Heidelberg Business Media Gmbh Häusserstr

D 51178; ISSN: 1438-9452 10.09.12

CHINA

Regional report No. 2012 09 IN THEAMERICAS,ASIA,EUROPEANDALLAROUNDPLANET MAGAZINE FORBOTTLERSANDBOTTLE-MAKERS

- Part 2

Page

MARKET

Suppliers of 2-stage stretch blow moulding machinery

survey

Page

is read in more than than more in read is

150

PETplanet countries

www.petpla.net speedrunner www.speed-runner.ch imprint

PUBLISHER Alexander Büchler, Managing Director EDITORIAL

HEAD OFFICE EDITORIAL heidelberg business media GmbH Häusserstr. 36 69115 Heidelberg, Germany dear readers,, phone: +49(0)6221-65108-0

fax: +49(0)6221-65108-28 AsAs youyo u do do thetthhee weekly weeklyekeklyklly shop, shopshoshoop, do do you ever eveeveer fi ndn your gaze straying to [email protected] thethEDITORIAL PETP bottles b ttl on the th shelf? h lf? The Th cap, theth label, l b the size of the bottle andand formform ofof presentation all seemse to induce a kind of fascination in me. The spell is even more pronounced pronouprono as you stroll around the aisles of EDITORIAL Doris Fischer: fi [email protected] a foreign supermarket, admiring the exotic PET display. And after you Michael Maruschke return, what impressions will you have brought back? If your holiday Ruari McCallion involved a plane journey, you may well have spent some time eyeing Ilona Trotter up the PET bottles in the aircraft, perhaps refl ecting on the manufactur- Wolfgang von Schroeter ing processes that ended with the bottles at 30,000 feet above ground. Anthony Withers But have you ever asked yourself what happens to the bottles at the end of the fl ight? When you touch down, there will still be bever- MEDIA CONSULTANTS Ute Andrä ages containers in the trolleys, some of which will still be closed, others [email protected] already opened and the rest empty. These need to be disposed of. It Martina Hischmann used to be only the sealed casks that were removed whilst the other [email protected] containers had to be disposed of as expensive wet waste. phone: +49(0)6221-65108-0 LSG Sky Chefs, the catering arm of Lufthansa, has now addressed fax: +49(0)6221-65108-28 the problem. In association with a granulator manufacturer from Gland- orf, they have developed a system that collects up the bottles and France, Italy, Spain, UK punches holes in them before compressing them slightly. Doing this Elisabeth Maria Köpke phone: +49(0)6201-878925 fax: +49(0)6201-878926 [email protected]

LAYOUT AND PREPRESS Exprim Kommunikationsdesign Matthias Gaumann | www.exprim.de

READER SERVICES Kay Krüger [email protected]

PRINT Chroma Druck & Verlag GmbH Right: the trolleys, in the middle the granulator; left the conveyor belt for Werkstr. 25 the unopened faulty products- Emptying residual quantities at LSG Sky 67454 Römerberg Chefs (photo Strautmann) Germany means that the beverages packaging can be sent for recycling, thus avoiding expensive wet waste disposal. LSG service up to 350 fl ights, WWW seven days a week. Not only that but the company packs 20,000l of www.hbmedia.net | www.petpla.net beverages into 1,600 trolleys every day. In order to accommodate the returns, the granulator runs a 2-shift operation. This leaves 500kg of emptied containers and huge quantities of aromatized and sweetened liquids. PETplanet insider ISSN 1438-9459 is published 10 times a year. This publication is sent to quali fi ed subscribers (1-year subscription 149 EUR, 2-year However, as our magazine is principally addressed to producers subscription 289 EUR, Young professionals’ sub- we have in this issue also looked at beverage ingedients. The world of scription 99 EUR. Magazines will be dispatched to aromas and sugars and their processing in syrup and mixed rooms is you by airmail). Not to be reproduced in any form now a regular part of PETplanet Insider. without permission from the publisher. Note: The fact that product names may not be Yours identifi ed as trade marks is not an indication that such names are not registered trademarks. Alexander Büchler

PETplanet insider Vol. 13 No. 09/12 www.petpla.net 3 PETcontents 09/12

INSIDE TRACK

3 Editorial 4 Contents 6 News 42 Products 44 Bottles: Beverages 46 Bottles: Page Home and personal 20 care products 48 Patents

REGIONAL MARKET REPORT 10 China - Part 2

BOTTLE MAKING 22 Stack, rack and roll Sidel and Siapi launch multi-layer Page stacking systems for PET bottles 44 24 Multi-component bottles Coloured PET bottles on standard SBM machines

MARKET SURVEY

23 Suppliers of two-stage SBM machinery

BOTTLING / FILLING 31 Water from the foothills SMI line for still and sparkling water

Page 31

EDITOUR REPORTS 32 Bulgaria’s bounty from a single source

BEVERAGE INGREDIENTS 38 The taste of nature New ways to beverage Page concepts at drinktec 2013 40

CAPPING / CLOSURES 40 Barriers under control Co-injection keeps oxygen at bay BUYER’S GUIDE 49 Get listed!

4 PETplanet insider Vol. 13 No. 09/12 www.petpla.net DOES SIZE MATTER?

Smallest and largest preforms are moulded in top form by our moulds. www.otto-hofstetter.com/pet Krones signs up to PETnews UN Global Compact Krones AG signed up to the United Nations (UN) Global Compact in May 2012, which it says is in line Elasto Müller Kunststoffe with its view of its social responsibilities as fundamental and EPS come together elements of its corporate culture. UN Global Compact signatory companies are obliged to comply with the global After several years of co-operation between Müller guidelines covering human rights, labour standards, envi- Kunststoffe and EPS, the two companies have agreed a deal ronmental protection and combatting corruption. that brings them together in a new Caps and Closures division within Elasto Müller Kunststoffe. EPS specialises in the www. krones.com development of compounds for caps and closures. Raymond Exon, CEO at EPS, will remain as Caps and Closures Product Manager for Elasto Müller Kunststoffe. Elasto parent company Hexpol AB announced the acquisition of Horst Müller Kunst- stoffe in December 2011. www.elastotpe.com Agr offering Six Sigma

Agr International has announced that its process con- UK’s Lotte Chemical sulting services for PET blowmoulding operations utilise a Six Sigma-based process evaluation. The Six Sigma orders Uhde MTR plant methodology is a well-established process improvement toolbox widely used in manufacturing and product design, KP Chemical Corporation of Korea subsidiary Lotte as well as complicated technical process management. Chemical UK Ltd., a producer of PTA and PET, has commis- Six Sigma is based on fi ve steps; defi ne, measure, ana- sioned a new plant from Uhde Inventa-Fischer for its produc- lyse, improve and control, which are backed by a broad tion facility near Middlesbrough, NE England. The plant will array of proven statistical tools. This is augmented by the have a production capacity of 200,000t/a, using the compa- use of Agr’s measurement tools specifi cally designed for ny’s patented Melt-To-Resin (MTR) technology. Resin made the PET bottle industry. Agr uses the Six Sigma pro- from this process is used, among other applications, as cess to conduct a practical analysis of the blowmoulding feedstock for the production of water and CSD bottles. Lotte process in a given manufacturing facility. The analysis Chemical UK Ltd produces pure terephthalic acid (PTA), at includes the identifi cation of the KPIs that should be the site and will supply it directly to the new plant via pipe- measured and controlled to optimise the process. Agr’s line. Uhde Inventa-Fischer will provide basic and detail engi- consulting personnel work directly with process engineers neering, supply of all plant components and supervision of and plant fl oor personnel to solve problems such as man- the construction and commissioning activities, and will also aging light weight applications and quality issues, as well train operating personnel. ThyssenKrupp Uhde and Uhde as a range of process improvement efforts that lead to India will provide the civil and steel structure engineering. improved pack rate. www.agrintl.com www.uhde-inventa-fi scher.com PTi sells sheet extrusion system to Aserpet IVL closes Indonesian PET deal Sheet extrusion machinery manufacturer Processing Technologies International (PTi) has announced the sale Indorama Ventures Public Company Limited (IVL) has of a new sheet extrusion system to Aserpet, of Gazi- completed the acquisition of the PET assets of PT Polypet antep, Turkey. The recently completed sale is PTi’s fi rst in Karyapersada in Indonesia. The deal, which the company Turkey. Aserpet, a recycler of PET fl ake for the packaging fi rst announced in March 2012, provides IVL 100,800t of industry, purchased its fi rst sheet extrusion line to help PET capacity adjacent to the PTA assets of PT Indorama support the company’s entrance into the packaging indus- Petrochemicals (formerly known as PT Polyprima Karyes- tries. The PTi coextrusion system, which runs 750 kg/hr of reska) at Cilegon, West Java, which IVL acquired under PET, also includes a roll stand, winder, and stacker. The a joint venture in 2011. Mr. Aloke Lohia, Group CEO of machine has been installed and is now operating at the Indorama Ventures, said, “Indorama Ventures has pursued customer’s facility. PTi sold the machine through its agent an integration strategy of our PET and PTA businesses in Kerem Anil with Plast-teknik in Istanbul. The company is Thailand, Italy (under a joint venture) and The Netherlands exploring other business opportunities in Turkey, targeting and earlier announced upstream integration into MEG PET, PP, PS, and barrier sheet extrusion systems for the (Monoethylene Glycol) in North America. The acquisition of packaging industry. PT Polypet Karyapersada creates synergies due to it being www.ptiextruders.com co-sited with our PTA plant PT Indorama Petrochemicals in Indonesia, making it a strategic investment in the most populous country in ASEAN.” www.indorama.net

6 PETplanet insider Vol. 13 No. 09/12 www.petpla.net handling waste and recycling, as well as implementation of use and implement improved management systems for follow, in order to achieve reduction of resource and energy principles and procedures which participating companies will neering a better world’. The industry has agreed on common the German Engineering Federation, under the slogan ‘Engi- mechanical engineering industry and is operated by VDMA, petence Initiative started in Germany. It covers the entire at improving environmental responsibility. The Blue Com- European commitment by engineering companies aimed supports the VDMA Blue Competence Initiative, a growing for the third year running. PET bales to the Far East fell, over 100kt. Net exports of ping market increased to just remained at 39%. The strap- as an end use for rPET fl tions. The 2011 share of for new packaging applica- to make containers or sheet produced in 2011 was used More than 50% of the rPET Packaging Waste Directive. plastic recovery set by the the 22.5% target rate for have a collection rate above surveyed and all but three about a third of the countries 70% are being recorded by 2%. Collection rates of over across the EU27 is stable at tonnes. Growth in collection mated at around 1.9 million EU27+4 countries is esti- reclamation capacity in the the market. Total mechanical of 51% of all PET bottles in (9.4%) over 2010 and a record in 2011, an increase of 140kt reached 1.59 million tonnes post-sorting PET collection announced that European KHS supportsBlueCompetenceinitiative rates up PET collection PETplanet insider Vol. 13No.09/12 www.petpla.net KHS GmbH has formally and publicly announced that it Petcore and EuPR have www.plasticsrecyclers.eu www.petcore.org ake fi bres > stretch-blow mouldingand ficasepackers >conveyor llingmachines >shrinkwrapperswrap-around systems >palletiser bination. increased recyclability, improved material usage, or a com- Kegs. All are claimed to offer reduced energy consumption, Series IV stretch blow molding machines; and Petainer Innopack Kisters packaging machines; InnoPET Blomax were its new Inno that KHS highlighted in connection with Blue Competence who join the initiative must meet”. Among the developments resilient sustainability criteria and standards that all those sation says that “…Blue Competence de sustainability principles in its own production. The organi- fi ll Glass DRS-ZMS pressure fi nes credible and

www.khs.com fi lling system; lling s 7 NEWS 8 NEWS and will be used in the production of preforms. is supplied to the beverage bottling industry in the region currently being installed in Tashkent. The rPET produced PET bottle-to-bottle recycling line in Uzbekistan which is able secondary resource. Starlinger has sold their that lies in reprocessing and reusing plastic waste as valu- are also beginning to recognise the economic potential 18 months. Central Asian companies and governments seven new customers have been acquired within the past for growth in this region – comparable to Russia, where packaging industry. Starlinger sees a strong potential recent years has also had a positive effect on the textile problems. Strong economic growth in Central Asia in customer care and troubleshooting in case of machine tion, a locally based technician is available for immediate stan, Turkmenistan, Tajikistan and Kyrgyzstan. In addi- chief representative for the region of Uzbekistan, Kazakh- Yuldosh Kazakov, who joined Starlinger in 2009 and is the tive offi duction and plastics recycling, has opened a representa- ufacturer of machinery for woven plastic packaging pro- degree to which the innovation solves a customer need. the marketplace, inventiveness, ten judges against several criteria, including impact on were launched in 2005 and are evaluated by a panel of International Packaging News for China. The awards tion Awards are presented by Ringier Trade Media Ltd.’s tradeshow in Shanghai. The Ringier Technology Innova- tives in a special ceremony during the ProPak China 2012 in China. The award was presented to Husky representa- ing system and its contributions to the packaging industry HyPET HPP (High Performance Package) injection mould- with the Ringier 2012 Technology Innovation Award for its representative of Starlinger hasopened TechnologyInnovation Award Husky’s HyPETwinsRingier2012 and NPE 2009. chaired the Sales & Marketing Committee for NPE 2012 ment Council of the Society of the Plastics Industry and now part of Milacron, Inc. Doyle also serves on the Equip- Group (now Sumitomo Demag) and Autojectors, which is six years and previously worked with Demag Plastics parent company, IPEG. Doyle has been with Conair for Chris Keller, who is also President and CEO of Conair’s The announcement was made by previous incumbent keting, has been promoted to President of the company. that Larry Doyle, Vice President of Global Sales & Mar- New presidentforConair As of May 2012 Starlinger & Co. GmbH, Austrian man- Husky Injection Molding Systems has been recognised Auxiliary equipment supplier Conair has announced ce in Tashkent, Uzbekistan. The of PETplanet insider Vol. 13No.09/12 www.petpla.net fi ce inUzbekistan fi nancial results and the www.conairgroup.com www.starlinger.com fi ce isheadedby www.husky.ca fi rst are set to signi year. According to Krones, earnings in the second half of 2012 increase in consolidated earnings compared to the previous ceding year’s its turnover will rise by up to 4% in 2012 compared to the pre- uncertain macro-economic prospects, Krones anticipates that consolidated turnover comes from emerging markets. share fell from €1.62 to €1.47. About 60% of the company’s equivalent period. Earnings per than in the preceding year’s months of 2012 Krones earned €44.2 million, 10.2% less half (preceding year: 5.5 %). After taxes, during the lion. The EBT margin came to 5.0% during the year’s high level, decreasing by 7.5% from €69.2 to €64.0 mil- (EBT) were after six months down on the preceding year’s lion (preceding year: €974.6 million). Earnings before taxes Orders on hand effective 30 June, 2012 totalled €980.4 mil- worth €1,327.8 million, up by 0.3% on the preceding year. just under 62% of its consolidated sales outside Europe. 2012 as a whole (preceding year: 3.0%). 2012 as a whole (preceding year: 3.0%). July - December. The EBT margin should exceed 5% over 8 MW by next year and 20 MW in the next Vimal Kedia said, “We plan to increase the capacity to about the wind power project, Managing Director, Mr. in the country for wind based power projects. Speaking project. Karnataka holds the third favourable position responsible for the construction and maintenance of the lion) in this project. Wind energy company Gamesa is The company has invested Rs. 20 crore (US$ 3.58 mil- and is Manjushree’s Belgaum, Karnataka. The 3 MW plant is fully operational nopack has set up a wind power plant, in Chikkodi town, basis. In all, during the turnover outside Europe rose by 8.6% on a like-for-like half. Whereas sales in Europe fell slightly, the company’s second growth is predicted to accelerate during the year’s equivalent months of 2012 were up by 2.6% on the preceding year’s improving its consolidated earnings. Sales in the will be operational by October 2012. Bangalore. The facility at Bidadi is under construction and fi ments of Rs.150 crores (US$ 26.9) for two new green- 55.6million). The company has also committed invest- 2011-2012, closing with a turnover of Rs. 310 crore (US$ the Rs. 300 crore (US$ 53.8 million) mark in the year tive consumption. Manjushree Technopack Ltd crossed Currently the power generated is being used for cap- 3 MW windpowerplantinKarnataka Manjushree Technopack setsup confi Krones unveilshalf-yearfi PETplanet insider Vol. 13No.09/12 www.petpla.net eld facilities, at Bidadi and Harohalli industrial areas, in On the basis of trends in the company’s markets and the From January to June 2012, Krones received orders Bangalore based packaging major Manjushree Tech- With the rms targetsfor2012 fi gure, from €1,257.5 to €1,289.7 million. Sales fi gures for the fi fi gure. Krones is aiming in 2012 for a substantial fi cantly exceed the preceding year’s fi rst investment in a power project. fi rst half of 2012, Krones achieved rst half of 2012, Krones is www.manjushreeindia.com gures and fi www.krones.com ve years.” ve fi fi gure for for gure rst six rst fi rst six rst fi rst

9 NEWS 10 REGIONAL MARKET REPORTS Packaging Unit General Manager Liu Tie Feng, Zi Jiang Enterprise Group Container continuously.” You needtore-inventyourbusiness “No businessmodelissustainableforever. Zi JiangEnterpriseGroup dedicated to the interviews with Zi Jiang, Sidel and Husky. The second part of our Regional Market Report on China is China by WolfgangvonSchroeter Liu of Zi Jiang, who – although outwardly con responsible. be a source of elation and satisfaction for the people each case of the order of double digit growth, must surely and PET bottles and the resultant explosion in sales, in years. The annual growth in the number of PET preforms times in terms of its development over the last several of PET packages in China and can look back on turbulent our visit in March 2012: of Sidel Together with Marilyn Chua, Communications Director Packaging Unit Technical Centre Manager Sun Bin , Zijiang Enterprise Group Container Packaging Unit Technical Director Wang ZhenHui, Zi Jiang Enterprise Group Container tainer Packaging Unit General Manager (Arthur) Liu Tie Feng, Zi Jiang Enterprise Group Con- We met: converters in the big markets. This has been caused by does not shy away from the problem that is worrying all delighted about what has been achieved – nevertheless Not necessarily, in the view of General Manager Arthur Zijiang Enterprise is one of the largest manufacturers Visit to Zi Jiang and discussions represent the status of PETplanet insider Vol. 13No.09/12 www.petpla.net

Regional market reports market Regional

China ﬁ dent and dent

Part 2 our own operations. improve product safety whilst continually raising the bar for cessfully helped customers to reduce their logistics cost, tion models with our customers. Over the years, we suc- this time, we established one of the earliest ‘inline’ produc- strategy was key to gaining more market share. During plying good quality products with a competitive pricing chain was conventionally a buyer-seller relationship. Sup- our strategy. have to continually adapt our business model and adjust them in three phases. In order to remain competitive, we beverage industry in the last few years, we can summarise transformation? value and bringing customised services to our customers. production-based model to one where we focus on creating phases. Our target is to transform the business from a have a strategic phased plan that we follow – in several in packaging solutions, we have to adapt and change. We huge volume but low margins. As a company specialised migration of your core business? We put some questions to Arthur Liu: market. plaining is due to the phenomenal growth in the beverages converters. The fact that these converters are still not com- hands of the brand owners and only 30% are still with the own customers. losing a piece of their preform supply business – to their business of supplying the bottles, are now also potentially in-house as well. taking responsibility for the injection moulding of preforms PET bottles into their production lines and, now, to start the trend for brand owners to incorporate blowmoulding PETplanet insider Vol. 13No.09/12 www.petpla.net Arthur Liu: PETplanet: Phase 1 (before 2005) Arthur Liu: PETplanet: Could you explain what you mean by this Arthur Liu: PETplanet: How are you coming to terms with the An estimated 70% of mould cavities are today in the As a consequence, the converters, having Before 2005, the beverage industry value Looking back at the development of the The Chinese beverage market is driven by ﬁ rst lost the business model. and the pressure to reduce cost, we need to re-invent our sell is out). With the growing competitiveness of the market Beverages, and bought their brought about increased demands on cost optimisation. aggressively expanding their China operations and this national players such as Coca-Cola and Pepsico were market was growing at more than 25% annually. Inter- F.l..: Wolfgang von Schroeter, Liu Tie Feng and Wang ZhenHui Husky machinery at the Zi Jiang plant But no business model is sustainable forever (buy and By end 2005, Coca-Cola BIG acquired bottler Kerry Arthur Liu: PETplanet: Phase 2 (2005 to 2010) From 2005 to 2010, the Chinese beverage ﬁ rst blow moulding machine

11 REGIONAL MARKET REPORTS 12 REGIONAL MARKET REPORTS Phase 3. market. I would categorise the period after 2010 as the warmed to it and the Combi soon became a trend in the players such as Coca-Cola, Ting Hsin, Wahaha quickly (blower- equipment suppliers. When Sidel introduced the Combi market provides a unique development opportunity for beverage industry value chain will evolve? for Cofco, CCCIL and other customers. the last fi two JV-like partnerships which have been in operation for using this JV-like formula. for our outstanding efforts in creating value for Coca-Cola the partners. their investments. The commercial risk is jointly borne by (open book) and split between the partners according to on investment. The costs incurred are separately recorded - and receive an agreed ment for injection moulding and blow moulding in-house a separate investment – Zi Jiang, for example, in equip- basis of the JV-like formula is that both partners each make a deal was made with Swire under this arrangement. The equity investment. ance has its limitations due to the nature of the long term cost optimisation, etc. However, this form of strategic alli- establish common interests such as return on investment, relationship between the stakeholders where both parties ness model is about? ciencies and achieve greater resource optimisation. suppliers and downstream suppliers to increase line ef and JV-like business models, partnering with equipment relationship, Zi Jiang established both joint-venture (JV) its competitors but also its customers. industry. Zi Jiang not only has to be competitive amongst adopted the business model of in-house manufacturing. Wahaha, Ting Hsin were also charting their growth and integrating their production operations. At the same time, and injection moulding machines, as part of their efforts in   moulding and one injection moulding system. Hanghou plant: 300 million bpa; in-house: two blow moulding machines and two injection moulding systems Zheng Zhou plant: 200 million bpa; in-house: two blow Arthur Liu: The rapid growth of China’s beverage PETplanet: Five years from now, how do you think the Zi Jiang is now working on adopting the same approach Zi Jiang and Swire (Coca-Cola holding) currently have In 2010, Zijiang was awarded ‘Coca-Cola best supplier’ Zijiang then developed a JV-like business model and Arthur Liu: PETplanet: Please explain what the joint-venture busi- Leveraging on industry know-how and strong customer This changed the dynamics of the beverage packaging fi ve years: ve ller-capper) to the Chinese market in 2008, major PETplanet insider Vol. 13No.09/12 www.petpla.net A JV business model builds on the strong fi xed amount by way of a return fi - Sidel packaging team. in cooperation with the local ogy was developed jointly and of soya sauce. The technol- ages, i.e. 12,000bph for 1.9l order for non-beverage pack- was recently achieved with an returns. customers generate higher tions, developing key competences, etc, in order to help our customer through technological development, innova- sation are high. volumes and multi-product line, the demands on customi- volume productionsforasingleproduct.However, forlower evolved during this phase. were trying to come to terms with the way the market had consumption while staying competitive. Quite frankly, we ers were able to increase ef Zi Jiang’s prime targets. cations, new commodities are ment in twelve Pepsi plants. placed their in-house equip- plants in China, Zi Jiang has Nestlé, C’est Bon, etc. Cola, Uni-President, Danone, brands such as Pepsi, Coca try, Zi Jiang supplies to major beverage packaging indus- Target for 2012 Clientele In 2011 Products ofZiJiang PETplanet insider Vol. 13No.09/12 www.petpla.net      bn preforms Total output: more than 7.3 strategy - – irrespective of trends and forms 1.5 bn are supplied as pre- blown into bottles and preforms, of which 5 bn are Total output over 6.5 bn verted 200,000t of PET resin con- That is why at Zi Jiang, we focus on creating value for We believe that the Combi works well for running high Leveraging on new technologies, beverage produc- A signi New customers, new appli- Out of Pepsi’s 24 bottling As a key supplier to the fi cant breakthrough cant fi ciencies, reduce energy www.krones.com krones fruit chunks as if they’re if as chunks fruit hand-picked. South Hall,Booth2466 Chicago, 28th–31st October PACK EXPO 2012

FlexiFruit –doses FlexiFruit is centralised in Zijiang’s Shanghai plant, Arthur Liu says: proximity and reduce logistics costs, all preform production cally spread across China. In order to drive customer Production ofZiJiang Equipment installedinallplants   biggest for 52.000bph. Sidel blow moulding machines: more than 70 units; the cavities. tems; most of them 96 cavities; latest models with 144 Husky injection moulding systems: more than 70 sys- Zi Jiang produces in more than 30 factories geographi-

13 REGIONAL MARKET REPORTS 14 REGIONAL MARKET REPORTS abroad, from far-away Canada and no less distant France. abroad, from far-away Canada and no less distant France. represented a technological challenge – with deliveries from markets – in the early days, when PET almost exclusively 2004. Both companies have made their mark on China’s PET Competence. Husky has been here since 1997, Sidel since is just a few hundred metres away from Husky’s Center of place on the site in Beijing. moulds. Production and assembly of Sidel products takes Sidel runs part of its Chinese business and produces its Greater China Zone Marylin Chua, Marketing & Communications Director Sidel Sidel China eye on developments at Zi Jiang in the years to come. Today our prime aim is to nurture talent and invest in R&D.” partner – local or international - into a new dimension. add value to the business and how to grow jointly with your also give lectures which Europeans should heed – how to grown and matured in the last twenty years. China can ered. They need to recognise that the Chinese market has should not just consider a market in terms of product deliv- turnover rate we need to take several measures: 60 and 78%. of annual capacity for blow moulding machines is between at present is 85% for injection moulding and the utilisation on-site management, utilisation and productivity customer’s tion moulding and 95% for blow moulding. However, due to the list of priorities and is my personal ambition.” “Assuring the ef  reduce inventory.” implement just-in-time production adopt a new,planning module replace older machines to increase productivity, The Shanghai of The Shanghai free trade zone is the location from which We at PETplanet Insider will certainly be keeping a close 20 years ago the emphasis was on selling production. And returning to his favourite subject: “Europeans Arthur Liu further claims: “In order to improve asset The company is targeting ef fi ciency of plant and equipment is high on fi ce located within the free trade zone fi ciency of 97% for injec- likely to be a surprise for many Europeans. place – in the direction of Europe – something that is transfer of know-how in the opposite direction is taking industrial traditions and pioneering achievements. A concerned. operational processes and the internal value chain are ers, their capacity for learning and their input as far as is mentioned – in particular that of the Chinese manag- commitment of the Chinese workforce in the factories the same service as in Europe”. to product quality”. nology. That is not possible with yesterday’s machines”. and expansion of global production”. national sales is now being followed by the development second phase of globalisation. The expansion of inter- regards local Chinese production: ourselves hearing the same or similar statements as tainability of the Chinese market. readiness to invest in China, with confidence in the sus- – as we will see – but once again common to both is the tion methods and in terms of manufacturing penetration with the original from abroad. trade-off in terms of performance and quality compared with original designs and without accepting the slightest markets in China – with no compromises, in accordance PET machines for China and the adjacent Asian Pacific – have in common: Both companies manufacture their something else that both companies - Husky and Sidel with Sidel). ing up its order book and is certainly on an equal footing presents the strongest challenge; it is currently build- lines for blow moulding / filling of PET bottles, Krones plants comeundertheSidelbrand.(Asregardsblock the name of Husky, the majority of PET blow moulding The majority of PET preform systems in the country bear in maintaining their extraordinary position in the market. mance, on-site service and marketing. in the battle for customers, namely commercial perfor- ment is still important, but elements have been added its act together. The technical performance of the equip- The Chinese – or so it seems – are unaffected by And, again and again, the high concentration and the “Customers in Asia expect excellent deliveries and Or: “We are not prepared to compromise when it comes Or: “China’s industries insist on the most modern tech- Or: “China’s manufacturing industry is currently in the Over and over again on our factory tours, we found There may well be differences as regards produc- Apart from their strong market position, there is Nevertheless, both companies are clearly succeeding Those times have long gone. The competition has got PETplanet insider Vol. 13No.09/12 www.petpla.net tics of Chinese products. based on the characteris- ment of the local bottle starts with the develop- mould manufacturing Hongkong and on Taiwan. company’s presence in workers. 400 blue- and white-collar multi-product plant with workers. blue- and white-collar hai mouldshop with 120 last visit in 2006. than doubled since our staffi tion activities in Beijing, block combi lines. and running jointly in and Approx. 200 Sidel blowers combination machines. moving in the direction of and bottling activities is as regards to blowing that the market trend and end-of-line, etc. ers, labellers, conveyors moulding machines, 03/2012), including blow in China (Sidel count 2,000 machines installed ful story with more than a long and success- Shanghai Manufacturing in Organisation equipment inChina Population ofSidel Marilyn Chua, Communications Director Laurent Bousselet, Product Supply Manager We met at Sidel in Beijing: Lenny Xuan, Design & Development Manager Marilyn Chua,Communications Director We met at Sidel Shanghai: and fullytrainedpersonnel.” speed tothemarket,localisationofproduct “Proximity tocustomers,reducedleadtimes, PETplanet insider Vol. 13 Here in Shanghai Added to this is the In Beijing: Beijing In Shanghai: Shang- As a result of produc- It is well-known Sidel in China is ng levels have more fi llers are installed fi ll- Laurent Bousselet at the Sidel Beijing plant

15 REGIONAL MARKET REPORTS 16 REGIONAL MARKET REPORTS duced in the Sidel plant in China. from European production plants and those that are pro- there should be no difference between products originating reasons of technology and/or capacity. In terms of quality its way into China, but only when the need arises – i.e. for sustained. Equipment from France is still continuing to that the economic development of the last few years will be fi company’s customers locally and at the same time testi- localisation of product and quali your customers, reduced lead times, speed to the market, and their message to the Chinese market: “Proximity to equipment”. Keywords from the vocabulary of Sidel Beijing making blowers, multi-product plant in Sidel’s global industrial set-up for trial investment” – in this impressive factory. It is “the invested a total of € 45 million – Sidel’s “largest ever indus- same time eco-friendly approach (light, water, landscape – concept is intended to convey a professional and at the that are delivered just-in-time for systems for the smaller parts, the pre-assembled modules space, with a well laid-out even in Europe, with its clear allocation of production alone equipment. This lean factory could be anywhere, in combi format, in a block arrangement as well as stand- range – from blow moulding machines and for assembling all the products that form part of Sidel’s on the doorstep of the Chinese capital, is a modern factory here, in a constantly developing industrial zone situated admiration. and for which the market and even competitors are full of anxious to visit Sidel’s “multi-product plant“, as it is known 100% made in the country. engineers are servicing the market. Moulds for blowers are tested – all within the space of 7 days.” tooling machinery. Thereafter the mould is assembled and tooling centre, where the mould is manufactured on Mazak needs and time is of the essence. making speed to the market, rapid reaction to customer’s sensitive product – utilising our global experience: In mould product to be able to present the optimum solution for a ber 2008. The shop- tion relocated to Beijing/ China. Manufacturing inBeijing The Beijingplant es to con The factory is the expression of a commitment to the Sidel (or rather its Swedish holding company) have The trip to Beijing turned out to be well worthwhile. For We Four designers, four process engineers, four laboratory The design of the bottle is transferred directly to the Lenny Xuan: “We approach clients before de The buildings here in Beijing came on stream in Octo- Sidel’s factory in Malaysia has been closed and produc- fl ew from Shanghai to Beijing, where we were fi dence in China’s future and to the assurance PETplanet insider Vol. 13No.09/12 www.petpla.net fi llers, labellers, conveyors and end-of-line fl oor covers an area of 38,000m fl ow of materials, the KanBan fi ed staff.” ed fi nal assembly. nal fi llers, supplied llers, fi ning the ning 2 . The fi rst fi nd nd jing (Sidel comprising the following have been manufactured in Bei- from stainless steel is currently (March) being set up. conveyor systems. The manufacture of steel components tory tools for the installations are manufactured as well as plant“. ises and in this way create more capacity at the Beijing assemble blowers and have been trained to the desired and required level, we will and become a routine operation, and once our employees selet – “when the production processes have stabilised going a test run. “At some stage“ – says Laurent Bous- locations. While we were there, four combis were under- are put together, integrated and tested at specially created has been in charge of the project since 2008 and was, and tion stone was laid for the new Sidel factory in Beijing. She Zone Market Operation. years Communications Director of Sidel for Greater China groups on the assembly stands. approach is used for the placement of materials and sub- stations, likewise on an assembly line. A just-in-time assembly facility, the compact blowers on trolleys in three Our References Products andproduction terms of Sidel’s image in the country. lation, use of recycled material) – thus being an asset in waste recycling, energy saving, water saving, heat insu- whether made in Europe or in China.” in the speci Beijing plant said: “There should be no difference either in local content continually increasing. of localisation and personnel training was initiated resulting the classic and traditional SBO universal blower, a process sourced Chinese components. Malaysian design and are manufactured using locally PETplanet insider Vol. 13No.09/12 www.petpla.net     CSD large bottles) SBO compact blow moulders (small bph, small cavities, SBO universal blow moulder (large capacities) equipment and equipment such as conveyors and other standalone Combi machines Aseptic Since October 2008, more than 250pcs of equipment Under the same massive roof in one and the same fac- Marilyn Chua has been doing the job since the founda- In Shanghai we are talking to Marilyn Chua, for four For Universal blowers are assembled using a conveyor Laurent Bousselet – Product Supply Manager of the Also fortheremainderofSidelproducts,inparticular The SBO compact blowers are based on the former fi nal assembly of the combis, blowers and fi ller fi fi gures): ller fi cations or in the quality of a Sidel machine fi prem- llers at the end customer’s fi llers Lead Sponsor versatile, sustainable Technology Conference for Get aheadwithPET:Get [email protected] the PET Packaging Industry D-93026 Regensburg,D-93026 Germany Nuremberg Nuremberg (CCN East) www.petnology.com November Prior to BrauPrior Beviale 12-13, 2012 PETnology/tecPET GmbH Phone: +499418702374 Congress Center Fax: +499418702373 Conference Organiser 15 and flexible P.O. Box 120429 th

Strategy and

PETnology Europe 2012: More Information

17 REGIONAL MARKET REPORTS 18 REGIONAL MARKET REPORTS able all over the world, including here in Shanghai. Our able all over the world, including here in Shanghai. Our autumn, bears, both polar and grizzly. photographs of Canadian Aboriginal Peoples, landscapes in out room for brainstorming and innovative ideas, on the walls by their computer, a large cafeteria, a softly furnished break- contact, provided they are not otherwise engaged or occupied oured windows. buildings with facades of clean concrete, glass and dark col- waterfall, a place to relax, overlooking the campus are large Impressions Molding Systems (Shanghai) Lesley Shen, Communication Manager Husky (Injection Systems (Shanghai) China South PET&Packaging, Huksy Injection Molding John Zhang, General Manager Joe Man, Consultant, Beverage Packaging Asia Paci We met: “Make sureyourcustomerispro F.l.t.r.:John Zhang, Lesley Chen and Joe Man Shanghai Husky InjectionMouldingSystems, level as his motivation. implementing European goals and ideas. fact that the patience and perseverance are necessary for situation in China, to the mindset of the employees and the his professionalism as well as his sensitivity towards the explaining procedures expertly. We were impressed with to today’s reality. He took us through the production side, of Sidel’s Beijing Plant – all the way from initial concept Laurent Bousselet gave us a comprehensive presentation past 18 months is an experienced and perceptive manager. thing which she does very well. still is, responsible for the company’s public image – some- No doubt, you have entered Husky territory, recognis- Inside: Widely spaced open of Outside: Green open park land, a large pond with His knowledge of manufacturing is at the same high Laurent Bousselet, the Product Supply Manager for the fi ces, with people in visual fi table. fi sh and and sh fi c bonded, tax free, industrialised area. machines - located still on the same site within the Shanghai manufacturing location to assemble Husky injection moulding Technical Center has developed into a well organised, mature visit marked a return to Husky after 6 years. The Shanghai very good business due to the trends towards lightweighting. moulds, for PET preforms – an activity which has grown into a ised facility, Husky refurbishes and in particular converts reduced lead times to the Asia market. tion, Husky also manufactures hot runners locally to provide of producing several hundred systems annually. In addi- Bolton, Canada or Shanghai, China. nents. All components are identical whether assembled in machine products are made from globally sourced compo- AE and H-MED AE. to the integration of the all-electric line that includes H-PET from the HyPET, HyCAP, HyPAC and base Hylectric systems, This includes the complete suite of Husky systems ranging consumer electronics – are assembled in the Shanghai plant. packaging, and for making caps and closures, medical and practically unheardof.Brand owners normallydonotreplace PET markets. By contrast, replacement of PET systems is tems in China. Husky’s market share amounts to approximately 80% of sys- China to be as high as 520 to 560 systems. We also estimate we had already noted when visiting Zi Jiang. from converters to brand owners continues – a factor which to brand owners, 30% to converters. And the percentage shift to PETplanet’s estimates, the overall market consists of 70% to brand owners rather than to converters in China: According Products A view of the Husky Shanghai Technical Center Market presence Outside of the industrialised zone in a separate special- According to Husky the Shanghai location is capable Husky places importance on the statement: All Husky All Husky products for beverage packaging, thinwall Annual addition of systems is solely for the expansion of We estimated the general population of PET systems in In the Chinese market of today more cavities are supplied PETplanet insider Vol. 13No.09/12 www.petpla.net the market he knows best. well-known face of Husky in was, still is and remains the tions. As active as ever, he well as the Asia Paci a consultant to the China, as and still occasionally acts as Paci was Vice President Asia and by his clients. Joe Man honoured by his former team Western societies. Joe Man is a living example – being loved and are generally appreciated in this part of the world – more than in speed to market.” ing and converting moulds in Shanghai, we have indeed increased our Shanghai, manufacturing hot runners in Shanghai, as well as refurbish- training for the entire system, and we do prototyping.” culture and their requirements, we provide support in after sales and needs – we are geographically close to them, we understand their customers continue to work with us. We have everything the customer are essential if we are to satisfy customer requirements. This is why tion, and of course, including the dedication of all Husky personnel, all system approach, combined with the size and scale of the opera- Packaging China South. cial manager, was assigned in 1998 to China for Sales Beverage & satisfaction remains the ultimate target to be achieved. to the collective work of Husky’s strong team” (Husky claim). Customer ers as well as the big brand owners are on Husky’s customer list. the highest quality, lowest cost preform.” The major Chinese convert- of the statement. doing more and better”. The manufacturing area is convincing proof upon what you saw six years ago, when PETplanet visited, but ing to Joe Man, whom we had met six years ago: “We have built be more pro always strived to develop innovative technology to help customers to completed. Husky began manufacturing at this location in 2006. are customised, integrated with complementary equipment, tested, and ance testing plus three more areas, where injection moulding machines turing area – with 13 clearly de Manufacturing Organisation Strategy maintains: “Make sure your customer is pro latter converters, John Zhang – Husky’s Sales General Manager - of cost, more sensitive to fl ment to their early investments. Converters would be more conscious old systems with new systems. They often have a sentimental attach- PETplanet insider Vol. 13No.09/12 www.petpla.net Seniority, experience and respect for the wisdom of their elders Joe Man adds: “And by assembling injection moulding systems in John Zhang sums it up: “A local presence together with a complete John Zhang – 17 years with Husky – started in Bolton as commer- Despite their industry-leading position in global markets “Husky has Despite their industry-leading position in global markets “Husky has The amazing, eye-catching part of Husky Shanghai is the manufac- Husky hasmorethan900teammembersin Asia Paci fi c until January 2012 fi table and grow their businesses. This is in large part due fi c opera- c uctuations, more uctuations, fi ned areas for fi www.

issue 10: KHS, KraussMaffei and Netstal, In issues 10 and 11 you can read

issue 11: Krones, Sipa, Wahaha, Bericap pet pla ﬁ table. He loves you for .ne ﬂ nal assembly and accept- exible. Referring to the t

interviews with

Yinglu , SOE ﬁ c. Accord- CCT Creative CompetenceTechnology GmbH ® Closure Molds PET Molds ComPETCap Designs D-65527 Niedernhausen, Germany D-65527 Niedernhausen, www.cct-systems.com please contactus for furtherinformation powered byCCTSystems for CSD(carbonatedsoftdrinks) CCTSystems for stillwater CCTSystems [email protected] current design current design Idsteiner Strasse74 3,92g 3,05g 3,92g 5,05g 4,10g 5,05g Design andPatents Developments PET Systems Closure Systems ® ® 1810 3025 19

® REGIONAL MARKET REPORTS CCT design CCT design Vol.6 PETplanet print

Table of Contents i...... About the Authors 16...... IV Loss ii...... Introduction 17...... Long Gate Nub 18...... Milky Preform Chapter 19...... Moisture Marks 1...... AA Level High 20...... Neck Finish out of Round 2...... Accordion Preform 21...... Parting Line Crease 3...... Air hooks / Streaks 22...... Parting Line Deformation 4...... Black Specks 23...... Preform Yellowing 5...... Bubbles 24...... Short Shots

PREFORM PRODUCTION 6...... Burn Marks 25...... Sinks 7...... Colour Streaking 26...... Splay ...... /Peeling 27...... Stretched Necks 8...... Crystallinity 28...... Stringing 9...... Drool Marks 29...... Surface Blemishes 10...... Flash 30...... Thread Flow Lines 11...... Gate Depressions 31...... TSS (Top Sealing Surface) Sink 12...... Gate Peeling 32...... Unmelts 13...... Gate Voids / Pin Holes 33...... Wall Thickness Variation 14...... Internal Gate Sink 34...... Wavy Body 15...... Internal Sinks 35...... Weld Lines

The rapid guide to perfect preforms - part 32 32. Unmelts Troubleshooting guides have suffered in the companies to support their daily work in making past from being locked away in offi ces and not the best preforms possible. being available to the people that actually need The product of two industry experts, Rick Unter- them. Considering the high cost of machine and lander and Ottmar Brandau, it gives concrete tools high scrap rates can be a costly proposi- advice on 35 of the most common problems in tion eating away at already tight margins. preform manufacture, most illustrated by pic- PETplanet’s “Rapid Guide to Perfect Preforms” tures. From high AA levels to wavy bodies pro- takes a different approach. It has been written cessors can fi nd help when they need it. Read for the people on the fl oor of injection moulding chapter 3” of the guide. Symptom

Partially melted or totally unmelted resin at 175ºC (347ºF) and up to 6h at essary. NOTE: Do not restrict when pellets in the preform. 160ºC (320ºF)) using colorants that are susceptible to 3. Check all temperature readings and jelling or coagulation. Cause correct if necessary. PET resin should 6. Check extruder back pressure. This be melted at about 280ºC (536ºF) must be high enough for adequate Unmelted pellets are present in the pre- +/- 10ºC (18ºF). Increase as neces- mixing and shearing. Typical range is form from insuffi cient melting of the PET sary. 15 – 20 bar (200 – 300 psi). resin. 4. Check throughput of plastic in 7. Check screw rpm. Screw speed may system doesn’t exceed output of be increased to increase shear and Solutions extruder screw. The processed kg/ improve melting. hour of plastic should be below the 8. Ensure PET resin pellets have not been 1. Check dryer for alarms and correct manufacturers rating of the screw. degraded. This may raise the pellet as necessary. A high dewpoint Contact manufacturer for spec, and crystallinity level and raise its melting (above –40ºC (–40ºF)) or low inlet if exceeded, raise extruder tempera- point. Check with resin manufacturer resin temperature (should be mini- tures and/or increase cycle time to for testing resin characteristics. mum of 160ºC (320ºF)) may cause compensate. 9. Check hardware for worn, damaged extrusion problems and must be recti- 5. Check extruder throat cooling isn’t or failed components, specifi cally the fi ed. cooling resin pellets too much (should resin in-feed line, and the extruder 2. Check for adequate resin drying be minimum 160ºC (320ºF) inlet screw. time in hopper (should be around 4h temperature). Restrict cooling as nec- www.petpla.net

20 PETplanet insider Vol. 13 No. 09/12 www.petpla.net 2 th >

E X M A D T I I N C 22 BOTTLE MAKING 250ml to 1l Sidel’s stackable bottle concept for Stack & Pack is the brand name for- ronmental performance and reduced CO claim similar bene have developed solutions aimed at different markets but of stacking systems by Sidel and Siapi. The two businesses but that may be changing, with the simultaneous launches Heavier and more rigid materials tended to have the advantage a disadvantage against its traditional competitors has been stacking. als for some time and in a number of applications, one area that has found the material at While PET has continued to demonstrate many advantages over other packaging materi- Stack, rackandroll multi-layer stackingsystemsforPETbottles Siapi andSidellaunch fi ts, including convenience, improved envi- for tion at its production facility and ready that the technology is now in opera- nating crushed bottlenecks. Sidel says for energy savings, as well as elimi- during production offers the potential sure using the stroke base solution bottles. The reduction of blowing pres- fewer pallets for the same volume of age space; less shelf restocking; and reduces waste; optimisation of stor- ers, which cuts immediate costs and tages include elimination of interlay- says that the commercial advan- juices and liquid dairy products. Sidel suitable for sensitive products like 40%. Stack & Pack is claimed to be fi the number of bottles that can be layers, rather than six, and increases six bottles. The stack can rise to ten is wrapped around to form a pack of is need for interlayers. Once the bottle of stacking space and eliminating the which reduces the required amount below stacking. The neck of the bottle base of each bottle enables ef than-usual concave indentation at the ties from 250ml up to 1l. A deeper- solution of its kind for bottle capaci- Stack & Pack, is the says that its stackable bottle concept, Stack &Pack tted onto a standard Europallet by fi lled and capped, a stretch sleeve fi In the mid-size category, Sidel eld tests at customers’ plants. fi ts into the base of that above, 2 emissions. fi rst stacking rst www.sidel.com fi cient PETplanet insider Vol. 13No.09/12 www.petpla.net including reduction of CO lower-impact environmental solutions, material offer the potential to achieve weight reduction and strength of the is stackable up to four layers. The a handle inserted into the neck and The specially-designed container has tion of 50% of the original weight. is claimed to have achieved a reduc- friendly fuel from HDPE to PET, which verted a container for environmentally industry. The company recently con- oil sector, as well as in the chemical size are used primarily in the food- America as well. Containers of this interest from Central and North pean market but they have attracted developed them for the North Euro- Stack Lock. The company initially 10, 16 and 20l, with the brand name stackable containerswithcapacitiesof Stack Lock ties of 10, 16 an 20l is named Stack Lock Siapi’s stackable container with capaci- during road transport. Siapi has introduced a line of 2 emissions www.siapi.it World premiere of PET sheet line at the viscotec open 2012 viscoSHEET September 12-13, 2012

Food grade without compromise The decontamination of PCR PET for direct food contact reaches the highest level: As an integrated system it fulfills the worldwide strictest new EFSA standard for infants. Quality without compromise Flexibility without compromise A fully integrated detection and documentation The conical twin screw extruder allows direct system shows failures in the sheet automatically. feeding of in-house skeleton or edge trim flakes Parameters like iV or thickness and optical and virgin/R-PET pellets up to 100% without properties of the sheet such as color variation, predrying and guaranteed high iV levels. black spots, fish eyes or holes are detected and documented instantly. Optionally these can be Thanks to the gravimetric dosing for up to 4 com- marked on the roll. ponents, production issues during changing the material formulation are a thing of the past and Health and safety without compromise can be done during full production of the line. Despite the high operability and ease of handling, the roll stack and the fully automatic winder are Due to the short and defined residence time of setting new safety standards. the material melt in the extruder and the self- cleaning effect of the conical twin screw extruder, In addition to recycled PET flakes, also sheet color changes are achieved within minutes, from recycled HDPE* (FDA LNO) and recycled leading to an up to now unknown flexibility in PP*material for direct food contact can be production. produced on this line.

*LNO is based on special limitations regarding the input material

Starlinger & Co. Gesellschaft m.b.H.- viscotec - Adsdorf 38, 4113 St. Martin im Mühlkreis, Austria T: +43 7232 3817-0 - [email protected] - www.viscotec.at 24 BOTTLE MAKING standard SBM (Stretch Blow security pigments (Securalic Moulding) machines. It ena- material combinations to be technology by Merck KGaA new technology to produce realised without any sepa- multi-component preforms which can be used for the bles individual colour and Inotech Kunststofftechnik rate assembly steps. The are based on a protected multi-colour applications GmbH has developed a production of bottles on pigments) used for the Darmstadt, Germany. Multi-component bottles whole new world of possibilities. areas with another material open up a assembly stage and to cover critical tional problems without any additional a design element. To solve func- while another colour can be used as can protect the milk against UV light discussed milk bottle: a black colour rated. ments made of TPE can be incorpo- stabilise the later bottle or haptic ele- fi as transparent areas for windows and and assemblies for functionality such possible to create multi-resin parts of the possible applications. It is also multi-stage moulding process that How isthepreformproduced? demanding hapticapplications From multi-colouredto Coloured PETbottlesonstandardSBMmachines lling levels. A second material can Another example is the much- Colourful PET bottles are only one Multi-component moulding is a PETplanet insider Vol. 13No.09/12 www.petpla.net speci form design, colour and shape. Some on the process depending on the pre- Minor adjustments have to be done standard IR or NIR heating systems. processed like standard preforms with components containers. One appli- applications to produce blown multi- The company actually has two patent such as the Krones new FlexWave. sible to heat on a microwave system How arethepreformsblown? arranged in a vertical position (90°). machine’s multiple screws are usually for each different resin or colour). The plastication/injection units (one unit machine needs to have two or more second shot. The injection moulding machine. Resin B is then used in the or part of the mould, is rotated in the the injection mould. Then the mould, the integrated materials/components. In produces preforms with two or more These preforms can then further fi rst stage the resin A is shot into fi c designs may only be pos- can be obtained from Gizeh. GmbH. The new PET bottles Rüth, Head of Gizeh PET technical for cosmetics, domestic and and drinks industry, but also for customers from the food major potential, in particular results. The product offers and achieved some good with various design options the product. tion for the brand name and to provide enhanced protec- injection security pigments, ble, by means of concealed fi increase the shelf life of the can be applied which will bacterial inner wall coating cal front. On request an anti- are emerging on the techni- In addition new possibilities currently being developed. anti-slip gripper zones are elements such as soft or ency and colour. Handling in combinations of transpar- nations by blow moulding or tles in various colour combi- possible to produce the bot- haptic design potential. It is bottles as regards visual and up new horizons for PET customers worldwide. offering this technology to its phase, the company is now development and testing machines. After an extensive bottles on conventional SBM produce multi-coloured PET this new technology and to fi tadt, Germany, is one of the specialist Gizeh, Bergneus- Licensee Gizeh tion blow moulding. plastic containers by injec- produce multi-component the single-stage process to patent application refers to a second stage. The other and then blow moulded in minimum of two components is partially moulded with a process where the preform cation refers to the SBM PETplanet insider Vol. 13No.09/12 www.petpla.net ller product. It is also possi- rst companies to employ Gizeh has experimented This technology opens The plastic packaging fl uids, says Daniel €100m. France, Poland and Switzerland and generates annual sales of approx. in Bergneustadt, employs around 560 staff at as for bodycare and cosmetic products. The GIZEH Group, headquartered innovative plastic packaging for products from the foodstuffs industry as well tic packaging in Europe. The company designs, produces and decorates one of the leading companies offering complete solutions for rigid plas- About Gizeh Gizeh Verpackungen GmbH has its headquarters in Bergneustadt. It is www.gizeh.com  www.gizeh-pet.com fi ve locations in Germany,  www.inotech.de

25 BOTTLE MAKING Strong fresh air for PET-bottle industry

Glide into a new era of air-cooled, oil-free, and cost-efﬁcient high pressure

Time to gain new heights. The highly energy efﬁcient ZD compressor, with superior screw and booster technology, offers Class Zero quality air and is extremely silent with no vibrations. The air-cooled ZD provides you an exceptional reliability, no water consumption, while driving down investment and installation cost. It all adds up to sustainable productivity for today’s challenging low carbon economy. This new ZD is The answer for all your high pressure 40 bar applications. Visit www.atlascopco.com/petcompressors MARKETsurvey Conveyors 09/2012 Bottle-to-bottle recycling plants Caps and closures Preform moulds and SBM moulds Preforms Suppliers of two-stage Preform and single stage machinery SBM machinery  SBM machinery Compressors This year, our annual market survey includes 16 global suppliers of two- Filling equipment stage SBM machinery. In alphabetical order, these are: Amsler Equipment (USA), Beutelspacher Resins and additives (Mexico), Chum Power (Taiwan), Dodhia (India), KHS (Germany), Kosme (Austria), Krones (Germany), Mega Machinery (China), Nissei ASB (Ja- pan), Siapi (Italy), Side (Spain), Sidel (France), Sipa (Italy), Technopet (India), Urola (Spain) and last but not least, Wei Li (China). These companies appear in the market survey in the order in which their details were received by the editors.

Although the publishers have made every effort to ensure that the information in this survey is up to date, no claims are made regarding completeness or accuracy.

Company name Side S.A. Amsler Equipment Inc. Postal address Pol. Ind. Monguit, C/Llinars, s/n 1245 Reid St., Unit 1 08480 - L'Ametlla del Valles (Barcelona) Richmond Hill, Ontario, Canada L4B1G4 Telephone number +34 938463051 +1 905-707-6704 Web site address www.sidemachines.com www.amslerequipment.net Contact name Josep Jiménez Heidi Amsler Function Global Export Manager Sales and Marketing Manager Direct telephone number +34 677551928 +1 905-707-6704 Fax +34 938492211 +1 905-707-6707 E-Mail [email protected] [email protected] 1. Machine designation / model Easyblow Maxiblow 1002e/ 2002e/ 5001 Maxi-W T-handle Linear Series - Linear Linear Con- Linear Large Rotary Series number 2004e/ 2003e 1 / 2 / 3 9 models Widemouth Jar vertible Series Format Series 2 models 2006e Series 4 models 5 models 2 models 2. Bottle volume (from/to in litres) a) Standard machines 0.1 - 2.5 0.1 - 11 0.1 - 2.5 0.1 - 11 1 - 40 0.1 - 11 1-4 0.05 - 5 0.1- 6 0.05 - 5 0.05 - 3 b) Machines for large containers 4 - 23 3. Maximum number of stretch-blow moulds (units) a) Standard machines 1 1 6 3 1 1 3 6 2 16 b) Machines for large containers 6 2 4. Output per stretch-blow mould for: a) 0.5 litres CSD bottle (units / hour) 1,500 1,500 1,500 1,500 1,500 1,500 1,000 1,800 1,800 1,500 b) 1 litre CSD bottle (units / hour) 1,500 1,500 1,500 1,500 1,500 1,500 1,000 1,400 - 1,800 1,400 - 1,800 1,250 - 1,500 c) 1.5 litres still mineral water bottle 1,500 1,500 1,500 1,500 1,500 1,500 1,000 1,400 - 1,800 1,400 - 1,800 1,300 - 1,500 (units / hour) d) Large capacity container 1,500 1,000 1,500 1,000 800 1,000 1,000 900(10l); 275(18.9l) e) Other 800 - 1600 3000(4l) 5. Footprint / space requirement (L x To be determined. Taylored solutions for small areas. 4.0x1.8x2.4 to 3.9x2.5x2.2 5.7x2.0x2.4 to 3.9x3.8x2.7 2.7x2.2x3.1 to W x H in metres) 4.3x3.7x2.5 4.3x3.7x2.5 4.2x3.0x3.2

PETplanet insider Vol. 13 No. 09/12 www.petpla.net 27 28 MARKET SURVEY (L xWHinmetres) 5. Footprint/spacerequirement e) Other d) Largecapacitycontainer (units /hour) c) 1.5litresstillmineralwaterbottle b) 1litreCSDbottle(units/hour) a) 0.5litresCSDbottle(units/hour) 4. Outputperstretch-blowmouldfor: b) Machinesforlargecontainers a) Standardmachines blow moulds(units) 3. Maximumnumberofstretch- b) Machinesforlargecontainers a) Standardmachines 2. Bottlevolume(from/toinlitres) number 1. Machinedesignation/model E-Mail Fax Direct telephonenumber Function Contact name Web siteaddress Telephone number Postal address Company name (L xW xHinmetres) 5. Footprint/spacerequirement e) Other d) Largecapacitycontainer (units /hour) c) 1.5litresstillmineralwaterbottle b) 1litreCSDbottle(units/hour) a) 0.5litresCSDbottle(units/hour) 4. Outputperstretch-blowmouldfor: b) Machinesforlargecontainers a) Standardmachines blow moulds(units) 3. Maximumnumberofstretch- b) Machinesforlargecontainers a) Standardmachines 2. Bottlevolume(from/toinlitres) number 1. Machinedesignation/model E-Mail Fax Direct telephonenumber Function Contact name Web siteaddress Telephone number Postal address Company name MARKETsurvey 2,9 x2x2,2 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 2 2 up to12 0.1 -6 (3 models) S [email protected] [email protected] +39 0438401016 +39 04384096 Sales Manager Maico Zanco www.siapi.it +3904384096 31020 SanVendemiano (Tv),Italy Via FerroviaNord,45 Siapi SRL 4x4x3 mouth:450 Jars Hot-fill andwide 800 1,200 1,200 1, 2,4 0.05 to2 1200/1800 Pauto [email protected] +91 22-28061410 +91 982034656/09821040637 Technology Mr. Vineet Bannore/Mr.Sunil Bharkhada www.technopet.in +91 22-28610828 Mumbai-400 067MaharashtraIndia 14/15, ShreeNamanPlaza,S.VRoadKadivali(W), TechnoPET Machineries 5 x2,22,55 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 2 3-5 up to10 0.1 -5 (7 models) SC series 3x5x6 800 800 1,100 2 0.10 to5 2x2x5 Pauto 500 500 1 6x4x7 1,600 1,500- 1,500 1,600 2 0.10 to2 PET-T1 Auto- 1,400 7,3 x3,12,4 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 3 -4 5-10 up to10 0.1 -5 models) SE series(13 09/2012 5x4x3.5 300 1 jar 5 Gallon TPS-20L 100 100 1 5 to20 7,3 x3,12,4 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 12 -16 0.1 -3l models) SD series(6 4x4x3 Combo filling 1, 2,4 Beer/Liquore TP-Beer For 600 500 0.2 to2 700 3.1 (withoutpreformfeedingsystem) min. 4.5x1.833.1;max.5.11.85 up to1,250for5l;35030l 1,600 1,650 1,700 4 0.05 -3 Linear machines(6models) [email protected] +43 2628-411-4125 +43 2628-411-125 Managing Director Johann Gugler www.kosme-austria.com 0043 2628-411-0 Sollenau, Austria 2601 Gewerbestrasse 3 2 -4 0.5 -30 Kosme GmbH various 24 24 EVO,SFR9/27(7models) SFR 16EVO,SFR20 EVO, SFR812 Rotary blowmoulders;SFR6 [email protected] +39 0438912273 +39 0438911511 Industrial DivisionDirector Antonio Narder www.sipa.it +390438911511 31029 Vittoria Venoto (TV),Italy Via CadutiDelLavoro up to2,000 up to2,000 0.25 -3.3 Sipa up to2,000 PETplanet insiderVol. 13 No.09/12www.petpla.net 5,8x2,2x2,1m 6 SFL 6/4,SFL 6/6(9models) SFL 4/4,SFL 6/2,SFL 6/3, 2/2,SFL 2/1,SFL 4/2,SFL 4/3, Linear blowmoulders;SFL up to1,700 up to1,800 0.25 -3.0 1,250 for 5l; 800 b/c/h for 30l 1,250 for5l;800b/c/h30l 6 4 -30 up to1,800 (without preformfeedingsystem) 6.05 x3.853.25 1,250 2,000 2,000 2,000 6 0.05 -3 (4 models) Rotary machines 6 0.5 -6

to 11.7 x7.64.6 from 6.5x5.44.6 28 11 modelsavailable Contiform Medium Krones AG [email protected] +49 940170-914980 +49 940170-4980 Sales Manager Peter Christiansen www.krones.com +49 9401-70-0 93073 Neutraubling,Germany Böhmerwaldstr. 5 2,250 2,250 0.1 -3.0(3.78i.e.1gallon) depending onmachinemodel 500-650 for5-10L;100-12020L 800-1,000 800-1,000 800-1,000 1 -4 0.015 -10 Large I-II,Ex-Wide) MP Series(Mini,StandardI-IV, MediumI-IV, 350-400 for500mlPP FridgeBottle [email protected] +852 26902380 +852 26902368 Business Manager Maggie Chau www.weiliplastics.com +852 26902368 26-28 Au PuiWan St.,Fo Tan, N.T. HongKong Room 1212,Fo Tan Ind.Centre, 1 -2 10 -20 Wei LiPlasticsMachinery(H.K.)Limited

to 14.4x7.64.6 from 10.7x6.24.6 36 4 modelsavailable Contiform Small 2,250 0.1 -0.7

to 11.2 x6.84.5 from 6.9x4.44.5 moulds) 1,800 (aluminium moulds) 2,000 (aluminium moulds) 2,000 (aluminium moulds) 2,000 (aluminium 24 (26) 0.1 -2.0 (7) modelsavailable Contiform MediumH;8 2 x3 400 upto6000ml 300 300 360 1 to2 5 0.01 -6 FlexiPET -6000 +91 22-24030034,66662110 Mumbai -400022,INDIA 69/3 PervinMansion,SionWest, Dodhia Techno Engg.PVT. LTD. Bipin Dodhia www.dodhia.com +91 22-24082792 Managing Director [email protected] 3.5 x 3 x 2 3.5 x32 1,250 1,250 1,400 2 0.1 -2 AutoPET -Duo [email protected] +49 4067907-9483 +49 4067907-483 Product ManagerBlomax Marco Boehnke www.khscorpoplast.com +49 4067907-0 Hamburg, Germany Meiendorfer Str. 203,22145 KHS CorpoplastGmbH 13,3 x7,03,5 2,200 2,200 2,200 36 0.2 -3.0 Blomax ,SeriesIV

4 [email protected] +34 943737144 Iñaki Unanue www.urola.com +34 943737003 20230 Legazpi,Spain Urola Kaleas/n,POBox 1,500 up to10 0.1 -2 Urola S.C. Largest: 5.9 x 4.35 x 2.3 Largest: 5.9x4.352.3 Smallest: 2.32x2.22.0; 1,200 1,600 1,500 8 Urbi-8; Urbi-2L,Urbi-4L Urbi-2, Urbi-4,Urbi-6, 1,100 -1,500 Sidel Group [email protected] +33 232858845 Blowing &CoatingProductManagementDirector Dominique Martin www.sidel.com +33 232858687 BP 204,76053LeHavreCedex,France Avenue delaPatrouilleFrance,Octeville-sur-Mer, to 18.8X6.63.9 from 7.1X3.33.8 2,000/1,800 forSBO30 2,000/1,800 forSBO30 2,000/1,800 forSBO30 30 0,25 -3 (rotary blower) 20 models SBO Universal2eco 1 [email protected] +55 58451053 +55 58404562 Director Ing. SergioBeutelspacher www.beutelspacher.com +55 58404562 Tláhuac, MexicoD.F. Venados No52,Col.LosOlivos, Beutelspacher S.A.DEC.V. 1,200 -1,800 1,200 -1,800 3 3 2 x 3.8 x 2.5 2 x3.82.5 700 -800 700 -800 1,200 -1,800 2 SB 3002 to 13.1X4.93.8 from 11.3 X4.93.9 2,000 34 0,2 -0,7 (rotary blower) 2 models SBO Highspeedeco 4 [email protected] +81 26723-1564 +81 26723-1565 Manager -SalesCoordination Team Mr. KatsuoIshiguro www.nisseiasb.co.jp/en/ +81 26723-1565 Nagano-ken 384-8585,Japan 4586-3 Koo,Komoro-shi, 1,000** up to2** up to0.6** Nissei ASB MachineCo.,Ltd. 6.7 x2.03.2 blowing athigheroutpits fill containers.Canalsobeusedforregular **data isfordoubleblow-heat-setfillinghot <500ml jarsat970bph/cav 600** 6 HSB-4N, HSB-6N,HSB-6M 1,600/1,200 forSBO2XXL 1,000 3 up to10 1,600/1,200 forSBO2XXL 1,600/1,200 forSBO2XXL 5.1 X23.4 1,600/1,200 forSBO2XXL 4 0,25l-10 (linear blower) 3 models SBO Compact2 1,400/1200 forSBO2XXL 1,000 3 up to10 1,400/1,200 forSBO2XXL 1,400 /1,200forSBO2XXL 5.1 X23.4 1,400/1,200 forSBO2XXL 4 0,25l-10 (linear blower) 3 modelsavailable (Preferential Heating) SBO Compact2PH up to 2 up to2 [email protected] +86-576-84020107 +86-576-84020122 Sales Manager Simon Cai www.megamachinery.com +86-576-84020122 yan, Zhejiangprovice,China 47-8 #HuangzhouRD,Huang- 1,500 1,500 up to25 up to2.5 16 Mega 25l Depending onmachinemodel 150 1,300 1,400 up to16 10 1,200 1,400 1,400 to 10.6X4.93.9 from 6.7X3.33.8 1,400 20 0,25 -3,3 (for flatand Heating)/; 8models PH (Preferential SBO Universaleco 4 [email protected] +886 423380219 +886 423388289#1200 General Manager Grace Lee www.chumpower.com +886 423388289 WuriRoad, Township, Taichung, Taiwan No. 688-1,Section3,ZhongShan Chum PowerMachineryCorp. 1,700 4 -20 0.060 -2 7x2.02x3.5 550- 1,000 1,500 1,500 12 L series 1,100 1,500 1,700 to 18.8X6.63.9 from 7.1X3.33.8 1,800/1,700 forSBO30 30 0,25 -3 (for hotfill) /11 models (Heat Resistant) SBO UniversalecoHR (L xWHinmetres) 5. Footprint/spacerequirement e) Other d) Largecapacitycontainer (units /hour) c) 1.5litresstillmineralwaterbottle b) 1litreCSDbottle(units/hour) a) 0.5litresCSDbottle(units/hour) 4. Outputperstretch-blowmouldfor: b) Machinesforlargecontainers a) Standardmachines blow moulds(units) 3. Maximumnumberofstretch- b) Machinesforlargecontainers a) Standardmachines 2. Bottlevolume(from/toinlitres) number 1. Machinedesignation/model E-Mail Fax Direct telephonenumber Function Contact name Web siteaddress Telephone number Postal address Company name (L xW xHinmetres) 5. Footprint/spacerequirement e) Other d) Largecapacitycontainer (units /hour) c) 1.5litresstillmineralwaterbottle b) 1litreCSDbottle(units/hour) a) 0.5litresCSDbottle(units/hour) 4. Outputperstretch-blowmouldfor: b) Machinesforlargecontainers a) Standardmachines blow moulds(units) 3. Maximumnumberofstretch- b) Machinesforlargecontainers a) Standardmachines 2. Bottlevolume(from/toinlitres) number 1. Machinedesignation/model E-Mail Fax Direct telephonenumber Function Contact name Web siteaddress Telephone number Postal address Company name 2,9 x2x2,2 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 2 2 up to12 0.1 -6 (3 models) S [email protected] [email protected] +39 0438401016 +39 04384096 Sales Manager Maico Zanco www.siapi.it +3904384096 31020 SanVendemiano (Tv),Italy Via FerroviaNord,45 Siapi SRL 4x4x3 mouth:450 Jars Hot-fill andwide 800 1,200 1,200 1, 2,4 0.05 to2 1200/1800 Pauto [email protected] +91 22-28061410 +91 982034656/09821040637 Technology Mr. Vineet Bannore/Mr.Sunil Bharkhada www.technopet.in +91 22-28610828 Mumbai-400 067MaharashtraIndia 14/15, ShreeNamanPlaza,S.VRoadKadivali(W), TechnoPET Machineries 5 x2,22,55 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 2 3-5 up to10 0.1 -5 (7 models) SC series 3x5x6 800 800 1,100 2 0.10 to5 2x2x5 Pauto 500 500 1 6x4x7 1,600 1,500- 1,500 1,600 2 0.10 to2 PET-T1 Auto- 1,400 7,3 x3,12,4 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 3 -4 5-10 up to10 0.1 -5 models) SE series(13 5x4x3.5 300 1 jar 5 Gallon TPS-20L 100 100 1 5 to20 7,3 x3,12,4 1,250-1,300 1,500-1,800 1,500-1,800 1,500-1,800 12 -16 0.1 -3l models) SD series(6 4x4x3 Combo filling 1, 2,4 Beer/Liquore TP-Beer For 600 500 0.2 to2 700 3.1 (withoutpreformfeedingsystem) min. 4.5x1.833.1;max.5.11.85 up to1,250for5l;35030l 1,600 1,650 1,700 4 0.05 -3 Linear machines(6models) 2 -4 0.5 -30 [email protected] +43 2628-411-4125 +43 2628-411-125 Managing Director Johann Gugler www.kosme-austria.com 0043 2628-411-0 Sollenau, Austria 2601 Gewerbestrasse 3 Kosme GmbH various 24 24 EVO,SFR9/27(7models) SFR 16EVO,SFR20 EVO, SFR812 Rotary blowmoulders;SFR6 up to2,000 up to2,000 0.25 -3.3 [email protected] +39 0438912273 +39 0438911511 Industrial DivisionDirector Antonio Narder www.sipa.it +390438911511 31029 Vittoria Venoto (TV),Italy Via CadutiDelLavoro Sipa up to2,000 5,8x2,2x2,1m 6 SFL 6/4,SFL 6/6(9models) SFL 4/4,SFL 6/2,SFL 6/3, 2/2,SFL 2/1,SFL 4/2,SFL 4/3, Linear blowmoulders;SFL up to1,700 up to1,800 0.25 -3.0 up to1,800 1,250 for 5l; 800 b/c/h for 30l 1,250 for5l;800b/c/h30l 6 4 -30 (without preformfeedingsystem) 6.05 x3.853.25 1,250 2,000 2,000 2,000 6 0.05 -3 (4 models) Rotary machines 6 0.5 -6

to 11.7 x7.64.6 from 6.5x5.44.6 28 11 modelsavailable Contiform Medium Krones AG 2,250 2,250 0.1 -3.0(3.78i.e.1gallon) [email protected] +49 940170-914980 +49 940170-4980 Sales Manager Peter Christiansen www.krones.com +49 9401-70-0 93073 Neutraubling,Germany Böhmerwaldstr. 5 depending onmachinemodel 500-650 for5-10L;100-12020L 800-1,000 800-1,000 800-1,000 1 -4 0.015 -10 Large I-II,Ex-Wide) MP Series(Mini,StandardI-IV, MediumI-IV, 1 -2 10 -20 [email protected] +852 26902380 +852 26902368 Business Manager Maggie Chau www.weiliplastics.com +852 26902368 26-28 Au PuiWan St.,Fo Tan, N.T. HongKong Room 1212,Fo Tan Ind.Centre, 350-400 for500mlPP FridgeBottle Wei LiPlasticsMachinery(H.K.)Limited to 14.4x7.64.6 from 10.7x6.24.6 36 4 modelsavailable Contiform Small 2,250 0.1 -0.7

to 11.2 x6.84.5 from 6.9x4.44.5 moulds) 1,800 (aluminium moulds) 2,000 (aluminium moulds) 2,000 (aluminium moulds) 2,000 (aluminium 24 (26) 0.1 -2.0 (7) modelsavailable Contiform MediumH;8 2 x3 400 upto6000ml 300 300 360 1 to2 5 0.01 -6 FlexiPET -6000 [email protected] +91 22-24082792 Managing Director Bipin Dodhia www.dodhia.com +91 22-24030034,66662110 Mumbai -400022,INDIA 69/3 PervinMansion,SionWest, Dodhia Techno Engg.PVT. LTD. PETplanet insiderVol. 13 No.09/12www.petpla.net 3.5 x 3 x 2 3.5 x32 1,250 1,250 1,400 2 0.1 -2 AutoPET -Duo [email protected] +49 4067907-9483 +49 4067907-483 Product ManagerBlomax Marco Boehnke www.khscorpoplast.com +49 4067907-0 Hamburg, Germany Meiendorfer Str. 203,22145 KHS CorpoplastGmbH 13,3 x7,03,5 2,200 2,200 2,200 36 0.2 -3.0 Blomax ,SeriesIV

4 [email protected] +34 943737144 Iñaki Unanue www.urola.com +34 943737003 20230 Legazpi,Spain Urola Kaleas/n,POBox 0.1 -2 1,500 up to10 Urola S.C. Largest: 5.9 x 4.35 x 2.3 Largest: 5.9x4.352.3 Smallest: 2.32x2.22.0; 1,200 1,600 1,500 8 Urbi-8; Urbi-2L,Urbi-4L Urbi-2, Urbi-4,Urbi-6, 1,100 -1,500 Sidel Group [email protected] +33 232858845 Blowing &CoatingProductManagementDirector Dominique Martin www.sidel.com +33 232858687 BP 204,76053LeHavreCedex,France Avenue delaPatrouilleFrance,Octeville-sur-Mer, to 18.8X6.63.9 from 7.1X3.33.8 2,000/1,800 forSBO30 2,000/1,800 forSBO30 2,000/1,800 forSBO30 30 0,25 -3 (rotary blower) 20 models SBO Universal2eco 1 [email protected] +55 58451053 +55 58404562 Director Ing. SergioBeutelspacher www.beutelspacher.com +55 58404562 Tláhuac, MexicoD.F. Venados No52,Col.LosOlivos, Beutelspacher S.A.DEC.V. 3 1,200 -1,800 1,200 -1,800 3 2 x 3.8 x 2.5 2 x3.82.5 700 -800 700 -800 1,200 -1,800 2 SB 3002 to 13.1X4.93.8 from 11.3 X4.93.9 2,000 34 0,2 -0,7 (rotary blower) 2 models SBO Highspeedeco 4 [email protected] +81 26723-1564 +81 26723-1565 Manager -SalesCoordination Team Mr. KatsuoIshiguro www.nisseiasb.co.jp/en/ +81 26723-1565 Nagano-ken 384-8585,Japan 4586-3 Koo,Komoro-shi, up to0.6** 1,000** up to2** Nissei ASB MachineCo.,Ltd. blowing athigheroutpits fill containers.Canalsobeusedforregular **data isfordoubleblow-heat-setfillinghot <500ml jarsat970bph/cav 6.7 x2.03.2 600** 6 HSB-4N, HSB-6N,HSB-6M 1,600/1,200 forSBO2XXL 1,000 3 up to10 1,600/1,200 forSBO2XXL 1,600/1,200 forSBO2XXL 5.1 X23.4 1,600/1,200 forSBO2XXL 4 0,25l-10 (linear blower) 3 models SBO Compact2 1,400/1200 forSBO2XXL 1,000 3 up to10 1,400/1,200 forSBO2XXL 1,400 /1,200forSBO2XXL 5.1 X23.4 1,400/1,200 forSBO2XXL 4 0,25l-10 (linear blower) 3 modelsavailable (Preferential Heating) SBO Compact2PH up to 2 up to2 [email protected] +86-576-84020107 +86-576-84020122 Sales Manager Simon Cai www.megamachinery.com +86-576-84020122 yan, Zhejiangprovice,China 47-8 #HuangzhouRD,Huang- up to2.5 1,500 1,500 up to25 16 Mega 25l 1,300 1,400 Depending onmachinemodel 150 up to16 10 1,200 1,400 1,400 to 10.6X4.93.9 from 6.7X3.33.8 1,400 20 0,25 -3,3 (for flatand Heating)/; 8models PH (Preferential SBO Universaleco 4 [email protected] +886 423380219 +886 423388289#1200 General Manager Grace Lee www.chumpower.com +886 423388289 WuriRoad, Township, Taichung, Taiwan No. 688-1,Section3,ZhongShan Chum PowerMachineryCorp. 0.060 -2 1,700 4 -20 7x2.02x3.5 550- 1,000 1,500 1,500 12 L series 1,100 1,500 1,700 to 18.8X6.63.9 from 7.1X3.33.8 1,800/1,700 forSBO30 30 0,25 -3 (for hotfill) /11 models (Heat Resistant) SBO UniversalecoHR 29 MARKET SURVEY The variety of the beverage world from one single source

The 17th revised edition of Birkner’s Beverage Wold 2012/2013, the directory for the international beverage industry, offers an extensive overview of your worldwide beverage markets. Find more than 21.500 company proﬁ les from 199 countries: Breweries, mineral water, soft drink and juice manufacturers, distilleries, hop, malt and raw material suppliers, supplying industries, international associations and trade press. And the professional access to the online database enables you to establish direct contact to decisive partners of national and international markets.

Your advantages at a glance: s!CCESSTOPERMANENTLYUPDATEDCOMPANYPROlLESOFTHEINTERNATIONALBEVERAGEINDUSTRY s5NLIMITEDRESEARCHFORMANUFACTURERS CONVERTERS RAWMATERIALSUPPLIERS MERCHANTS service companies and suppliers for 1 year s0ROFESSIONALSEARCHOPPORTUNITIESFORMANAGEMENT MACHINES RAWMATERIAL PRODUCTS brand names and services s%ASYDATAEXPORTFORTHEUSEINOWNCUSTOMERANDFORMLETTERl L E S s5P TO DATECOMPANYNEWSANDPRODUCTVIDEOSnCONNECTEDTOTHECOMPANYPROlLES sWith an advertisement in Birkner’s Beverage World 2013/2014 you will reach deciders of the international beverage industry Your professional access www.beverage-world.com to the online database

BECOME A PROFESSIONAL

REGISTER NOW – Phone +49 40 800 80 1777 or www.beverage-world.com/anmelden format of 0.5l bottles. ously used by Stella Alpina for the 3x2 as against the 50-60 micron previ- ness less than 30 microns to be used, This allows shrink controlled by digital servo-drivers. which uses with a motorized blade wrapping machine with a new knife, achieved by equipping the shrink- in thermo-shrinkable weighs 23g. Savings of up to 50% bottle weighs 11g, the 5l version “ultra-light” containers. The 500ml up to 30% with the introduction of new rial. PET usage has been reduced by mary and secondary packaging mate- them has been reduced. the number of conveyors connecting smaller footprint than usual, because palletiser. This solution has a much tion between the shrinkwrapper and that features high levels of integra- unit, a shrink- comprises a Pack Bloc packaging and labelling. Downstream equipment stretch-blow moulding, unit, which is an integrated system of the Ecobloc Plus primary packaging sumption. The enable lower costs and energy con- two integrated machine blocks, which Reduced packagingmaterial over a surface area of just 800m Alpina’s plant in Mojo de’ Calvi, Bergamo, Italy, was devised, designed and created by SMI A new SMI SACS (Stella Alpina Cost Saving) line for still and sparkling water at Stella Water thefoothills from PETplanet insider Vol. 13No.09/12 www.petpla.net The system has reduced both pri- The new line is made up of just SMI SACS line fi lm packaging system fi rst block consists of fi lm with a thick- fi lm have been fi lling / capping CO on the conveyors. high energy-ef is made of more resistant materials and moving parts has been reduced, the line heated resistances. The number of less heat from IR lamps and electrically- preforms and thinner shrink the end-of-line shrinkwrapper; and lighter partly discharged to the shrinking oven in used for pre-heating the preforms and and air compression systems is partly Heat recovered from the blow moulder use of high pressure compressed air. system enables a of single modules; the air recovery belts for the connection of a low number the bottling line requires less conveyor of measures. The compact footprint of 15%, through the adoption of a number production line has been reduced by process usually accumulates. where dirt and waste from the production components and mechanical parts, the machines to be “freed” from moving ogy to the fi the application of “baseless” technol- sumption has been cut by 90% with and energyuse Reduced water plete line has been achieved. 2 .

2 In the end an overall reduction in Energy consumption of the entire Energy consumption of the entire The plant’s cleaning water con- It produces up to 14,400bph. emissions of 50% along the com- ller. This allows the base of ﬁ ciency motors are used ciency motors are used

40% reduction in the 40% reduction in the www.smigroup.it ﬁ lms require require lms end of the line PET bottles are packed on trays at the The Stella Alpina bottle logo still and sparkling water produces Stella Alpina

31 BOTTLING / FILLING 32 EDITOUR REPORTS Germany account for €1.4bn. Travelling through Bulgaria it Balkans amounts to around €2.3bn whereas imports into whom are represented locally; the volume of exports to the 5,000 German companies trading with Bulgaria, 1,200 of is played by Germany– altogether there are more than components as well as consumer goods. Here the key role the other hand, the country imports machines and machine stuffs and machinery, together with chemical products. On export activities include the export of, for example, food- expanded correspondingly. For instance, mainstream have not only undergone streamlining but have also been and the associated availability of subsidies, supply chains ans as well as Wallachians and people of Romany origin. remaining 15% is made up of Turks, Russians and Armeni- around 111,000km². 85% of these are Bulgarians whilst the inhabitants overall in a country occupying a total area of the European Union since January 2007, has 7.3 million from asinglesource Bulgaria’s bounty tour reports about the Go to Brau beviale Tour 2012 will start. (by Kay Krüger) and a step visit to Bericap Romania (by Alexander Büchler). In November, our Edi- We As a consequence of Bulgaria’s accession to the EU The Republic of Bulgaria, which has been a member of fi nish our Editour report from the Go to Brau Beviale Tour 2011 with the reports about Bulgaria Nuremberg Ljubljana Mirna PeˇcMirna Sveto Gorica Radenci jansk Dulo Selo Bulgaria Cegled Subotica Novi Sad Beograd Saedinenie Plovdiv Ploiesti Istanbul Ingöl Ankara The bene entated way, spreading their portfolio as wide as possible. approach the issue in a highly just one product at any given time. Instead, people mostly PET processing, to be able to identify THE core market for it is evident that it is not essential, either in production or in tendency. From discussions with a range of different senting major automotive concerns, displays a proprietary contrast to international retail chains or agencies repre- panies or PET producers, the Bulgarian drinks market, by ably enjoying some advantages. uct lines are, viewed from a time perspective, unquestion- sector, cracy, export and import activities in the injection moulding cerned? Due to a signi What does this mean as far as the drinks industry is con- German companies that are not represented in this area. is not long before you notice that there are hardly any big Gaziantep However, moving on to locally-established bottling com- fi lling lines, capping systems and entire PET prod- fi ts for the customer are wide-ranging. These not PETplanet insider Vol. 13No.09/12 www.petpla.net Yerevan YerevanYe fi cant reduction in complex bureau- fl exible and customer-ori- Baku BakuBaBakBkB akua kku u fi rms Choose the Number One. VA T h placement of the goods on the supermarket shelf. company, from the emergence of his idea right through to customer can count on the services of one and the same packaging, but instead offer all-round solutions. Here the simply limit themselves to individual aspects of beverage One special feature is that packaging manufacturers do not both of which are still way ahead of juices, for example. consumption, the population’s focus is on CSD and water, ing to market activity in this region. In terms of beverage and export activities are concerned and are contribut- their business relationships with Bulgaria as far as import sion to the EU. Quite a few global players have expanded turn, especially in the wake of the country’s recent acces- beverages and food, as well as to beauty and health care. also be marketed separately. And all of this applies both to tions, the products created in the various processes can tion to these possibilities, when it comes to complete solu- sures, for example, or look after the labelling side. In addi- preform manufacturers, they may also create caps and clo- changes or requirements. Bottle blowing is carried out by This means that it is possible to make a rapid response to single source, or, in other words, by just one company. to bottling and palletising; often much is offered from a ing throughout the entire production process right through only include the design and development of PET packag- PETplanet insider Vol. 13No.09/12 www.petpla.net CU e U The economy of Bulgaria has taken an interesting s RRE pecialis E MAM A ® –PET t s i e n xxt

p ru lasti si on n c tec r ecy hn n ol og l i ng sy ie e s s t ems. One of the many display cases in the Gotmar showroom without CO onade and water is relatively high. Of course, natural water ket in up to 3l bottle sizes) the demand for carbonated lem- PET (which is available here in practically every supermar- unequivocally favours CSD and water. In addition to beer in the water and beer sectors. a volumetric content of ten or more litres, predominantly in size bottles, signi The discounter range also offers, in addition to standard when it comes to a comparison of consumption trends. Consumption on the part of the Bulgarian population 2 also has a role to play, but tends to fall away ﬁ cant quantities of container bottles with

33 EDITOUR REPORTS 34 EDITOURS REPORTS Count Draculareallydid exist. philosophical discussion aboutwhether local wine,theconversation turnstoa over apleasantmealand abottleofthe ial eveningathislocal hostelry,where, eral Manager.Together we spendaconviv- where IamtomeetTiberiuBako,theGen- appointment withBericapinPloiesti, evening, Ireachmydestinationand I amextremelyrelievedwhen,onSunday in Bulgariaareanawfulstate,so viewed twomajorcompanies.Theroads via Bulgaria,whereKayhasalreadyinter- nia isnextontheagendawithadetour Romania blog here wecome! Editourmobil quenchesitsthirst.Turkey, petrol station,justontheborder, hit 20degreesandmore.Atthelast world. Beforelongthetemperaturewill sun isshining,andallwellwiththe placed forthemotorwaytoIstanbul.The which washandyasitisconveniently stay asecondnightattheIvecopremises Turkey. Victorhadkindlyallowedmeto Sofi you enoughforyourhospitality.Ileave access available.Victor,Ican’tthank food anddrinkevenmakestheWi- temporary mobileof change Victor’sreceptionareaintomy Without somuchasabyyourleave,I is Victor,whocannotdoenoughforme. repaired. ThemaninchargeatIvecoSo tantly, Ineedtogetthewindscreen writing tocatchupon,andmoreimpor- lenges. Forstarters,Ihavealotof touches thepillow. I amasleeppracticallybeforemyhead fi ever. Itis10o’clockatnightwhenI than makeupforthepseudo-monsoonhow- weather improving.Bothappointmentsmore under water,andthere’snosignofthe is bucketingdownwithrain,theroad gress isnothelpedbythefactthatit To gettothemisa150kmdrive,andpro- two appointmentsatGotmarandindex-6. a goodnight’ssleep,Iprepareformy day, andgotobedearly.Refreshedafter and tiringdrive,Idecidetocallita a Wi-fi hire acar,andthe able fortheEditourmobilsoIdecideto roads ofthecityarenotreallysuit- ity ofsupervision.Thenarrow,crowded the othervehiclestestifytoqual- the airport.Slashedtyresonsomeof the nightatasupervisedcarparknear locate asuitableplacetobeddownfor point. OncearrivedinSo cles andendlesshold-upsatthecrossing Inevitably, therearequeuesofvehi- Bulgaria blog

nally pullupbesidetheEditourmobil.

After mybriefsojourninTurkey,Roma- The nextdaybringssomenewchal- Finally IreachtheBulgarianborder. a andsetoffinthedirectionof

hotspot.Shatteredafterthelong ﬁ

ce. Hepliesmewith ﬁ

- Alexander Büchler- rst taskisto ﬁ

a, Imanageto - KayKrüger ﬁ nd ﬁ

fi a the have been no signi respectively (Source: Gotmar). wine and spirits accounted for a mere 4.3% and 2.6% beverages sector, beer takes a clear lead with 19.6% whilst 5.1% (coffee 3.9%, tea 1.2%). As regards the alcoholic tea 1%, milk and dairy drinks 6.7% and, for hot drinks, water 26.9%, cordials, juices and sports drinks 9.7%, iced consumption of non-alcoholic beverages: CSDs 24.1%, 2560.2 million litres (Source: Gotmar) Chart 1: Overall consumption of beverages in 2010: approx. banner Kormevski and Lidija Velcheva with the Go to Brau Beviale (from left to right) Dimo Golev, Kay Krüger, Zdravko From drawingboardto Gotmar (Source: Euromonitor International) Chart 2: Market size / total volume over the past years aeois20 0921 2011 million litres 2010 Soft drinks in in tonnes 2009 Hot drinks million litres drinks in 2008 Alcoholic Categories As far as market size is concerned chart 2 shows that there As far as market size is concerned chart 2 shows that there In 2010 the fi last four years. PETplanet insider Vol. 13No.09/12 www.petpla.net 7646 7587 7635 17,836.60 17,643.50 17,538.70 17,684.60 gures shown in chart 1 emerged for the ,8.01387 ,1.01,337.50 1,315.70 1,368.70 1,385.90 8. 8. 8 682.9 680 689.4 683.6 fi cant changes in the various segments in fi nished product account cost structures, has Electric etc. like ABB, Liebherr, Schneider for well-known manufacturers ing engineering components the division for manufactur- arations in 2002 and, in 2005, household and cleaning prep- the manufacture of bottles for from a Chinese manufacturer), those days still on a machine PET preform production (in its existing portfolio. In 1998 added other departments to 1997 expansion, the company bottles. With the move and the edible oil in PVC and PVC began with the production of TPE, PP and HDPE. PA 6 and PA 66, ABS, SAN, using materials such as PS, parts for (e.g.) refrigerators for electronic switches or large themselves e.g. micro parts technical plastic components as well as manufacturing the technical plastic components of moulds for packaging and in the precision manufacture ments at Gotmar are engaged wasn’t enough: other depart- and containers. And, as if that packaging, cosmetics jars food, such as e.g. cosmetics beer and spirits, plus non- non-CSD, dairy products, tors, as well as water, CSD/ caps for a wide range of sec- of high quality preforms and goes in for the manufacture imagine, the company also bottle format you can possibly production of practically any uct samples. In addition to the display cases with their prod- direction of the array of glass demand for packaging“, explains Mr. Golev, glancing in the ian market is something really special in relation to the it comes to matters of plastics processing. “The Bulgar- quickly realise that Gotmar is an absolute all-rounder when showroom and a meeting room at the same time, you will for reasons of expansion. Looking at what is actually a present location at Saedinenie. The company moved here plastic parts for industry and household equipment Zdravko Kormevski, responsible for the production of Velcheva,Lidija Assistant Dimo Golev, Production Manager Preforms Sector, We met PETplanet insider Vol. 13No.09/12 www.petpla.net Innovation, taking into launch in 1992 Gotmar’s Gotmar was established in 1992, quite close to its Q Q Q Q 6JG-*5+PPQƂNN)NCUUOCEJKPG 6JGVTWORECTFKPCP[ƂNNKPINKPG (CUVENGCPKPIVJCPMUVQEQPUKUVGPVJ[IKGPKEFGUKIP /WNVKRNGCYCTFYKPPKPIQRGTCVQTRTQORVKPI 'PGTI[GHƂEKGPE[CVVJGJKIJGUVNGXGNs6¸8EGTVKƂGF $GPEJOCTMKPƂNNKPIVGEJPQNQI[ ning. In 2000 Gotmar was the been a guiding principle for Gotmar right from the begin- facture, tools from Hofstetter and Sipa are used. Around as Netstal, Biraghi, Engel and Krupp. In preform manu- mar‘s array of machines, consisting of global players such through to 19l containers. Similarly impressive is Got- and manufactures 0.025l bottles for the hotel sector right manufacturing bandwidth featuring 5g to 670g preforms whilst retaining existing stability and quality levels. for reducing the weight of the bottom section of preforms of a similar size. In 2002 the company developed a method produce 5l bottles from a preform that was, in those days, In the PET sector the company has today arrived at a fi rst supplier in Bulgaria to $TCW$GXKCNG s0QXGODGT*CNN5VCPF 'ZRGTKGPEGQWTKPPQXCVKQPUNKXG -*5+PPQƂNN)NCUUD[XKUKVKPI YYYMJUEQOINCUUQT .GCTPOQTGCDQWV UECPVJG34EQFG

35 EDITOUR REPORTS 36 EDITOURS REPORTS beverages and food but also for non-food items. the PET sector playing a decisive role here, not only for fi pany but also to the machines themselves. Mr. Dimitar Spasov applies this maxim not only to the com- “Always in Motion“ is, if anything, more than appropriate. plays a signi A high level of commitment to health and safety at work grated Management System and environmental protection. various ISO certi opment, evidence of which is forthcoming in the shape of sector and in matters relating to sustained corporate devel- blazer in a number of areas, both in the machine building growth. Since its establishment in 1990 it has been a trail- this family operation which has experienced tremendous Manager. introduced to Mr. Dimitar Spasov in his capacity as Project into a large conference room where, a short time later, I am maker Index-6. CEO Mr. Petar Spasov who escorts me Dimitar Spasov, Project Manager Petar Spasov, CEO We met: Dimitar Spasov on the stairs in front of the Index-6 Slogan Perpetual motion Index-6 with the idea, Gotmar transforms it into a product. remain true to its precept: it is the customer who comes up customer is concerned. And, otherwise, Gotmar intends to which will mean considerable cost savings as far as the Golev, the company is targeting a new lightweight preform Turkey. as (e.g.) countries of the former Yugoslavia, Greece and being spread over both inland and foreign customers such Trade, located on the same site, with the remaining 60% products are supplied to the bottler Nova 40% of Gotmar’s lling and closure lines right through to the labelling line, With six employees and starting with the design and Index-6 has specialised in the production of complete Later that afternoon I get to know a great deal about I have been invited to the town of Plovdiv for Machine As far as the future is concerned, according to Mr. fi cant part. For this reason the Index-6 motto fi cations of Quality Management, inte- www.gotmar.com in Bangalore. It is the company’s proudly informed of a plant that is currently being installed Europe and, while I am still inspecting the markings, I am exported machines, a considerable number go outside ing pennants, I am unsurprised by the fact that, out of the motion“. well-priced ultra-clean line. True to their motto: “Always in promotion of an extremely high quality yet nevertheless ciency. The Spasovs are paying particular attention to the well as healthy growth and a continuous increase in ef consistently very high machine quality and sustainability, as sented in 32 countries. continues. Since then Index-6 has gone on to be repre- the impression is all that has happened here since the sale of will doubtless not be the last. What really makes a striking Glimpse of Index-6 Showroom staff and reward achievements. improvements on board and they give due credit to the to promote this, for example by taking suggestions for i.e. happy, motivated employees. At Index-6 they do a lot which is also an integral part of the company philosophy, commitment and that the staff enjoy their work, something it is immediately clear that the team demonstrates a clear import and export procedures for machine parts. extra time savings are possible as regards the handling of And, as a result of Bulgaria’s admission to the EU in 2007, export, this is where 90% of the company’s workload lies. Dimitar Spasov tells me that Index-6 focuses mainly on lines are set up for both testing and display purposes. room, a production hall in which some of the production 15mm. Later I am shown into a kind of oversized show- is capable of cutting steel up to a maximum thickness of machine which has been subsidised by the EU and which sort and am totally fascinated by a large Lasermax cutting area of around 20,000m than 180 employees and occupies factory premises with an Index-6 has, in the meantime, built up a workforce of more manufacture of machines for the preserves industry, When I subsequently catch sight of a world map sport- The company’s vision of its corporate future envisages I fi rst machine to Turkey over 15 years ago and the story fi nd myself in front of CNC machines, tools of every PETplanet insider Vol. 13No.09/12 www.petpla.net 2 . On my way around the premises fi rst line in India and www.index-6.com fi - the engine oil caps. far as this is concerned, a particular feature in Romania is also offer closures sourced from the remaining locations. As the global presence of Bericap the national company can Starbev, URBB and Albacher are some examples. Due to worked hard to acquire a respectable share of the market. caps. Plus, where beer is concerned, the company has also closures and a signi has a leading market share under its belt for edible oil the company being in its infancy, Bericap Romania already in portfolio.” says Managing Director Tiberiu Bako. Despite tinational soft drink bottlers and beer producer are already tion to offer competitive tenders along with the others. Mul- because we are locally placed, that we are really in a posi- contracts over several years which means that it is only now, one major brand or another. “The major brands award their the country, although there continues to be an absence of also been successful in acquiring some new customers in launch of Bericap’s latest baby in 2008. Since then it has a gift of the customers located in Romania. This marked the present to the new company, Bericap Hungary also made it a 100% -owned subsidiary of Bericap Hungary. As a birthday Tiberiu Bako, Managing Director We met: Double digitgrowth Bericap Romania PETplanet insider Vol. 13No.09/12 www.petpla.net Auxiliary equipment Bericap Romania is just four years old. The company is for plastics processing. fi cant market share for water and CSD it hopper. Don’t call STAND 519 HALL 7A

designed by Moretto advantage and satisfaction of the customers. advantage and satisfaction of the customers. been converted globally by the Bericap Technical Service to the bleSeal SuperShorty closure range more than 120 lines have the introduction of the PCO 1881 neck and the Bericap Dou- team for its customers, if they wish to switch to the 1881. Since an on-site advice and consultancy through its technical service of lightweight bottling. As a special service, Bericap maintains so the Romanian market will soon be getting its have been arrived. The contracts have already been negotiated machine hall. already in situ in the further machines are the connections for down. In any event, growth will slow anticipated that this to date, it may be already achieved high market shares Because of the rates everyyear. double digit growth in recording strong plant has succeeded in Romania, the is slightly depressed market for beverages In January two moulds for the lightweight 1881 closure In January two moulds for the lightweight 1881 closure Although the 7 patents for unlimited advantages: the choiceisyours. exact treatment time for apolymer. we have improved thematerial flow insideit,fixingthe Now we know whathappensinsidethe and hopper the processaccording to the resultto beobtained. amachine, hasbecome itisable toThe hopper control Conventional Drying system Conventional Drying FLOW MATERIAL we’ve gotthesolution. don’t worry, internal materialflow, This isyourhopper the Bericap Romania Plant Dracula, here against the backdrop of The Editourmobil in the land of Count Original Turbo eXchanger www.moretto.com www.bericap.com ﬁ rst glimpse glimpse rst

7EV

37 EDITOUR REPORTS 38 PREFORM PRODUCTION fl look at some of the trends that may feature as far as the Publications, Nuremberg. We would now like to take a B1 drinktec in cooperation with Dr. Harnisch International cepts: the “Special Area New Beverage Concepts” in Hall special exhibition area dedicated to New Beverage Con- centre from September 16 to 20, 2013, there will be a At drinktec 2013, taking place at Munich´s trade fair avours and beverage ingredients are concerned. New waystonewbeverageconceptsatdrinktec2013 The taste of nature tasteof The innovative drinks. area enabling on the spot sampling of Beneo. The area has its own catering Jens Böhm, Marketing Manager for offer nutritional bene they are natural products that also that rate highest on this criterion, as ginseng or Palatinose (Isomaltulose) and crash’ effect. It is ingredients like energy, avoiding the so-called ‘boost cepts that release a steady supply of increasingly focusing on drinks con- boosting products: “Consumers are ideas for a better balance in energy- ingredients, will be demonstrating Beneo, manufacturer of functional raw materials, additives and agents. in the exhibition section featuring designated and designed area located foods. But what exactly do we mean foods. But what exactly do we mean development of beverages and liquid supreme imperative governing the Sweet =Good New beverageconcepts The Special Area is a separately A good taste has always been the fi ts,” explains ts,” PETplanet insider Vol. 13No.09/12 www.petpla.net sweeter than sugar, and calorie-free. steviol glycosides are up to 300 times of a plant named stevia rebaudiana, on stevia. Obtained from the leaves drinks using new concepts based foremost enables the sweetening of as a food additive (E 960) The EU approval of steviol glycosides all the way to brand-new alternatives. sports use and classics like sucrose sugar, special sugar combinations for blood sugar-neutral substitutes for eners through natural and almost Hall B1 range from calorie-free sweet- These subcategories represented in diabetes, glycaemic index or ‘natural’. labels such as obesity, dental health, These concerns come with category motivating alternative approaches. keep emerging, as do new concerns sumer lifestyles, new requirements partly as a result of changing con- it” response, deep inside us. However, almost automatically trigger that “I like of East Africa. Sweet foodstuffs thus since our primeval forebears came out ‘good’, and probably has done ever all. For example, ‘sweet’ stands for taste becomes a complex matter after into an overall judgment. memories, which our brain processes sense impressions trigger emotions or incomparably more sensitive. All these from the eyes and the nose, which are Everything else about ‘taste’ comes sour, bitter, salty and satisfyingly meaty. precisely ‘taste’ itself? The tongue can distinguish by ‘tastes good’, or indeed by the word It’s because of the emotions that fi ve types of taste: sweet, fi rst and rst it is worth remembering that, for very the aroma takes its name. However, on the source fruit or plant from which trend is to concepts based exclusively elderberry.natural Among beetroot, red cabbage, spinach or ing extracts again are derived from of blue pigment. Other pigment- microalgae are a natural source has also been found that include chlorophyll and carotene. It ples of well-known natural pigments of headline theme dominating the world feel.” the sensory parameter of body/mouth of sweetness, but also in particular to pay attention not only to the proper sugar-reduced products we have to of sweetness, with sugar-free or substitutes. As well as the property develop sweeteners and other sugar used or combined with each other to a whole variety of substances can be Ingredients, points out: “These days tor, Tate & Lyle Speciality Food Marketing & Communications Direc- story, as Caroline Sanders, Global coconut water. extracts or – distinctly more exotic – sweet drink bases such as malt red cabbage Colouring fromspinachand at visitors to drinktec can A further interesting option, on which PETplanet insider Vol. 13No.09/12 www.petpla.net fl fi avours and colourings. Exam- rst hand, is the use of naturally Naturalness is also currently the But sweetness isn´t the whole fi nd out more Spirulina fl avours the avours also contain no sulphur dioxide.” colourings in terms of stability. They superior to other anthocyanin-based pigmenting concentrates are now ager Colours for DöhlerGroup. “The tian Benetka, Senior Product Man- from the black carrot,” says Chris- ing development of the new red tones and stability were the objectives driv- “Brilliance of colour, natural sourcing representative keeping-quality tests. sensory analyses and, not least, built up through trial production runs, resource of specialist knowledge, developments is thus always a deep tolerance. The prerequisite for new of storage life, temperature or pH used may prove less stable in terms natural environment, or substances colours are just not provided by the ingredients are far-reaching. Certain fl the switchover to natural sourcing for Naturalness andtechnology interest to the milk industry or nut. These are fl cappuccino, walnut, almond, caramel be natural ‘brown’ ries. Also represented at drinktec will produced exclusively from strawber- match the demand for natural ries would be nothing like enough to the entire world harvest of strawber- other natural sources. For instance, have to be made or harvested from good reasons, some avours, colourings and key functional The technological implications of avours of particular fl avours like toffee, www.drinktec.com fl avours do avours . fl avours

39 PREFORM PRODUCTION 40 CAPPING / CLOSURES band on the bottle finish. band with ribs to position the locking tures a continuous conical locking ishes. This tamper evident band fea- ible with current market bottle fin- has a tamper evident band compat- of the system work together in har- tion flow to ensure that the elements runner heaters, and the barrier injec- the E-Drive pin positioning, hot grated Iris control system controls actuation system. The single inte- the valve pins using the E-Drive E-Multi unit, and the positioning of technology, precise control of the using proprietary iFlow manifold rial into all parts equally is achieved filling of 3-5% barrier-layer mate- of the two melt streams. Balanced control of dosing, flow and pressure obtained by precise, integrated CO water and tea that need oxygen or like carbonated beverages, juices, piece cap ideally suited for products new approach produces a single monolayer polypropylene cap. The resistance to permeation than a Design bypurpose with a co-injected barrier (Figure 1). meation. Mold-Masters’ latest co-injection development now enables caps to be produced able emphasis and development on beverage containers in recent years to reduce this per- products has a negative impact on product quality and shelf life. There has been consider- The permeation of oxygen into beverage containers or carbon dioxide out of carbonated under control Barriers Co-injection keepsoxygenatbay support on the sides, a plug seal, and a co-injected 0,1mm oxygen and CO Fig. 1.: This 38mm hot 2 These co-injection results are This barrier has 30 times more barrier protection. The cap also ﬁ ll polypropylene (PP) beverage closure includes a tamper-evident band at the bottom, a locking band, bottle ng a- - o

section of the part. in the direction of fl paths together and allows for on-the- Iris nozzle design merges the two melt Fig. 2: The Iris co-injection system: The for on-the-fly control of the barrier two melt paths together and allows The Iris nozzle design merges the through a single gate (Figure 2). injection flow paths and delivers it ously in the primary and secondary design moves the melt simultane- pending Iris co-injection system multi-material application. ing a mono material machine into a ise existing machinery by convert- unit also allows moulders to revital- mony. The E-Multi auxiliary injection y control of the barrier position both The proprietary and patent- fl ow and in the cross 2 barrier layer made of EVOH (illustrated here in blue). parts at a cycle time of less than 5s. polypropylene (PP) closure produces co-injected Fig. 3: The 16-cavity Iris system for 38mm hot PETplanet insider Vol. 13No.09/12 www.petpla.net and CO container with an integrated oxygen hot fill HDPE cap for a beverage that are a tamper evident, liner-less, mould (Figure 3) produces the parts a c h t m Beverage barrierclosuresB e ing in a very balanced thin layer. 16 cavity production mould is result- injection of 3 to 4% barrier into the or mould a liner. The simultaneous ing a secondary operation to insert used directly as opposed to need- in a simpler cap design that can be encased in its centre. This results are moulded with barrier technology co-injection technology such caps EVOH. Using Mold-Masters new Iris The co-injected barrier material is locking band on the bottle finish. cal locking, with ribs to position the The band features continuous coni- with current market bottle finishes. tamper evident band is compatible ever before. streams to a greater degree than control what is happening in the melt ler, the moulder can observe and With a single integrated control- and in the cross section of the part. position both in the direction of flow A recently showcased 16-cavity 2 barrier. The patent pending, fi ll ll Iris co-injection is achieved via the combination and integration of Mould mounted TempMaster M2 cycle times and precise cavity E-Drive iFlow Iris Masters: Iris co-injection system produces a and glues in thin-wall containers. The layer structures that require tie layers to use thermoformed fi equipment. It also eliminates the need in closures by secondary processing injection application of barrier liners multiple injection systems and post- Masters provides an alternative to function. weight, fast cycles, quality and higher systems to be optimised for lighter design approach allows the closure handling system. This coordinated available to be integrated into the parts innovative barrier veri have barrier all across the bottom an rier. To ensure that 100% of the caps dented precision and control of the bar- both injection units creates unprece- gate function, manifold heating and the threads. Tight integration of valve the closure but does not extend into needed. The barrier covers the top of a cap with the barrier only where it is trol of the hot runner system produces design. The precise operation and con- in a simpler, cost effective, robust cap ations to insert or mould a liner results Sustainable technology cooling 5. Advanced 1. System overview PETplanet insider Vol. 13No.09/12 www.petpla.net compact co-injection nozzle With the new technology, Mold- The elimination of secondary oper- manifold technology that combines melt streams and provides balanced

valve-gate control of the opening and closing movements of the servo-actuated valve-gate pins to achieve fast E-Multi auxiliary injection unit located close to the gates

hot runner temperature control fi 2. E-Multi and E-Drive ve- or seven- cation system is Integrated Control fi ll 6. Part improvements canned goods, and as a replace- packaging, baby food, coffee beans as diced fruit and pudding, pet-food age closures, packaging for food such suited to producing hot Market potential higher value recycling waste streams. tainers can be deposited into existing percentage of barrier (<5%). The con- elimination of tie layers and the low ity of the part is also improved due to oxygen or other gases. The recyclabil- offering 30 times the protection against EVOH barrier the implementation is that with an injection moulded part and parts that have foil or label barriers is over typical thermoformed thin-walled with integrated barrier. Advantages thin-wall, deep draw food containers tion for the Iris technology include less plastic, energy and water. have a greener production line, using cooling technology makes it possible to barrier technology with the ef injection. The combination of using the sequential injection or multi-material taneous co-injection, different from advancement represents true simul- net-shape part with no web scrap. The The co-injection technology is well Other typical co-injection applica- 3. Two melt streams fi lled bever- lled fi cient cient fi ve key technology elements supplied by Mold- , fi ll 7. Resin cost savings applications. By combining re-purpose it for much higher value their existing machinery capital and April this year. Moulders can now take introduced at the NPE show in early components. The Iris technology was medical parts and other high-tech ment for current packaging used for down to new thresholds. weights and bring moulding costs This allows moulders to reduce part comparable systems in the and 25% faster colour changes than drops, greater than 90% systems have 10% lower pressure iFlow manifold technologies. Sprint tip design coupled with Mold-Masters Sprint system uses a unique nozzle for cycles between 3 and 6s. The beverage closures hot runner system new pace by purpose engineering a moulding machine. co-injection on any modern injection- and control system to implement provides the entire melt distribution valve gate movement), the system unit, temperature control and precise design, portable auxiliary injection technologies (melt distribution, nozzle 4. iFlow manifolds Mold-Masters has also set a www.moldmasters.com fi ll balance ll fi fi ve key ve eld.

41 CAPPING / CLOSURES Tradeshow

preview October 28 -31, 2012 Chicago, Illinois

AGR South Hall 661 South Hall 1566 New inspection capability CSI Capping solutions Agr International, Inc. has expanded its OptiCheck product line to include a sidewall module speciﬁ cally designed to meet the inspection requirements of PET and transparent containers. This system takes into considera- tion the day-to-day variations in the production of plastic containers while maintaining the versatility to deal with fre- In addition to a number of capping equipment products, quent product change-overs Closure Systems International will be featuring several and limited line space. The caps and closures, including (but not limited to) the light- transparent sidewall module weight Extra-Lok V 38mm OD and SP38D-ML Xtra-Lok utilises four cameras that are strategically located to facili- mini S 28mm and Econo-Lok mini 28mm . tate full 360° imaging of round and non-round containers in Xtra-Lok mini ‘S’ 28mm closure for the short-height a range of sizes. LED back lights, in combination with high carbonated soft drink bottle ﬁ nish features a lightweight precision cameras, provide clear images for analysis. The design that delivers improvements in packaging cost and

OptiCheck system is also available with modules for fi nish sustainability, CO2 performance, and impact resistance. measurement and gauging, seal surface inspection, sidewall Econo-Lok mini is an ultra-lightweight 28mm linerless and label inspection, and base inspection of opaque contain- closure with 1881 short neck fi nish designed for use on ers. The modular approach permits Agr to confi gure the Opti- both CSD and bottled water. This closure is engineered to Check system with the appropriate combination of modules to meet all standard performance requirements for CSD and meet the inspection needs of a specifi c production line in the bottled water applications, while weighing less than 2g. It most economical manner. can be used on PET package sizes ranging from 250ml to www.agrintl.com 3l bottles. The cap is made of organoleptic resin material that meets sensory protocols for sparkling beverages and

waters. It has a robust seal that meets all CO2 perfor- Gernep Booth E-7717 mance requirements and has a patented secure tamper evidence system. Labelling combinations The 38mm aseptic SP38D-ML closure is designed for the dairy market which can be applied either to 1842 Gernep, supplier of rotary labelling machines, offers vari- HDPE bottle fi nish or 1845 PET bottles. This closure has a ous labelling systems which can be combined on one Gernep moulded in-shell liner which eliminates the need to use an machine.The rotary labeller Labetta-SK has special servo induction foil seal and also provides excellent liquid reseal drives located at the self adhesive dispenser Innovative and after the product is opened for the fi rst time. exclusive label designs as well as no-label-look and water www.csi resistant plastic labels can be processed. Compared to wet glue labelling systems changeover times, as well as cleaning and maintenance works are obviously shorter. For wet glue labelling Gernep provides the labelling machine of type KHS South Hall 812 Labetta. The overlay gear of the wet glue aggregate allows precise label adjustment along with individually adjustable Roll-fed labeller glue segments. KHS AG will be presenting its Innoket 360 roll-fed label- With the Combi series, due to the compact arrangement ler. Focus of the machine is on ergonomic and cleaning- of several different labelling systems, almost every label friendly, hygienic design on which all machine parts are outfi t can be realized. Labetta and Combi can be equipped easily accessible for operators: changeover and mainte- with mechanical or photo electronical container orientation nance times are thus reduced to a minimum. Signifi cant systems. The machines can additionally be equipped with features are cutting technology with self-sharpening cutter, (wet glue or self adhesive) guarantee seal labelling in L- or segmented vacuum drum and a gluing system based on U-shape. Alternatively, all types of Gernep labelling machines the principle of induction. At one of its fi rst reference cus- can be equipped with servo driven bottle plates for labelling of tomers, the Heil- und Mineralquellen Germete GmbH (spa various container formats. The servo controlled bottle rotation and mineral springs), the Innoket 360 has labelled more offers an especially high fl exibility. than 20 million bottles since 2008. www.gernep.de www.khs.com

42 PETplanet insider Vol. 13 No. 09/12 www.petpla.net bowl hopper has been applied to all screw feeders of K-Tron multi- feeders through this operator interface. The patented on the WKC-HMI or input the technological recipe of the The loss-in-weight feeders can input the feeding set value of pellets and powder with a feeding accuracy of +/-0.5%. various materials such as pellets, powder, or the mixture in-weight feeders and weigh belt feeder. It is able to feed includes single, twin screw, liquid, micro and vibratory loss- tion led by loss-in-weight controlling technology. This system the consumer. new line, for bottlers; and an easy opening and closing to owners; simple conversion of existing equipment for the product offers an attractive and functional design to brand membrane below the overcap. Bericap claims that the new It features post-opening breaking bridges and a tear-off printing, as well as ef the traditional Galileo look but also allows large-surface for syrups aimed at children and young adults. It maintains oil, vinegar and traditional syrups markets, is also suitable fi to a Verplast 29/21 neck ing closure, designed to 29/44 long-skirt dispens- company’s new LSK EV ogy is the base for the hinge closure technol- lished Galileo moulded cavity machine at a cycle time of around 7.2s. that produced a still water preform weighing 15.8g, in a 128- than 1g. The company presented a system at Chinaplas with 1l juice bottles achieved a weight reduction of more improved wall thickness and material build-up. Initial tests says that its technicians have exerted more in have to heat a thinner wall. During development, Netstal larger surface area, the UV lamps in the blowing machine the base area more speci subsequent blowing process, this effect can be used to heat be obtained in the base area. Netstal claims that, during the contour through the blowing process, a thinner wall can also changed for the fi both the base contour and, thus, the surface area can be after the injection moulding process. This means that cation) the preform is blown out in the base area directly the Preblow process (which is the subject of a patent appli- reduce cycle times and improve moulding quality. During company says that this process, named Preblow, helps to ing phase with a blow-out process in the base area. The PET-Line Calitec system, with the extension of the cool- Loss-in-weight controllingtechnology Longskirt dispensingclosure for reducedcycletimes Preblow process PETplanet insider Vol. 13No.09/12 www.petpla.net nish. The new design, which is aimed at premium edible Wuxi K-Tron colormax Co., Ltd. offers a feeding solu- Bericap’s estab- Netstal has announced a further development of its the rst time. By increasing the size of the base fi cient tamper-evidence performance. fi t fi cally and more ef www.bericap.com www.netstal.com fi ciently. With a fl uence and uence 1-30 L/H with accuracy materials in the lower output range. Feeding rate can be ing of pellets, granules, free is designed to provide high accuracy to loss-in-weight feed- steel material. The Wuxi K-Tron Micro Loss-in-Weight feeder All of the contact parts of the feeders are made of stainless tions to the screw and effectively avoids material build-up. Colormax. It allows the material to all production ef accountability purposes, which contributes further to the over- All material consumptions are logged for traceability and anticipation of the next automatic self-cleaning feature which is initiated in blender’s ing it off to its respective machine. Another feature is the the required job recipe, mixes the material, before convey- machine requests a material entered into the TSM central blender control panel. When a no longer necessary. Individual material recipes are simply advantages as gravimetric blenders for each machine are line blending to feed multiple machines. This has many cost offers several advantages such as the use of centralised off- with total automatic cleaning between recipes. The design and can supply any number of machines at any given time blender can handle up to 12 individual material components in a high throughput gravimetric blender. This gravimetric to centrally locate the blending of all materials and recipes Centralized off-lineblending perature. the air regulator, ally no maintenance. To operate it, the user simply adjusts dryers. With no desiccant or moving parts, they require virtu- they consume far less electricity than most conventional dryers require 220v power and ing throughputs under 22.5kg/h (50lb/h), these easy-to-use pressed-air dryers. Targeted at drying applications requir- memory for instant recall. ture or ambient conditions. Settings can also be stored in of throughput changes or variations in material tempera- tain a stable temperature within the drying hopper regardless quality optimum conditions while saving energy and producing high- added to the bed of material in the drying hopper to maintain from the Conair Drying Monitor. Just enough heat energy is temperature, but also dew point and air View dryer control (Siemens platform) regulates not only air 5000lbs/h). In the so-called Optimizer Mode, the new Touch- throughputs between 182kg/h and 2273kg/h (400lbs/h and Stage (ES-1) drying systemfrom Conair are available for Drying andmaterialhandlingsolutions TSM ’s multi-blend system TSM3000 allows the end user Other Conair drying solutions include the SlimLine com- Polymer dryers, including the EnergySmart Single- fi nished products more ef fi ciency. fl ips a switch, and sets the processing tem- ≤ fi ll request or masterbatch change. +/-2%. fl owing powders and other bulk fi ll, the TSM blender prepares fi ltered compressed air, so www.ktroninternational.com fi ciently. The controls main- fl ow evenly from all direc- www.conairgroup.com fl www.tsmcontrols.com ow based on data

43 PRODUCTS PETbottles Beverages + Food

Romanian beer When Heineken enrolled PET Engi- neering in the re-launch of Silva, the best-known Romanian beer brand, the Saladalad ddressingressing objective was to create a packaging with a premium identity, while retaining the UK supermarket chain Asda, part of US company essence of its land of origin. The new Wal-Mart, is launching a new range of Chosen by You Silva is presented as a fusion of tradi- branded salad dressings in a new 250ml PET bottle, tion and modernity, ‘made in Transylva- designed and produced by Appe. The new bottle is nia’. The connection with the history of 90% lighter than the glass version it replaces, which the region can be seen in the main logo, represents a saving of around 200t/a of packaging and which recalls a traditional bird-based offers improved transport effi ciencies, reduced costs coat of arms, which is complemented by and lower carbon impact in the logistics chain. Its high the bottle’s distinctive and recognizable shatter resistance is claimed to eliminate breakages shape. The container is designed with a during fi lling and distribution. The bottle is the fi rst of its tapered centre, with labelling at the neck kind for private-label salad dressings in the UK. It was and towards the bottom of the bottle. designed at Appe’s design facility in Brecht, Belgium, and is manufactured by the two-stage process at the com- www.petengineering.com pany’s Gresford factory, near Wrexham, N Wales. Appe’s technical team worked closely with the closure supplier in the development, piloting and testing of the design to deliver a complete solution to the customer. The dressings are being manufactured and packed by one of the UK’s leading suppliers of table sauces, salad dressings and chutneys. www.appepackaging.com

Iced coffee from Müller The Alois Müller dairy has recently been selling a new product as part of its chiller range. The product, which is available in three variants, is made from milk with a shot of coffee. The caffeine content is equivalent to the taste of one to three cups of Espresso. Prior to consumption, the chilled product needs to be shaken until it foams. The product is packaged in a handy 250ml PET bottle. The sleeve-wrapped bottle is sealed with a colour-matched screw cap complete with tamper-proof strip. www.muellermilch.de

Engineering made in Germany Patent pending: MHT coolMAX® post mold cooling

Make the most of your machine - with a high offer an upgrade set for 33% more preforms, without cavitation mold from MHT! reﬁtting on the machine! 60 cavities for Netstal PETline 2000 For many machine types, we supply the mold with • • 96 cavities for Husky HyPET 300, 128 for HyPETET 400400 the highest cavitation, thereby enabling optimum • 112 cavities for KraussMaffei 350 preform output. For the Husky HyPET machine, we

44 Dr. Ruben-Rausing-Str. 7 | D-65239PET Hochheim/Mainplanet insider Vol. 13 No. 09/12 www.petpla.net MHT MOLD & HOTRUNNER TECHNOLOGYOLOGY Tel. +49 (0) 6146-906-0 | www.mht-ag.de easy opening. proof screw cap that makes for closure is an easy to hold tamper- to resemble a belt. Featured as a paper label which is printed so as tinted bottle sports an all-round fair. The unusual shape, light blue timed to coincide with a fashion water in a promotional campaign 1l PET bottle for sparkling mineral showcased a special version of its Mineralwasser AG, Vöslauer Special editiondrinks New shapebottle the top half of the bottle and sporting coordinating printing. 1.5l PET bottle with the shrink sleeve label stretched over PETplanet insider Vol. 13No.09/12 www.petpla.net The Austrian company,The Austrian www.voeslauer.com www.pfanner.com nut from Volvic in lime and coco- well-known 1.5l PET bottle rent examples of this are the and entice them to buy. Cur- the curiosity of the consumers tity are calculated to awaken tions in terms of time or quan- editions and subject to restric- marketed as limited or special These beverages, which are featuring an exotic appeal. are sometimes compositions the theme of taste in what producing new variations on constantly developing and vanilla Ice Tea with strawberry and The drinks industry is fl avour and the Pfanner fl avour in the waisted,  www.volvic.de round off the presentation at the POS. sleeve label and a blue screw cap with a 500ml content. A shrink-wrap is packaged in a waisted PET bottle sport. The fat- and gluten-free product promote physical regeneration after content. The product is intended to protein drink with a 55g milk protein marketing a chocolate Aktivkost GmbH of Hamburg are brand name of “Champs Sportsline“, need additional protein. Under the formance sportsmen and –women Sports drink To support a balanced diet, per- www.champ-sportsline.de brand logo. an embossed seal incorporating the proof seal, reinforcing grooves and transparent screw cap with tamper- uct features a paper body label, a containing the slightly tinted prod- Aloe Vera and Taiga Root. The bottle health-promoting additives such as fl calorie soft drink – available in plum are 500ml of “ganicwater” - a low- “Functional“ drink avour, with additional vitamins and fl avoured high avoured Packaged in a 500ml PET bottle www.ganicwater.com

45 BOTTLES PETbottles Home + Personal Care

Exotic shower gel Maag Group is the innovative solution provider for pump, pelletizing and filtration systems. We deliver high-quality com- Palmolive are expanding their range ponents and complete systems, from extruder tips to pelletiz- of shower gels by a variation with more ers. In addition to our primary locations in Switzerland and exotic appeal. The shower gel, scented with Indian mulberry and lotus ﬂ ower, Germany, we have eight sales and service offices around the is offered to the consumer in a waisted, globe to provide our customers with full service par excellence. tear-drop shaped PET bottle containing 250ml of product. The tinted product, the two-tone closure and the multi-lin- gual label design lend the package just the right look.

www.palmolive.com

brands of maag group Scent of spring

Automatik Plastics Machinery GmbH Products scented according to the Ostring 19 ß 63762 Grossostheim ß Germany ß T +49 6026 503 0 ß [email protected] season are an effective way of increas- Maag Pump Systems AG ing sales. One example is the spring ß ß ß ß Aspstrasse 12 8154 Oberglatt Switzerland T +41 44 278 82 00 [email protected] edition of Pril washing up liquid which www.maag.com is scented with magnolia and apple blossom. By way of a container for the slightly purplish-coloured product, the well-known, transparent 600ml PET bottle with its shiny silver push-pull dispensing cap is used. A non-label look label on the front and a paper label at the back take care of the retail information. www.pril.de

Dishwashing liquid in moulded PET bottle

Under its own-label Auchan brand, the French chain Auchan is selling dishwashing liquid with grapefruit and vinegar additives packaged in a 500ml PET bottle which, despite its original shape, is still user-friendly in terms of handling. With a bit of imagination, the shape of the bottle resembles the bird in the lettering which makes up the brand name. A push-pull device, coloured pink, matches the colour of the slightly tinted product. The bottle features just one label on the front incorporating additional information on the inside. The back of the bottle has only a barcode label. www.auchan.fr

46 PETplanet insider Vol. 13 No. 09/12 www.petpla.net dispensed. product and the quantities in which it is to be tic label gives details relating both to the for easier handling and an all-round plas- opening for dispensing the product makes Blink“. A screw-on, green hinged lid with an green PET bottle under the brand name ”Bio the Müller drugstore chain, packaged in a sustainable raw materials is being sold by apple blossom and manufactured using ing shrink sleeve label. feature of the packaging is a match- dispensing operation. A decorative view of the ﬂ interlock and enables an optimum pump dispenser features a rotating pump dispenser. The transparent PET bottle complete with screw-on Mann & Schröder GmbH in a clear marketed by the German company name “natuderm botanics“) is being Gingko and extracts of olive (brand Bio-dishwashing liquidinPET with Ginkgo Nurturing soap PETplanet insider Vol. 13No.09/12 www.petpla.net 500ml dishwashing liquid scented with 300ml of nurturing soap with www.natuderm-botanics.de ow of product during the tion. protects the sprayer against faulty opera- information and a matching coloured cap labels to front and rear convey the retail with a translucent spray device. Plastic foot odour in a transparent PET bottle 150ml content freshness spray to combat Laboratoires Juva Santé is selling a Mercurochrome, the French company Foot deodorant www.mueller-blink.de Under the brand name Laboratoires www.mercurochrome.fr GDXL f finish ini n neck b bottle PCO1 PCO1881 e ott neck PCO1810 O1 neck c s 881 l k e h finish neck fo HR for rH R

47 BOTTLES PETpatents

PET containers International Patent No. Multi-stage opening WO 2012 / 009156 A1 Applicant: Graham Packaging International Patent No. Comp., York (US) WO 2012 / 017934 A1 Date of Application: 28.6.2011 Applicant: Tetra Laval Holdings & Finance S.A., Pully (CH) Extrusion blow moulded bottle in PET Date of Application: 29.7.2011 with integrated handle. The design of the chamfers and radii is shown. The top side of the packaging for a beverages carton incor- porates a closure with a multi-stage opening facility. A small opening can be selected for a straw or a large one for pour- ing out the contents.

Additional security Angled neck using cap

International Patent No. International Patent No. WO 2012 / 012715 A1 WO 2012 / 022475 A1 Applicant: Abbott Laboratories Abbott Applicant: SHB GmbH, Crailsheim (D) Park (US) Date of Application: 17.8.2011 Date of Application: 22.7.2011 The manufacture of PET bottles with a In order to provide better protection for the curved external shape (e.g. for WC clean- use-by dates applied to the container, the ers) is time-consuming and hence associ- sleeve label is subsequently pulled over it. ated with increased production costs. In This means that the information, which is order to reduce these, mounting an appro- applied using ink, cannot be readily wiped off priately curved adapter on a “straight” or manipulated without previously destroying bottle is suggested, on which the screw the label. closure is ﬁ tted.

Closure system Container fabrication Disclosure No. International Patent No. DE 102009002074 A1 WO 2012 / 013188 A2 Applicant: Henkel AG & Co. KGaA, Applicant: KHS Corpoplast GmbH, Düsseldorf (D) Hamburg (D) Date of Application: 1.4.2009 Date of Application: 26.7.2011 Design and operation of a container clo- The design and the procedure for manu- sure which combines the advantages of a facturing a blow moulded container with screw closure with those of a snap-on cap specially shaped grip area are described. are described. Mechanical mounting of the closure is easier and faster and does not present any disadvantages when being handled by the consumer.

www.verpackungspatente.de

48 PETplanet insider Vol. 13 No. 09/12 www.petpla.net Buyer’sguide 1.0 MATERIALS

1.1 Materials for bottle and cap production Gastro PET d.o.o. Kotna ulica 5 BUYERS GUIDE 1.1.9 Additives and colorants GABRIEL-CHEMIE SI-3000 Celje www.corvaglia.ch Gesellschaft m.b.H. (Zentrale) Tel: +386 (0)3 425 80 30 Industriestrasse 1 Fax: +386 (0)3 425 80 31 A-2352 Gumpoldskirchen [email protected] Tel.: +43 (0)2252 / 63 630-0 www.gastropet.si Fax: +43 (0)2252 / 62 725-0 e-mail: [email protected] Americhem Europe Ltd www.gabriel-chemie.com Custom colour and additive CLOSURES | EQUIP | TECH SERV masterbatches PDG PLASTIQUES Pierre Vandekerckhove F-45330 Malesherbes - France www.csiclosures.com Tel.: +44 782 541 9086 Tel. 00 33 2 38 34 61 95 Europe: +34 93 891 62 49 [email protected] [email protected] Global Headquarters: www.americhem.com www.pdg-plastiques.com +1-317-390-5000 HOLLAND COLOURS NV P.O. box 720 7300 AS Apeldoorn, Netherlands 0031-55 3680700 0031-55 3662981 Clariant Masterbatches [email protected] PET Preform (Italia) S.p.A. www.hollandcolours.com Plastic cap and closure Has Plastik San. Tic. A.S. Via Lainate, 26 Rue de la plaine Esenyurt Fabrikalar yolu No: 50 20010 Pogliano Milanese (MI) 47230 Lavardac - France 34325 Avcilar Italy Tel.: +33 (0)5 53 97 41 00 Istanbul, Turkey Tel +39.02.9918.7558 Fax: +33 (0)5 53 65 85 97 Tel +90 212 695 50 00 Fax +39.02.9918.7552 www.sbecm.com Fax +90 212 694 97 24 [email protected] [email protected] http://mb.clariant.it TM www.hasplastik.com M.P.I. Srl Moulds Plus International 15050 Villalvernia (AL) – Italy Tel. 0039 0131 836136 [email protected] Preform manufacturer www.ultrapurge.com 3 Rue de l’île Macé 44 412 REZE France Advanced Colorants and Additives Tel: + 33 (0)2 40 05 09 37 COLORMATRIX EUROPE LTD. Fax: + 33 (0)2 51 70 00 55 Knowsley Business Park, [email protected] Knowsley, Merseyside. www.sgt-pet.com Georg Menshen GmbH & Co. KG L34 9GT. UK Industriestraße 26 Tel: 0044-151 632-8800 Liquid colours and additives D-57413 Finnentrop [email protected] 1.2.4 Caps and Closures Tel.: +49-2721-518 0 www.colormatrix.com REPI S.p.A. Fax: +49-2721-518 198 Via B. Franklin 2 [email protected] 21050 LONATE CEPPINO VA www.menshen.com ITALY tel. +39 0331 819511 fax +39 0331 819581 [email protected] Creative Dispensing Solutions www.repi.it D94078 FREYUNG Tel: + 49 8551 975 234 colorplasticchemie Fax: + 49 8551 975 180 NOVEMBAL SAS Albert Schleberger GmbH 1.2 Packaging components [email protected] 5 route du Pérollier Schlosserstrasse 5 and accessories www.aptar.com 69570 DARDILLY, France 42899 Remscheid, Germany Tel: +33 (0) 4 72 54 96 00 Tel: +49-2191-5619-0 1.2.1 Preforms Fax: +33 (0) 4 72 54 96 95 Fax: +49-2191-54075 www.novembal.com [email protected] www.colorplasticchemie.de PET PREFORMS AND CLOSURES

BERICAP is a globally acting manufacturer of plastic closures with 21 factories in 19 countries. Future Plast Industries L.L.C P.O. Box 341034 Dubai, UAE Tel: +971 4 607 0280 Fax: +971 4 607 0220 www.bericap.com [email protected] www.futurepet.com

PETplanet insider Vol. 13 No. 09/12 www.petpla.net 49 Buyer’sguide Entries from 5,70 Euro/mm, Call +49-6221-65108-0

2.0 MACHINES AND 2.2 Bottle production EQUIPMENT (machines and equipment)

2.1 Preform production (machines and equipment) Eugen Seitz AG No. 688-1, Zhong-shan road, Spitalstrasse 204 Sec. 3, Wuri, Taichung, 8623 Wetzikon, Switzerland 414, Taiwan phone: +41 44 931 80 80 Tel: 886-4-23388289 Nissei ASB Machine Co., Ltd. fax: +41 44 931 80 90 Fax: 886-4-23380219 4586-3 Koo, Komoro-shi, ffi [email protected] [email protected] Nagano-ken 384-8585, Japan www.seitz.ch www.chumpower.com Tel. 0081-267-23-1565 Fax 0081-267-23-1564 Idsteiner Strasse 74 [email protected] D-65527 Niedernhausen, www.nisseiasb.co.jp Germany Tel. +49 6127 8954 + 8850 Fax +49 6127 78189 SIPA S.p.A [email protected] via Caduti del Lavoro,3 Stretch Blow Molding Machines, www.cct-systems.com 31029 Vittorio Veneto, Italy Preform Molds & Cap molds Tel. +390438911511 Tel.: +86-576-84066853 Fax +390438912273 [email protected] [email protected] www.MegaMachinery.com www.sipa.it Bottle-Top Development Co., No. 143-1, Renhe Rd., Nantou PREFORM and CAP Production City, Taiwan 540 Hong Kong Tel: +886-49-2258335 Tel: 852-2665 3888 [email protected] Fax: 852-2664 8202 www.bottop.com [email protected] SMI S.p.A. www.petkamold.com www.chenhsong.com.hk Via Piazzalunga, 30 [email protected] I-24015 S. Giovanni Bianco (BG) Tel. +39 0345-40111 Fax +39 0345-40209 [email protected] www.smigroup.it PETTechnologies Europe

SACMI IMOLA KHS Corpoplast GmbH PET Technologies Europe GmbH www.sacmi.com Meiendorfer Str. 203 Austria 22145 Hamburg Tel.: +43-720-555300 Deutschland www.pet-eu.com 2.1.1 Injection moulding T +49 40 67907-0 machines F +49 40 67907-100 E-Mail: [email protected] Your partner for improvement and www.khscorpoplast.com innovation for the P.E.T. industry Krones®, Sidel®, KHS®, SIPA®, others Wide diversifi ed inventory available www.umallette.com [email protected]

Ferromatik Milacron India Pvt. Ltd. SIAPI S.r.l. 93/2 & 94/1, Phase - I, GIDC Vatva, Norgren AG Via Ferrovia Nord, 45 Ahmedabad - 382 445, Gujarat, Ventilfabrik 2.2.1 Single stage stretch 31020 San Vendemiano (TV), Italy India Postfach blow moulding Tel: +39 0438 4096 Tel: +91-79-25890081 8362 Balterswil, Switzerland equipment Fax: +39 0438 401016 [email protected] Tel +41 71 973 83 00 [email protected]  www.siapi.it www.milacronindia.com Fax +41 71 973 83 01 [email protected] 2.2.2 Two stage stretch blow www.norgren.com/sbm moulding equipment

UROLA S.C. NETSTAL-MASCHINEN AG 20230 Legaz pi, Spain Tschachenstraße Tel. + 34 943 737003 8752 Naefels, Switzerland SACMI IMOLA Amsler Equipment Inc. Fax + 34 943 730926 Tel. 0041-55-618-6111 www.sacmi.com Swiss Engineered - [email protected] Fax 0041-55-618-6605 Canadian Built www.urola.com [email protected] 1245 Reid St, Toronto, www.netstal.com Canada L4B1G4 Phone 905 707 6704 [email protected] www.amslerequipment.net

50 PETplanet insider Vol. 13 No. 09/12 www.petpla.net 2.2.3 Coating systems 2.2.8 Unscramblers

drying-dosing-conveying-crystallisation Packsys Global (Switzerland) Ltd. Tel: +49 6181 916 00 0 Unscramblers, Silos and Air Phone: +41 55 250 39 00 [email protected] | www.lanco.de BUYERS GUIDE Conveyors for empty plastic bottles [email protected] KHS Plasmax GmbH [email protected] www.packsysglobal.com Meiendorfer Str. 203 www.posimat.com 22145 Hamburg Deutschland T +49 40 67907-102 2.3 Cap production MANN+HUMMEL ProTec GmbH F +49 40 67907-100 (machines and equipment) [email protected] E-Mail: [email protected] www.mh-protec.com www.khsplasmax.com SACMI IMOLA Via Selice Prov. le 17/a 40026 Imola BO, Italy 2.2.4 Compressors Tel. 0039-0542-607-111 Fax 0039-0542-642-354 [email protected] www.sacmi.com Moretto S.p.A. Tel. +39 049 9396 711 BMB SpA 2.3.4 Printing equipment [email protected] Via Enrico Roselli 12 www.moretto.com 25125 Brescia (BS) - Italy Tel.: 0039 030 2689 811 ARIZAGA BASTARRICA Y CIA, S.A. Fax: 0039 030 2689 880 www.abc-compressors.com [email protected] www.bmb-spa.com TAMPOPRINT® AG Lingwiesenstrasse 1 70825 Münchingen, Germany motan-colortronic gmbh Tel.: +49 7150 928-0 Otto-Hahn-Straße 14 Fax: +49 7150 928-400 61381 Friedrichsdorf [email protected] Tel.: +49 6175 792 167, www.tampoprint.de Fax +49 6175 792 284 www.atlascopco.com/petcompressors www.motan-colortronic.com Technologies for closures BORTOLIN KEMO SPA Corso Lino Zanussi 34/B 2.4 Crate production 2.5.3 Dryers 33080 Porcia (PN) - ITALY (machines and equipment) tel. 0039 0434 922010 www.bortolinkemo.com 2.5 Ancillary equipment Oil free compressors for for the production of PET bottle blowing preforms, caps and crates Gardner Denver Ltd. Claybrook Drive, Redditch, 200 West Kensinger Drive Worcestershire, B98 0DS, England Cranberry Township, PA 16066, USA Tel: + 44 (0) 1527 838600 Tel.: +1-724-584-5500 Fax: +44 (0) 1527 838630 [email protected] [email protected] www.cct-systems.com Material Drying and www.conairgroup.com www.gardnerdenverproducts.com Mould Dehumidifi cation Eisbär Trockentechnik GmbH. A-6840 Götzis 3.0 SUPPLIERS FOR Tel.Nr. 0043 5523 55558 0 STRETCH BLOW MOULDS [email protected] www.eisbaer.at AND PREFORM MOULDS SIAD Macchine Impianti S.p.A. Via Canovine, 2/4 Tel.: +49 (241) 9126-0 24126 Bergamo, Italy [email protected] Tel. +39 035 327611 www.intravis.de Fax +39 035 316131 [email protected] Molds, Change Parts, SBM and www.siadmi.com Injection Molding Machinery for the PET/Bioplastics Industries Werner Koch Maschinentechnik GmbH 284 Pinebush Road 2.2.5 Heating boxes for blow NETSTAL-MASCHINEN AG Industriestraße 3 Cambridge Ontario molding machines Tschachenstraße 75228 Ispringen / Pforzheim Canada N1T 1Z6 8752 Naefels, Switzerland Tel.: +49 72 31/80 09 0 Tel: 001-519-624-9720 Tel. 0041-55-618-6111 Fax: +49 72 31/80 09 60 Fax: 001-519-624-9721 Fax 0041-55-618-6605 E-Mail: [email protected] [email protected] [email protected] www.koch-technik.com www.hallink.com www.netstal.com

PETplanet insider Vol. 13 No. 09/12 www.petpla.net 51 Buyer’sguide Entries from 5,70 Euro/mm, Call +49-6221-65108-0

Production of blow moulds and PET mould parts TOOLING PREFORM No.1517, Sec.8, Huanjhong Rd, Wurih tel.: +359 32 606 821 SYSTEMS BV Township, Taichung 414, Taiwan fax: +359 32 606 888 Moulds & Robotics PET Preform and Blow Molds Tel: +886-4-2335-9689 o f fi c e @ i t d . b g PET-related Services for Different Application [email protected] www.itd.bg & Technologies www.passcard.com.tw C. Houtmanstraat 42 Guang Dong Xing Lian Precise Emmen, The Netherlands Machinery Co., Ltd. Tel +31 (0) 591 679768 Baoshi Rd, Xiabei, Pingzhou, Fax +31 (0) 591 630616 Nanhai, Foshan, Guangdong, China [email protected] · www.tps.nl Tel: (86-757) 8677 7168 Fax:(86-757) 8623 3168 E-mail: [email protected] Website: www.gdxl.com www.petkamold.com KHS Corpoplast GmbH [email protected] Meiendorfer Str. 203 22145 Hamburg Deutschland T +49 40 67907-0 F +49 40 67907-100 Single & Two Stage PET Molds E-Mail: [email protected] 33-4, Wonmi-Dong, Wonmi-Gu www.khscorpoplast.com www.wtbvc.com Bucheon City, Kyunggi-Do Korea 420-110 Blow Molds for All Technologies, Tel.: +82-32-663-6377 All Machine Types, All Sizes. [email protected] Highest Quality, Fastest Delivery, www. ksmold.com Lowest Cost. Canada - 905-574-0010 50 Galaxy Blvd. #13 [email protected] Toronto, Ontario via Caduti del Lavoro,3 Poland - 48-81-820-5730 M9W 4Y5, CANADA 31029 Vittorio Veneto, Italy [email protected] P- (+1) 416 213 9400 Tel. +390438911511 UK - 44-1623-658-416 F- (+1) 416 213 9379 Fax +390438912273 [email protected] MHT MOLD & HOTRUNNER [email protected] [email protected] China - 86-137-646-05384 TECHNOLOGY AG www.rnaprecision.com www.sipamolds.com [email protected] www.mht-ag.de Argentina - 54-11-4753-1111 [email protected] 3.2 Stretch blow moulds

Awanti Polymoulds 3.1 Preform moulds Pvt. Ltd. 25/5A/1/2, Nanded, Sinhagad Rd., Mold-Masters Europa GmbH Pune - 411 041, INDIA R&D / Leverage Postfach/P.O. Box 19 01 45 Telefax: - 91 20 24392805 Hamilton Road 76503 Baden-Baden, Germany [email protected] Sutton-in-Ashfi eld Neumattring 1 www.awantipolymoulds.com Nottinghamshire, NG17 5LD Tel: +49 7221 50990 England Fax: +49 7221 53093 Tel: +44 1623 556287 [email protected] Fax: +44 1623 552240 www.wtbvc.com www.moldmasters.com www.rdleverage.com Preform Moulds, Components, PET engineering, bottle design, 1009 SE Browning Avenue Refurbishments and Conversions. Prototyping, industrial blow Lee’s Summit, Missouri Highest Quality, Fastest Delivery, mould and services - MO. 64081, USA Lowest Cost. Rue du buisson Moreau 16100 Tel: +1 816 525 0353 United States - 937-898-8460 Otto Hofstetter AG Cognac FRANCE Fax: +1 816 524 5068 [email protected] Zürcherstrasse 73 Tel : 0033 (0)5 45 36 63 50 www.rdleverage.com Poland - 48-17-860-1020 8730 Uznach, Switzerland www.sa-comep.fr [email protected] Tel. +41 55 285 22 11 [email protected] UK - 44-1623-658-416 Fax +41 55 285 22 44 [email protected] [email protected] Argentina - 54-11-4753-1111 www.otto-hofstetter.com [email protected]

PREFORM MOULDS / DEMO Design and Moulds STRETCH BLOW MOULDS 31020 San Vendemiano (TV) - Italy Tel: 0039 071 7500214 Tel.: +39 0438 409048 Fax: 0039 071 7501958 Fax: +39 0438 409046 [email protected] · www.simexitaly.it [email protected] www.designandmoulds.com

52 PETplanet insider Vol. 13 No. 09/12 www.petpla.net 4.4.1 Labelling machinery

Bühler AG z-werkzeugbau-gmbh Thermal Processes BUYERS GUIDE www.petkamold.com Hoechster Strasse 8 CH-9240 Uzwil [email protected] 6850 Dornbirn, Austria GERNEP GmbH T +41 71 955 3466 Tel. 0043-5572-7272-720 Benzstraße 6 F +41 71 955 3440 Fax 0043-5572-7272-8620 D-93092 Barbing [email protected] offi [email protected] Tel: +49 9401/9213-0 www.buhlergroup.com www.z-moulds.com Fax: +49 9401/9213-29 Email: [email protected] PET-Recycling Plants www.gernep.de Consulting & Engineering 4.0 FILLING / BOTTLING Complete Solutions

RÖDERS GMBH Scheibenstr. 6 29614 Soltau, Germany Tel. 0049-5191-603-53 Fax 0049-5191-603-36 P.E. LABELLERS S.p.A. [email protected] Via Europa 25 www.roeders.de 46047 Porto Mantovano (MN), Italy Blow molding, fi lling, packaging Tel.: +39 0376 389311 Herbold Meckesheim GmbH Via Fedolfi , 29 [email protected] PET Granulators, Agglomerators, 43038 Sala Baganza (Parma) - Italy www.pelabellers.it Shredders, Complete PET Phone +39 0521 839411 washing and recycling lines [email protected] Industriestrasse 33 www.procomac.it 74909 Meckesheim www.sidel.com 4.5 Downstream equipment Tel.: 06226 - 932 – 0 Fax: 06226 - 932 – 495 PET Packaging design and [email protected] development, blow molding www.herbold.com equipment and molds

North America ZECCHETTI S.R.L. +1 678 221 3000 www.tech-long.com Via Galileo Galilei, 1-1A Central America 42027 Montecchio Emilia RE, +52 33 3952 0324 Italy Latin America Tel. 0039-0522-867-411 PET Chemical treatments: +55 11 4668 7000 Fax 0039-0522-866-034 Cleaners, fl otation compounds Western Europe, [email protected] and additives Northern Europe, Africa www.zecchetti.it +33 232 858 798 SIPA S.p.A Via Vigevano 61 Eastern Europe, CIS, Middle East via Caduti del Lavoro,3 28069 - San Martino di Trecate +43 1 370 1661 105 31029 Vittorio Veneto, Italy Novara - Italy Asia Tel. +390438911511 5.0 RECYCLING Tel. 0039-0321789770 +86 21 5048 4088 Fax +390438912273 Fax 0039-0321789765 [email protected] [email protected] www.sipa.it 3.3 Cap moulds 5.8 Complete recycling plants 4.3.4 Aseptic ﬁ lling lines

Automatik Plastics Machinery GmbH Ostring 19, 63762 Grossostheim Complete PET recycling plants, www.corvaglia.ch Germany FDA approved, integrated IV Aseptic & Ultra-clean fi lling lines T +49 6026 503 - 0 increase without Pellet-SSP, 12 route de Mamers - BP 46 F +49 6026 503 - 110 process features lowest overall 72402 LA FERTE BERNARD [email protected] energy consumption, more than Cedex www.maag.com 100 plants supplied to industry. Tel.: (33) 2 43 60 28 28 EREMA GMBH [email protected] Unterfeldstr. 3 www.serac-group.com 4052 Ansfelden/Linz, Austria Erwes Reifenberg GmbH & Co KG Tel. 0043-732-3190-0 High Precision Mould Maker Fax 0043-732-3190-23 www.erwes-reifenberg.de [email protected] www.erema.at

PETplanet insider Vol. 13 No. 09/12 www.petpla.net 53 Buyer’sguide Entries from 5,70 Euro/mm, Call +49-6221-65108-0

6.1 Laboratory equipment 6.3 Contract manufacturers

6.1.2 O 2 barrier measurement lonely 6.3.2 Suppliers of custom “PET washing and recycling designed bottles plants, turnkey and modules for in space – B2B, fi ber, sheet” 7.0 USED MACHINERY SOREMA division of PREVIERO N.srl Via per Cavolto 17, 22040 Anzano del Parco (Co) -Italy Non-invasive oxygen/ or plugged in to the world- Tel:+39 031 63491250 pH measurement wide PET community? [email protected] · www.sorema.it PreSens Precision Sensing GmbH Germany MachinePoint Used Machinery A few ways to beneﬁ t from [email protected] Parque Tecnológico de Boecillo PETplanet‘s many offers. Tel +49 941 94 27 21 00 Edifi cio C.E.E.I. - 2.01 www.PreSens.de/PET E-47151 Valladolid (SPAIN) Tel.: +34 983 549 900 Stay permanently listed in the Fax: +34 983 549 901 magazine‘s Buyer‘s Guide with [email protected] your company logo and contact 6.1.4 Bottle and Preform www.machinepoint.com information (includes printed and PET recycling technology: inspection equipment online version). For only EUR Recycling extruders with 5,70 per mm you can be present inline SSP (IV increase, among top suppliers of PET pro- food-contact, FDA) cessing materials – in every issue of the year. Starlinger & Co. Ges.m.b.H. Sonnenuhrgasse 4 T +44 (0)845 1285501 AT-1060 Vienna T +34 676 986962 (SPAIN) Price of the entry: Tel.: +43/1/599 55 0 E [email protected] Fax: +43/1/599 55 180 www.petmachinery.com number of lines e-mail: [email protected] [email protected] x 3,2 mm line height www.recycling.starlinger.com www.agrintl.com x 5,70 EUR

= entry per issue

Example: Complete washing lines for PET recycling, for fi bre, sheet, B-t-B Intravis GmbH 1,824.– EUR/year applications Rotter Bruch 26a TECNOFER ECOIMPIANTI SRL 52068 Aachen, Germany Via Calto, 409/28 Tel.: +49 (241)9126-0 45030 Ceneselli (RO) - Italy Fax: +49 (241)9126-100 Tel: +39 0425 849090 E-Mail: [email protected] [email protected] www.intravis.de PETplanet Insider www.tecnofer.biz Häusserstr. 36

69115 Heidelberg, Germany 32 mm Tel. 0049-6221-65108-0 Fax 0049-6221-65108-28 6.0 OTHER [email protected] www.petpla.net EMPTY BOTTLE INSPECTION SYSTEM 1 Line = 3,2 mm P&S technology Co. Ltd #326-1, Taejeon-dong Gwangju-si, Gyeonggi-do 464-805, Korea Tel.: 0082-31-763-5621 PTI-US: +1 419 867-5400 Fax: 0082-31-763-5623 PTI-Europe: +41 24 423-9530 [email protected] [email protected] www.pnstech.co.kr www.plastictechnologies.com contact Ask for your SACMI IMOLA individual offer – www.sacmi.com call +49-6221-65108-0

54 PETplanet insider Vol. 13 No. 09/12 www.petpla.net &ŝƌƐƚ͘ ĞƐƚ͘

)UʝəȾHȿHʋUɭɓʏʢʖɃʑɚȫHʣLʔɚ KŶůǇ͘

Structural Brand Development | Mould Manufacturing ʋQɍɍȫHʣLʔɚȾɏՌȸʑȷʑQɢ

R&D/Leverage™ is the First, Best, Only company to bring consumer research, industrial design, and prototyping ƚŽŵĂŶƵĨĂĐƚƵƌŝŶŐĂŶĚǀĂůŝĚĂƟŽŶʹĂůůĨƌŽŵŽŶĞĐŽŵƉĂŶǇ͘ /ĚĞĂƐŵŽǀĞĨĂƐƚĞƌ͘/ŶƐƉŝƌĂƟŽŶŇŽǁƐĨƌŽŵŽŶĞƉƌŽĐĞƐƐƚŽ ƚŚĞŶĞǆƚ͘dĞĂŵƐĂƌĞĂůŝŐŶĞĚĂŶĚǁŽƌŬŝŶŐƚŽǁĂƌĚŽŶĞŐŽĂů͘ dŚĞƌĞƐƵůƚŝƐďĞƩĞƌƉƌŽĚƵĐƚƐŵĂĚĞĨĂƐƚĞƌƚŚĂŶĞǀĞƌďĞĨŽƌĞ͘ &ŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶ͕ĐŽŶƚĂĐƚƵƐ͗

EuropeUSA 816.525.0353 +44 1623 556 Europe 287 USA +44 +1 (0) 816 1623 525 556287 0353 www.rdleverage.com

&KKΘsZ'ͮ,KDΘWZ^KE>Zͮ,>d,Z WɛFʝʛȷʑUʎLɪɗPʝʅOɍ

ΞϮϬϭϮZΘͬ>ĞǀĞƌĂŐĞ͘h< 7 6 5 4 3 2 1

D 51178; ISSN: 1438 9452