp2 was also evident when LiCl was applied together with dbcAMP, and dbcAMP prevented the SB216763-induced downregulation.
    [Show full text]
  • PHYSIOLOGICAL and TRANSCRIPTOMIC ASPECTS of ADAPTATION to EXTREME ENVIRONMENTS by COURTNEY NICOLE PASSOW B.S., Texas A&M Un
    PHYSIOLOGICAL AND TRANSCRIPTOMIC ASPECTS OF ADAPTATION TO EXTREME ENVIRONMENTS by COURTNEY NICOLE PASSOW B.S., Texas A&M University, 2011 AN ABSTRACT OF A DISSERTATION submitted in partial fulfillment of the requirements for the degree DOCTOR OF PHILOSOPHY Division of Biology College of Arts and Sciences KANSAS STATE UNIVERSITY Manhattan, Kansas 2016 Abstract Extremophiles are organisms with the ability to survive in environments characterized by strong physicochemical stressors lethal to most other organisms, providing excellent models to further our understanding of life’s capacities and limitations to deal with far-from-average conditions. I studied how physiological processes varied among fish residing in starkly different environmental conditions to understand how organisms cope with extreme environments and disentangle the roles of short-term plastic responses and evolved population differences in shaping physiological responses. I used the Poecilia mexicana model, a series of extremophile fish populations that has colonized toxic hydrogen sulfide (H2S) rich springs and caves, to address three major objectives: (1) I investigated the energetic consequences of life in extreme environments and tested whether predicted reductions in organismal energy demands evolved repeatedly along replicated environmental gradients. (2) I characterized variation in gene expression among populations and organs to test for interactive effects between different stressors and identify potential physiological mechanisms underlying adaptation to H2S and cave environments. (3) I conducted common garden and H2S-exposure experiments to test how evolutionary change and plasticity interact to shape variation in gene expression observed in nature. To address these objectives, I measured variation in metabolic physiology and quantified variation in physiological processes through genome-wide gene expression analyses.
    [Show full text]
  • Genómica De Los Procesos De Colonización En La Región Austral De Sudamérica
    TESIS DE DOCTORADO PEDECIBA BIOLOGÍA Genómica de los procesos de colonización en la región austral de Sudamérica Mag. Facundo Giorello Tutor: Dr. Enrique Lessa Tribunal: Susana González, Arley Camargo, María Inés Fariello Facultad de Ciencias, Universidad de la República Montevideo, Uruguay 2019 ÍNDICE RESUMEN.............................................................................................................................................................1 INTRODUCCIÓN..................................................................................................................................................3 Factores determinantes para la Biogeografía de América del Sur.................................................................3 Métodos y análisis filogeográficos...............................................................................................................6 RNA-seq y expresión diferencial................................................................................................................11 Antecedentes filogeográficos y ecológicos de Abrothrix olivacea..............................................................13 OBJETIVOS.........................................................................................................................................................15 CAPÍTULOS........................................................................................................................................................16 Capítulo 1...................................................................................................................................................16
    [Show full text]
  • Analysis of the Regulation of Drug Uptake and Detoxification Systems in the Blood- Cerebrospinal Fluid Barrier: the Role of Sex Hormones and Circadian Rhythm
    Analysis of the regulation of drug uptake and detoxification systems in the blood- cerebrospinal fluid barrier: the role of sex hormones and circadian rhythm (Versão final após defesa) Rafael Morais Mineiro Dissertação para obtenção do Grau de Mestre em Bioquímica (2º ciclo de estudos) Orientador: Profª. Doutora Telma Alexandra Quintela Paixão Co-orientador: Profª. Doutora Isabel Maria Theriaga Mendes Varanda Gonçalves Julho de 2020 ii Acknowledgments First of all, I would thank some people that anyway made this project possible, and to Universidade da Beira Interior for that five years journey. First, I would like to thank PhD professor Telma Quintela for the opportunity to develop a project in the neuroscience field, to work with circadian rhythms, and for the guidance and scientific knowledge provided during this year. I would like to thank PhD professor Isabel Gonçalves also for the opportunity to develop this work, and for always being available to help. I thank the remaining members of the complexus research group, especially to André and Catarina for all the help and support provided in the laboratory activities. Finally, I thank my friends and family, especially to my parents: João e Elsa for encourage-me and for the support and help provided during these five years. iii iv Resumo Alargado De forma a se adaptarem às alterações diurnas, os organismos vivos desenvolveram ritmos circadianos, que correspondem a alterações com uma ritmicidade de 24 horas nas funções biológicas. Os ritmos circadianos são conduzidos por relógios moleculares que, nos mamíferos, se encontram organizados de forma hierárquica. O núcleo supraquiasmático do hipotálamo opera como oscilador central, tendo a importante função de receber a informação luminosa e sincronizar os osciladores periféricos, de acordo com a hora do dia.
    [Show full text]