DOCSLIB.ORG

PHYSIOLOGICAL and TRANSCRIPTOMIC ASPECTS of ADAPTATION to EXTREME ENVIRONMENTS by COURTNEY NICOLE PASSOW B.S., Texas A&M Un

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
PHYSIOLOGICAL and TRANSCRIPTOMIC ASPECTS of ADAPTATION to EXTREME ENVIRONMENTS by COURTNEY NICOLE PASSOW B.S., Texas A&M Un PHYSIOLOGICAL AND TRANSCRIPTOMIC ASPECTS OF ADAPTATION TO EXTREME ENVIRONMENTS by COURTNEY NICOLE PASSOW B.S., Texas A&M University, 2011 AN ABSTRACT OF A DISSERTATION submitted in partial fulfillment of the requirements for the degree DOCTOR OF PHILOSOPHY Division of Biology College of Arts and Sciences KANSAS STATE UNIVERSITY Manhattan, Kansas 2016 Abstract Extremophiles are organisms with the ability to survive in environments characterized by strong physicochemical stressors lethal to most other organisms, providing excellent models to further our understanding of life’s capacities and limitations to deal with far-from-average conditions. I studied how physiological processes varied among fish residing in starkly different environmental conditions to understand how organisms cope with extreme environments and disentangle the roles of short-term plastic responses and evolved population differences in shaping physiological responses. I used the Poecilia mexicana model, a series of extremophile fish populations that has colonized toxic hydrogen sulfide (H2S) rich springs and caves, to address three major objectives: (1) I investigated the energetic consequences of life in extreme environments and tested whether predicted reductions in organismal energy demands evolved repeatedly along replicated environmental gradients. (2) I characterized variation in gene expression among populations and organs to test for interactive effects between different stressors and identify potential physiological mechanisms underlying adaptation to H2S and cave environments. (3) I conducted common garden and H2S-exposure experiments to test how evolutionary change and plasticity interact to shape variation in gene expression observed in nature. To address these objectives, I measured variation in metabolic physiology and quantified variation in physiological processes through genome-wide gene expression analyses. I found that adaptation to extreme environments directly impacts energy metabolism, with fish living in extreme environments consistently expending less energy overall. Reductions in energy demand have evolved in convergence and were primarily mediated through a life history shift (reduction in body mass). The quantification of gene expression across divergent habitats and organs revealed organ-specific physiological responses in H2S-rich and cave habitats. Gene expression variation in the relevant genes was primarily shaped by evolutionary change in gene regulation, and ancestral plastic responses play a minor role in causing the observed expression differences between replicated sulfidic and nonsulfidic populations in nature. Overall, my research has implications for understanding the capacities and constraints that shape life in extreme environments and aids in our understanding of modifications in physiological pathways mediating adaptation to elevated H2S and perpetual darkness. PHYSIOLOGICAL AND TRANSCRIPTOMIC ASPECTS OF ADAPTATION TO EXTREME ENVIRONMENTS by COURTNEY NICOLE PASSOW B.S., Texas A&M University, 2011 A DISSERTATION submitted in partial fulfillment of the requirements for the degree DOCTOR OF PHILOSOPHY Division of Biology College of Arts and Sciences KANSAS STATE UNIVERSITY Manhattan, Kansas 2016 Approved by: Major Professor Michael Tobler Copyright COURTNEY NICOLE PASSOW 2016 Abstract Extremophiles are organisms with the ability to survive in environments characterized by strong physicochemical stressors lethal to most other organisms, providing excellent models to further our understanding of life’s capacities and limitations to deal with far-from-average conditions. I studied how physiological processes varied among fish residing in starkly different environmental conditions to understand how organisms cope with extreme environments and disentangle the roles of short-term plastic responses and evolved population differences in shaping physiological responses. I used the Poecilia mexicana model, a series of extremophile fish populations that has colonized toxic hydrogen sulfide (H2S) rich springs and caves, to address three major objectives: (1) I investigated the energetic consequences of life in extreme environments and tested whether predicted reductions in organismal energy demands evolved repeatedly along replicated environmental gradients. (2) I characterized variation in gene expression among populations and organs to test for interactive effects between different stressors and identify potential physiological mechanisms underlying adaptation to H2S and cave environments. (3) I conducted common garden and H2S-exposure experiments to test how evolutionary change and plasticity interact to shape variation in gene expression observed in nature. To address these objectives, I measured variation in metabolic physiology and quantified variation in physiological processes through genome-wide gene expression analyses. I found that adaptation to extreme environments directly impacts energy metabolism, with fish living in extreme environments consistently expending less energy overall. Reductions in energy demand have evolved in convergence and were primarily mediated through a life history shift (reduction in body mass). The quantification of gene expression across divergent habitats and organs revealed organ-specific physiological responses in H2S-rich and cave habitats. Gene expression variation in the relevant genes was primarily shaped by evolutionary change in gene regulation, and ancestral plastic responses play a minor role in causing the observed expression differences between replicated sulfidic and nonsulfidic populations in nature. Overall, my research has implications for understanding the capacities and constraints that shape life in extreme environments and aids in our understanding of modifications in physiological pathways mediating adaptation to elevated H2S and perpetual darkness. Table of Contents List of Figures ................................................................................................................................. x List of Tables ................................................................................................................................. xi Acknowledgements ....................................................................................................................... xii Dedication ..................................................................................................................................... xv Preface.......................................................................................................................................... xvi Chapter 1 - Reduction of energetic demands through modification of body size and routine metabolic rates in extremophile fish1 ...................................................................................... 1 Abstract ....................................................................................................................................... 1 Introduction ................................................................................................................................. 2 Material and Methods ................................................................................................................. 6 Results ....................................................................................................................................... 11 Discussion ................................................................................................................................. 13 Figures ...................................................................................................................................... 19 Tables ........................................................................................................................................ 22 Chapter 2 - Convergent evolution of reduced energy demands in extremophile fish .................. 26 Abstract ..................................................................................................................................... 26 Introduction ............................................................................................................................... 27 Materials and methods .............................................................................................................. 29 Results ....................................................................................................................................... 33 Discussion ................................................................................................................................. 34 Figures ...................................................................................................................................... 39 Tables ........................................................................................................................................ 41 Chapter 3 - Tissue-specific responses to toxic hydrogen sulfide and permanent darkness in livebearing fishes ................................................................................................................... 45 Abstract ..................................................................................................................................... 45 Introduction ............................................................................................................................... 46 Methods ...................................................................................................................................
Load more

Recommended publications
  • Article Evolutionary Dynamics of the OR Gene Repertoire in Teleost Fishes
    bioRxiv preprint doi: https://doi.org/10.1101/2021.03.09.434524; this version posted March 10, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Article Evolutionary dynamics of the OR gene repertoire in teleost fishes: evidence of an association with changes in olfactory epithelium shape Maxime Policarpo1, Katherine E Bemis2, James C Tyler3, Cushla J Metcalfe4, Patrick Laurenti5, Jean-Christophe Sandoz1, Sylvie Rétaux6 and Didier Casane*,1,7 1 Université Paris-Saclay, CNRS, IRD, UMR Évolution, Génomes, Comportement et Écologie, 91198, Gif-sur-Yvette, France. 2 NOAA National Systematics Laboratory, National Museum of Natural History, Smithsonian Institution, Washington, D.C. 20560, U.S.A. 3Department of Paleobiology, National Museum of Natural History, Smithsonian Institution, Washington, D.C., 20560, U.S.A. 4 Independent Researcher, PO Box 21, Nambour QLD 4560, Australia. 5 Université de Paris, Laboratoire Interdisciplinaire des Energies de Demain, Paris, France 6 Université Paris-Saclay, CNRS, Institut des Neurosciences Paris-Saclay, 91190, Gif-sur- Yvette, France. 7 Université de Paris, UFR Sciences du Vivant, F-75013 Paris, France. * Corresponding author: e-mail: [email protected]. !1 bioRxiv preprint doi: https://doi.org/10.1101/2021.03.09.434524; this version posted March 10, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Teleost fishes perceive their environment through a range of sensory modalities, among which olfaction often plays an important role.
    [Show full text]
  • Female Choice Undermines the Emergence of Strong Sexual Isolation Between Locally Adapted Populations of Atlantic Mollies (Poecilia Mexicana)
    G C A T T A C G G C A T genes Article Female Choice Undermines the Emergence of Strong Sexual Isolation between Locally Adapted Populations of Atlantic Mollies (Poecilia mexicana) Claudia Zimmer 1,2,*, Rüdiger Riesch 3 ID , Jonas Jourdan 4 ID , David Bierbach 5, Lenin Arias-Rodriguez 6 and Martin Plath 1,7 1 College of Animal Science & Technology, Northwest A&F University, Yangling 712100, China; [email protected] 2 Department of Ecology and Evolution, Goethe University of Frankfurt, Max-von-Laue-Straße 13, D-60438 Frankfurt am Main, Germany 3 Centre for Ecology, Evolution and Behaviour, School of Biological Sciences, Royal Holloway University of London, Egham, Surrey TW20 0EX, UK; [email protected] 4 Department of River Ecology and Conservation, Senckenberg Research Institute and Natural History Museum Frankfurt, D-63571 Gelnhausen, Germany; [email protected] 5 Department of Biology and Ecology of Fishes, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Müggelseedamm 310, D-12587 Berlin, Germany; [email protected] 6 División Académica de Ciencias Biológicas, Universidad Juárez Autónoma de Tabasco (UJAT), 86150 Villahermosa, Tabasco, Mexico; [email protected] 7 Shaanxi Key Laboratory of Molecular Biology for Agriculture, Northwest A&F University, Yangling 712100, China * Correspondence: [email protected] Received: 24 January 2018; Accepted: 25 April 2018; Published: 2 May 2018 Abstract: Divergent selection between ecologically dissimilar habitats promotes local adaptation, which can lead to reproductive isolation (RI). Populations in the Poecilia mexicana species complex have independently adapted to toxic hydrogen sulfide and show varying degrees of RI. Here, we examined the variation in the mate choice component of prezygotic RI.
    [Show full text]
  • Andrea RAZ-GUZMÁN1*, Leticia HUIDOBRO2, and Virginia PADILLA3
    ACTA ICHTHYOLOGICA ET PISCATORIA (2018) 48 (4): 341–362 DOI: 10.3750/AIEP/02451 AN UPDATED CHECKLIST AND CHARACTERISATION OF THE ICHTHYOFAUNA (ELASMOBRANCHII AND ACTINOPTERYGII) OF THE LAGUNA DE TAMIAHUA, VERACRUZ, MEXICO Andrea RAZ-GUZMÁN1*, Leticia HUIDOBRO2, and Virginia PADILLA3 1 Posgrado en Ciencias del Mar y Limnología, Universidad Nacional Autónoma de México, Ciudad de México 2 Instituto Nacional de Pesca y Acuacultura, SAGARPA, Ciudad de México 3 Facultad de Ciencias, Universidad Nacional Autónoma de México, Ciudad de México Raz-Guzmán A., Huidobro L., Padilla V. 2018. An updated checklist and characterisation of the ichthyofauna (Elasmobranchii and Actinopterygii) of the Laguna de Tamiahua, Veracruz, Mexico. Acta Ichthyol. Piscat. 48 (4): 341–362. Background. Laguna de Tamiahua is ecologically and economically important as a nursery area that favours the recruitment of species that sustain traditional fisheries. It has been studied previously, though not throughout its whole area, and considering the variety of habitats that sustain these fisheries, as well as an increase in population growth that impacts the system. The objectives of this study were to present an updated list of fish species, data on special status, new records, commercial importance, dominance, density, ecotic position, and the spatial and temporal distribution of species in the lagoon, together with a comparison of Tamiahua with 14 other Gulf of Mexico lagoons. Materials and methods. Fish were collected in August and December 1996 with a Renfro beam net and an otter trawl from different habitats throughout the lagoon. The species were identified, classified in relation to special status, new records, commercial importance, density, dominance, ecotic position, and spatial distribution patterns.
    [Show full text]
  • Differential Expression of Hydroxyurea Transporters in Normal and Polycythemia Vera Hematopoietic Stem and Progenitor Cell Subpopulations
    Zurich Open Repository and Archive University of Zurich Main Library Strickhofstrasse 39 CH-8057 Zurich www.zora.uzh.ch Year: 2021 Differential expression of hydroxyurea transporters in normal and polycythemia vera hematopoietic stem and progenitor cell subpopulations Tan, Ge ; Meier-Abt, Fabienne Abstract: Polycythemia vera (PV) is a myeloproliferative neoplasm marked by hyperproliferation of the myeloid lineages and the presence of an activating JAK2 mutation. Hydroxyurea (HU) is a standard treat- ment for high-risk patients with PV. Because disease-driving mechanisms are thought to arise in PV stem cells, effective treatments should target primarily the stem cell compartment. We tested for theantipro- liferative effect of patient treatment with HU in fluorescence-activated cell sorting-isolated hematopoietic stem/multipotent progenitor cells (HSC/MPPs) and more committed erythroid progenitors (common myeloid/megakaryocyte-erythrocyte progenitors [CMP/MEPs]) in PV using RNA-sequencing and gene set enrichment analysis. HU treatment led to significant downregulation of gene sets associated with cell proliferation in PV HSCs/MPPs, but not in PV CMP/MEPs. To explore the mechanism underlying this finding, we assessed for expression of solute carrier membrane transporters, which mediate trans- membrane movement of drugs such as HU into target cells. The active HU uptake transporter OCTN1 was upregulated in HSC/MPPs compared with CMP/MEPs of untreated patients with PV, and the HU diffusion facilitator urea transporter B (UTB) was downregulated in HSC/MPPs compared withCM- P/MEPs in all patient and control groups tested. These findings indicate a higher accumulation ofHU within PV HSC/MPPs compared with PV CMP/MEPs and provide an explanation for the differential effects of HU in HSC/MPPs and CMP/MEPs of patients with PV.
    [Show full text]
  • The Concise Guide to Pharmacology 2019/20
    Edinburgh Research Explorer THE CONCISE GUIDE TO PHARMACOLOGY 2019/20 Citation for published version: Cgtp Collaborators 2019, 'THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Transporters', British Journal of Pharmacology, vol. 176 Suppl 1, pp. S397-S493. https://doi.org/10.1111/bph.14753 Digital Object Identifier (DOI): 10.1111/bph.14753 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: British Journal of Pharmacology General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 28. Sep. 2021 S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2019/20: Transporters. British Journal of Pharmacology (2019) 176, S397–S493 THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Transporters Stephen PH Alexander1 , Eamonn Kelly2, Alistair Mathie3 ,JohnAPeters4 , Emma L Veale3 , Jane F Armstrong5 , Elena Faccenda5 ,SimonDHarding5 ,AdamJPawson5 , Joanna L
    [Show full text]
  • Modeling Shifts in Habitat Due to Sea Level Rise
    Estuaries and Coasts (2016) 39:781–797 DOI 10.1007/s12237-015-0025-5 Modeling Potential Shifts in Hawaiian Anchialine Pool Habitat and Introduced Fish Distribution due to Sea Level Rise Lisa Marrack1 Received: 8 March 2015 /Revised: 25 July 2015 /Accepted: 6 August 2015 /Published online: 21 August 2015 # Coastal and Estuarine Research Federation 2015 Abstract Global mean sea levels may rise between 0.75 and Keywords Groundwater inundation . Brackish ecosystems . 1.9 m by 2100 changing the distribution and community struc- LiDAR . Nonnative fishes . Sea level rise . Atyid shrimp ture of coastal ecosystems due to flooding, erosion, and salt- water intrusion. Although habitats will be inundated, ecosys- tems have the potential to shift inland, and endemic species Introduction may persist if conditions are favorable. Predictions of ecosys- tem migration due to sea level rise need to account for current Global mean sea level may rise between 0.75 and 1.9 m by stressors, which may reduce the resilience of these ecosys- 2100 (Vermeer and Rahmstorf 2009;Parrisetal.2012). tems. This study predicts the potential consequences of sea Coastal ecosystem distribution and community structure are level rise on the groundwater-fed anchialine pool ecosystem expected to change significantly due to flooding, erosion, salt- in Hawaii. Scenarios of marine and groundwater inundation waterintrusion,oracombinationofthesephenomena were compared with current patterns of habitat, introduced (Nicholls and Cazenave 2010;IPCC2013; Williams 2013). fishes, and land use. Results show that current habitats con- Coastal ecosystems may shift inland if open space is available taining endemic anchialine shrimp will be increasingly inun- and conditions are suitable (Woodroffe 1990; Kirwan and dated by marine waters.
    [Show full text]
  • Abrothrix Olivacea)
    Received: 13 June 2017 | Revised: 30 May 2018 | Accepted: 31 May 2018 DOI: 10.1111/mec.14778 ORIGINAL ARTICLE An association between differential expression and genetic divergence in the Patagonian olive mouse (Abrothrix olivacea) Facundo M. Giorello1,2 | Matias Feijoo1 | Guillermo D'Elía3 | Daniel E. Naya1 | Lourdes Valdez3 | Juan C. Opazo3 | Enrique P. Lessa1 1Departamento de Ecología y Evolución, Facultad de Ciencias, Universidad de la Abstract República, Montevideo, Uruguay Recent molecular studies have found striking differences between desert‐adapted 2Espacio de Biología Vegetal del Noreste, species and model mammals regarding water conservation. In particular, aquaporin Centro Universitario de Tacuarembó, Universidad de la República, Tacuarembó, 4, a classical gene involved in water regulation of model species, is absent or not Uruguay expressed in the kidneys of desert‐adapted species. To further understand the 3Instituto de Ciencias Ambientales y Evolutivas, Universidad Austral de Chile, molecular response to water availability, we studied the Patagonian olive mouse Valdivia, Chile Abrothrix olivacea, a species with an unusually broad ecological tolerance that exhi- Correspondence bits a great urine concentration capability. The species is able to occupy both the Facundo M. Giorello, Departamento de arid Patagonian steppe and the Valdivian and Magellanic forests. We sampled 95 Ecología y Evolución, Facultad de Ciencias, Universidad de la República, Iguá 4225, olive mouse specimens from four localities (two in the steppe and two in the for- Montevideo 11400, Uruguay. ests) and analysed both phenotypic variables and transcriptomic data to investigate Email: [email protected] the response of this species to the contrasting environmental conditions. The rela- Funding information tive size of the kidney and the ratio of urine to plasma concentrations were, as Fondo Nacional de Desarrollo Científico y Tecnológico, Grant/Award Number: expected, negatively correlated with annual rainfall.
    [Show full text]
  • Structure and Permeation Mechanism of a Mammalian Urea Transporter
    Structure and permeation mechanism of a mammalian urea transporter Elena J. Levina,1, Yu Caoa,1, Giray Enkavib, Matthias Quickc, Yaping Pana, Emad Tajkhorshidb,2, and Ming Zhoua,2 aDepartment of Physiology and Cellular Biophysics, College of Physicians and Surgeons, Columbia University, 630 West 168th Street, New York, NY 10032; bCenter for Biophysics and Computational Biology, Department of Biochemistry, College of Medicine, and Beckman Institute for Advanced Science and Technology, University of Illinois at Urbana-Champaign, Urbana, IL 61801; and cDepartment of Psychiatry and Center for Molecular Recognition, Columbia University, 650 West 168th Street, New York, NY 10032 Edited by Christopher Miller, HHMI, Brandeis University, Waltham, MA, and approved June 1, 2012 (received for review May 3, 2012) As an adaptation to infrequent access to water, terrestrial mam- homolog (21), dvUT, which forms a trimer with a continuous mals produce urine that is hyperosmotic to plasma. To prevent membrane-spanning pore at the center of each protomer. How- osmotic diuresis by the large quantity of urea generated by protein ever, it remained unclear how similar this structure was to that catabolism, the kidney epithelia contain facilitative urea transpor- of the mammalian UTs, and the details of the permeation me- ters (UTs) that allow rapid equilibration between the urinary space chanism were unknown. To answer these questions, we solved and the hyperosmotic interstitium. Here we report the first X-ray the structure of a mammalian UT-B and investigated the permea- crystal structure of a mammalian UT, UT-B, at a resolution of 2.36 Å. tion mechanism with molecular dynamics simulations and func- UT-B is a homotrimer and each protomer contains a urea con- tional studies of UT-B mutants.
    [Show full text]
  • Tricarboxylic Acid Cycle Intermediates As Myometabokines
    H OH metabolites OH Review Signals from the Circle: Tricarboxylic Acid Cycle Intermediates as Myometabokines Jennifer Maurer 1 , Miriam Hoene 1 and Cora Weigert 1,2,3,* 1 Department for Diagnostic Laboratory Medicine, Institute for Clinical Chemistry and Pathobiochemistry, University Hospital Tuebingen, 72076 Tuebingen, Germany; [email protected] (J.M.); [email protected] (M.H.) 2 Institute for Diabetes Research and Metabolic Diseases, Helmholtz Center Munich, University of Tuebingen, 72076 Tuebingen, Germany 3 German Center for Diabetes Research (DZD), 85764 Oberschleissheim, Germany * Correspondence: [email protected]; Tel.: +49-7071-29-85670 Abstract: Regular physical activity is an effective strategy to prevent and ameliorate aging-associated diseases. In particular, training increases muscle performance and improves whole-body metabolism. Since exercise affects the whole organism, it has countless health benefits. The systemic effects of exercise can, in part, be explained by communication between the contracting skeletal muscle and other organs and cell types. While small proteins and peptides known as myokines are the most prominent candidates to mediate this tissue cross-talk, recent investigations have paid increasing attention to metabolites. The purpose of this review is to highlight the potential role of tricarboxylic acid (TCA) metabolites as humoral mediators of exercise adaptation processes. We focus on TCA metabolites that are released from human skeletal muscle in response to exercise and provide an overview of their potential auto-, para- or endocrine health-promoting effects. Keywords: TCA cycle; exercise; myometabokine; exercise adaptation; liver; arterio-venous difference; Citation: Maurer, J.; Hoene, M.; Weigert, C. Signals from the Circle: succinate; citrate Tricarboxylic Acid Cycle Intermediates as Myometabokines.
    [Show full text]
  • H00008170-Q01 規格 : [ 10 Ug ] [ 25 Ug ] List All
    SLC14A2 (Human) Recombinant Protein (Q01) Catalog # : H00008170-Q01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human SLC14A2 partial ORF ( NP_009094, 40 a.a. - 128 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCI protein) CLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ Antibody Production Host: Wheat Germ (in vitro) Protein Array Theoretical MW 35.53 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Applications Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array Page 1 of 2 2016/5/22 Gene Information Entrez GeneID: 8170 GeneBank NM_007163 Accession#: Protein NP_009094 Accession#: Gene Name: SLC14A2 Gene Alias: FLJ16167,HUT2,MGC119566,MGC119567,UT-A2,UT2,UTA,UTR,hUT- A6 Gene solute carrier family 14 (urea transporter), member 2 Description: Omim ID: 601611 Gene Ontology: Hyperlink Gene Summary: In mammalian cells, urea is the chief end-product of nitrogen catabolism and plays an important role in the urinary concentration
    [Show full text]
  • Computational Dissection of Human Episodic Memory Reveals Mental
    Computational dissection of human episodic memory PNAS PLUS reveals mental process-specific genetic profiles Gediminas Luksysa,1, Matthias Fastenratha, David Coynela, Virginie Freytagb, Leo Gschwindb, Angela Heckb, Frank Jessenc,d, Wolfgang Maierd,e, Annette Milnikb,f, Steffi G. Riedel-Hellerg, Martin Schererh, Klara Spaleka, Christian Voglerb,f, Michael Wagnerd,e, Steffen Wolfsgruberd,e, Andreas Papassotiropoulosb,f,i,j,1,2, and Dominique J.-F. de Quervaina,f,j,1,2 aDivision of Cognitive Neuroscience, Department of Psychology, University of Basel, CH-4055, Basel, Switzerland; bDivision of Molecular Neuroscience, Department of Psychology, University of Basel, CH-4055, Basel, Switzerland; cDepartment of Psychiatry, University of Cologne, D-50937, Cologne, Germany; dGerman Center for Neurodegenerative Diseases, D-53175, Bonn, Germany; eDepartment of Psychiatry, University of Bonn, D-53105, Bonn, Germany; fUniversity Psychiatric Clinics, University of Basel, CH-4012, Basel, Switzerland; gInstitute of Social Medicine, Occupational Health and Public Health, University of Leipzig, D-04103, Leipzig, Germany; hCenter for Psychosocial Medicine, Department of Primary Medical Care, University Medical Center Hamburg-Eppendorf, D-20246, Hamburg, Germany; iLife Sciences Training Facility, Biozentrum, University of Basel, CH-4056, Basel, Switzerland; and jTransfaculty Research Platform, University of Basel, CH-4055, Basel, Switzerland Edited by James L. McGaugh, University of California Irvine, CA, and approved July 9, 2015 (received for review January 18, 2015) Episodic memory performance is the result of distinct mental the model-based analysis approach has largely been missing from processes, such as learning, memory maintenance, and emotional studies of human episodic memory and genome-wide association modulation of memory strength. Such processes can be effectively studies (GWAS).
    [Show full text]
  • Human Intestinal Nutrient Transporters
    Gastrointestinal Functions, edited by Edgard E. Delvin and Michael J. Lentze. Nestle Nutrition Workshop Series. Pediatric Program. Vol. 46. Nestec Ltd.. Vevey/Lippincott Williams & Wilkins, Philadelphia © 2001. Human Intestinal Nutrient Transporters Ernest M. Wright Department of Physiology, UCLA School of Medicine, Los Angeles, California, USA Over the past decade, advances in molecular biology have revolutionized studies on intestinal nutrient absorption in humans. Before the advent of molecular biology, the study of nutrient absorption was largely limited to in vivo and in vitro animal model systems. This did result in the classification of the different transport systems involved, and in the development of models for nutrient transport across enterocytes (1). Nutrients are either absorbed passively or actively. Passive transport across the epithelium occurs down the nutrient's concentration gradient by simple or facilitated diffusion. The efficiency of simple diffusion depends on the lipid solubility of the nutrient in the plasma membranes—the higher the molecule's partition coefficient, the higher the rate of diffusion. Facilitated diffusion depends on the presence of simple carriers (uniporters) in the plasma membranes, and the kinetic properties of these uniporters. The rate of facilitated diffusion depends on the density, turnover number, and affinity of the uniporters in the brush border and basolateral membranes. The ' 'active'' transport of nutrients simply means that energy is provided to transport molecules across the gut against their concentration gradient. It is now well recog- nized that active nutrient transport is brought about by Na+ or H+ cotransporters (symporters) that harness the energy stored in ion gradients to drive the uphill trans- port of a solute.
    [Show full text]