Leeds International Festival

NOV 3 - 17, 2016 30th INTERNATIONAL FILM FESTIVAL leedsfilm.com INTRODUCTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 3 12 13 32 41 45 52 58 67 67 70 76 77 79 80 81 84 86 11 31 99 51 75 100 102 122 124 126 128 131 132 133 134 136 138 INTRODUCTION Competition, World Award, British Short Animation Award, Competition, World Competition, Film Competition, Yorkshire Screendance Competition, Short Award, Film Audience Award Leeds International Short Film Award, Dead Shorts Competition, Future Shock: Short Film Award, Sci-Fi Shorts Panorama Andrzej Zulawski Histories Czech Jiri Trnka’s Women New Wave Norwegian Classics Soundtracks Juries Competitions: International Short Film Documentary Shorts Panorama: Nine Moving Stories Shorts of Sex + -Rated Teat-Beat 2016 Talents New VAF Animation Panorama: World Three Minute Quickies Family Short at Kirkgate Market #4 on Tour European Creations Young Reality Booth at Leeds Station Bruntwood Virtual Leeds Big Screen on Millennium Square Artist Film Opening & Closing Films Programme Underground Voices Music on Film Forum Fanathons: Night of the Dead, Animation Day Day of the Dead, Fanorama Retros Fanomenon Short FIlms: Dark Owl International Fantasy Retrospectives Short Film City Index CONTENTS Official Selection Cinema Versa Fanomenon Biserka Stringer-Horne Graham Pilling Louisa Foley Build LIFF30 POSTERS Leeds Inspired commissioned by LIFF is as much about exploring the city of Leeds as about discovering films from around the world. For our 30th anniversary year, 30th anniversary For our the world. around films from discovering as about city of Leeds the about exploring as much LIFF is year, , churches music halls, cinemas, into LIFF experience taking the citywide, 30 venues a record events in over 300 presenting we’re even onto boats. In Leeds Station, and Kirkgate Market, Millennium Square, clubs, museums, colleges, venues, pubs, bars, community Bloom to Leeds, a City in partnership a virtual we’ve also commissioned with Bruntwood, short reality the city itself: Welcome starring so collaborated with We’ve Authors. the company of poetry and historic sites in a 360° tour of new takes you on from Leeds Young four artists Leeds Inspired and including with the city to produce LIFF30, individuals based in organisations and many more the on our anniversarycreation of a huge thank you and film, and celebration of Leeds page. LIFF30 is an epic that appear on this posters to everyone who has made it possible. NOV 3 - 17, 2016 3 - 17, NOV Leeds International Film Festival Film LeedsInternational 4 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 PARTNERS Supporting Partners Supporting Leading Partners Presented by PARTNERS Centre for World Cinemas School ofModern Languages and Cultures Leading Funders 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com TEAM BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 5 TEAM Venues & Volunteers Supervisor & Volunteers Venues Supervisor & Volunteers Venues Short City Programmer Film Short City Programmer Film Short City Programmer Film Short City Programmer Film Short City Programmer Film Short City Programmer Film Fanomenon ShortProgrammer Film Colm McAuliffe, Rebecca Hill, Molly Cowderoy, Robb Caroline Döring, Laura Ager, Sylvia Barber, Gitta Wigro Barham, Andy Wood, Graham Pilling, Biserka Build, Louisa Foley, Stringer-Horne

Sylvia Barber Sylvia Mpetha Mosa Colm McAuliffe Rebecca Hill Laura Ager Robb Barham Andy Wood Gitta Wigro David Maguire Short Film City Inspired LIFF30/Leeds Poster Artists REALITY BOOTH COORDINATORS BRUNTWOOD VIRTUAL Alice Duggan, Natasha Fell, Charlotte Imlah RUNNERS Kirstie Ruth Clemens, Molly Hewitt, MarteMarsden, Katie Ward, Blyseth Lauren Woodfin Watson, Alex King, Chris Fell, Molly Cowderoy Alex King, Chris Fell, Molly Alex King, Chris Fell Martin Fell, David Maguire Grund, Chris Nick Jones Alex King, Molly Cowderoy, Lee Goater Alex Finney Martin Grund, Martin Pinder, Director Manager Programme Manager Communications Short Film City Manager Coordinator, Programme Guest & Industry Manager Coordinator, Film Festival Production Manager Design Manager Manager Print Traffic Coordinator Engagement Youth

VENUE ASSISTANTS Al-Janabi, Celia Ashman, Robb Barham, Lucy Barnes,Hibah Zareen Ahmed, Matthew Albrighton, Daoud Sue Barnes, Christopher Bartlett, Megan Beattie, James Berman, Hayley Blackburn, Michael Brough, Pete Cann, Wylie Caton, James Blackie, Jorja Ellie Bolton, Charlotte Booth, Declan Bracewell, Christian Brayford, Charlotte Jacob Farr, Emily Coyne, Sophie Crewe, Luka Delic, Alison Devine, Georgia Dowell, Sam Drury, Collishaw, Chen, Gong Chenchen, Marion Tracy Field, Meg Firth, John Grieve, Maria Carlotta Grimaldi, Karolina Grygorowicz, Joseph Gaskell, Rhys Gillard, Ellie Goodwin, Thomas Gregson, Milly Gribben, Harrop, Bethany , Thomas Hodgson, Alex Holmes, Alexandra Howell, Charlotte Hudson, PeterColin Hall, Lucy Hallimond, Megan Hampton, Jasmine Klingel, Summer Knight, Alex Kupse, Ursula Bilal Hussain, Joseph Jackson, Helena Johnson, Oriel Kenny, Hughes, Dominic Conneely Hughes, David Hurdon, Usma Mahmood, Jenny Mahon, Natalie Marsh, Daniel Marsh, Christopher Martin, Lin, Louise Lontton, Azhar Mahmood, Kieran Li, Weiping Lai Kwan, Ying Jadzia Moeller, Jeffrey Mills-Thomas, Georgia Milner, Sean McMahon, Bobby Sam McCall, Kate McCall, Simon McGarry, Martin-Rushworth, John McAndrew, Bich Nguyen, George Nuth, Jacqui Ong, Devlin Orton,Emily Moss, Hannah Myers, Thi Thao Anh Nguyen, Patterson, Kate Perou, Dominic Sarah Parkin, Emily Lucy Mae Seymour, Marta Mariana Rios Sanchez, Laura Sawyer, Saccavino, Lou Ross, Alistair Ryder, Preston, Gio Prete, Daniel Reddington, Nicol Reynolds, Smith, Alice Smith, Ella Statham, Zachary Steven Zeynep Stones, Ligita Sukyte, Caroline Thomas, Kerrie Thomson, Eve Tindall, Elly Sinclair, Kae Sinclair, Katie Wilson Chloe Williams, Anna Whitelaw, Stephen Webber, Sophie Warwick, Charlotte Ward, Heeswyk, Shufei Wang, Uludag, Phil Urmson, Dan Van CONTENT DIGITAL Diana Davis, Libby Molineaux and Jacob ThorntonDigital Manager: Sally Molineaux for Molineaux Productions with Fallis, Thea Flindall, Bryony Jameson, Sophena Tom Lucy Dalton, James Dyer, Assistants: Oliver Asadi, Hannah Broadbent, Camila Castaneda, Volunteer Char Wetherhill Effy Varley, Uncomely, Tom Luo, Sam McMahon, Laura Myers, Artjoms Novickis, Celestine Ratsch-Rivera, Niki Stavrianou, Abi Timmins, Khan, Viola LEEDS CITY CENTRE BOX OFFICE STAFF LEEDS CITY CENTRE Shirley Shortall, Rooke, Ashley Sagar Helen Richmond, Margaret VENUE COORDINATORS Liz Ainge, Laura Beddows, Georgina Booth, Hollie Bryan, Laura Ager, GageTom Kendall, Alexandra Dorisca, Matt Goodband, Evelyn Griffiths, Sarah Wilson Wildbore, Nick Randles, Vicki Oxley, PROGRAMMING Official Selection Retrospectives Fanomenon Cinema Versa DESIGN Lead Designer Additional Design Chris Fell Chris Alex King Nick Jones Molly Cowderoy Caroline Döring Jamie Cross Martin Grund Lucile Bourliard Gage Oxley 6 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 VENUES MAIN VENUES Hyde ParkPictureHouse TownLeeds Hall, Headrow, The LS1 Leeds 3AD guests. is afascinating and events of series documentaries with special with 7.1 surround Room, sound. more the intimate In Albert there Victoria Hall, agiant featuring and digital screen cinema system classics are in stunning venue the presented orchestral concert venues LIFF30. at biggest The filmsLIFF30 of many and all-time in 1858,Opened city’s the favourite building landmark has two TownLeeds Room Hall &Albert Victoria Hall: Trinity Leeds, Albion St, LS1 Leeds 5AY Louis Film Prince le Short International Competition. documentaries, retrospectives of individual filmmakers, the and from Europe, America, South Far and the East, alongside mix is there of exclusive awonderful Everyman 4 at previews For cinema LIFF30boutique the Everyman. in Screen selection TrinityThe in 2013 Centre opened and with luxurious it the Everyman Light,The 22 Headrow, The LS1 Leeds 8TL Europe, Africa, East, Middle the USA. and the this year is exclusive previews new of films acclaimed from we are using selection 5and almost whole larger Screen the the in 2001, Vue the 14 features screens over levels. three For LIFF30, CinemaFormerly Century Ster Leeds the when The Light opened Vue inThe Light 73 Rd, Brudenell 1JD LS6 Leeds night horror marathon, and live events. (many film screeningcompetitions, of them 35mm), short on an all- of exclusiveincredible variety previews, retrospective special films largest of anythe is venue, Park an featuring Hyde the at selection in 1987. start of LIFF very from the part has been House LIFF30 The ‘cosiestThe cinema in Leeds’, Park Hyde Picture much-loved the 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com VENUES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 7 Millennium Square Calverley Street, 1UR Leeds LS1 North Bar New Briggate,24 6NU Leeds LS1 The Oakwood Cinema Roundhay Hall, Parochial Drive LS8 5 Fitzroy 4AB Otley Courthouse Street, Courthouse 3AN LS21 Otley, Phil Taylor Cinema The University of Leeds, Leeds 9JT LS2 Seven Arts Harrogate 31(a) Chapel Road, Leeds, Allerton, LS7 3PD The Tetley LeedsHunslet Rd, LS10 1JQ Visit leedsfilm.com forVisit full location and access details for all venues. SATELLITE VENUES SATELLITE Kirkgate Market 28-34 George St, Leeds LS2 7HY Left Bank Rd, Cardigan Leeds LS6 1LJ CityLeeds Museum Millennium Square, Leeds 8BH LS2 Leeds College of Music 3 Quarry Hill, Leeds 7PD LS2 Leeds College of Art Blenheim Walk, Leeds 9AQ LS2 Leeds Dock The Boulevard, Leeds LS10 1PZ Leeds Dock Taxi Water GranaryFrom South via Wharf, Exit of Leeds Station StationLeeds New Station St, 5DL Leeds LS1 Mill Hill Chapel City Leeds Square, LS1 5EB The Adelphi Hunslet 1–3 Leeds, Road, 1JQ LS10 Mills Armley Leeds Industrial CanalMuseum, Leeds, LS12 Road, 2QF Music Belgrave Hall Cross 1-1A Belgrave St, Leeds 8JP LS2 Brudenell Social Club Rd, Queen’s 33 Leeds LS6 1NY FM Chapel Leeds Road, York LS14 6JB City Varieties Leeds St, Swan LS1 6LW Road Cottage Cottage Rd, Leeds LS6 4DD Studios Duke 3 Sheaf No, St, 1HD Leeds LS10 CinemaIlkley 46a Leeds Road, 8DP LS29 Ilkley,

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 11 OFFICIAL SELECTION OFFICIAL Official Selection assembles a broad range of the finest features from around the world in 2016, a broad range of the finest features from around the world Official Selection assembles latest with ’s which is shaping up into a vintage year for world cinema. Opening innovative - extraordinary, idiosyncratic indie hit Paterson and closing with Maren Ade’s Erdmann, in between there are new gems from every corner of the globe in a huge drama Toni Mimosas follows a hallucinatory journey through the range of different styles. Oliver Laxe’s satirises the stifling bureaucracy in urban China Old Stone Moroccan mountains, Johnny Ma’s Lovers and a Bear sets an intense tale of doomed lovers against the vast Two and ’s the latest from great directors like frozen wastelands of Arctic Canada. Elsewhere we showcase and devote Only the End of the World) and (It’s Kelly Reichardt (Certain Women) Cristian Mungiu (Graduation), Cristi a special focus to new Romanian cinema and new films by Puiu (Sieranevada), Radu Jude (Scarred Hearts) and Bogdan Mirica (Dogs). 12 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION Toni Erdmann:LIFF30ClosingFilm Paterson: LIFF30OpeningFilm OFFICIAL SELECTION was this,, whomIfoundthemostinteresting.’ MarenAde,Director addictedtoAndyKaufmanand allhedid.Iwaswatchingthisfor weeks.Iwatchedcomediesalso, includingoldfilms,butit alter egos,andIgot very farwiththat.SoIlookedforcomediansdoingthis,because comediansoftenhavetheir knew thatIwantedthefathertoplay arole,andtogovery world sheworksinwassomething Ididn’t knowmuchabout.But,duringtheresearch,Ifoundalotofsimilarities andthingsIcouldidentifywith. point.Withwas thestarting Ines,thefemalecharacter, Ithought inthebeginningthatIwouldchoosesomeonehasnothingto dowithme.The ‘The fatherwastherefromthebeginning. Hehassomesimilaritieswithmyownfather, goodsenseofhumour – that wholikestojoke,hasavery withtheUKFilmFestival. ofpublicdebatein Europe.TheLuxPrizescreeningsatLIFF30arepresentedinpartnership heart hilarious. Toni ErdmannisoneofthreefilmsnominatedfortheEuropeanParliament’s LUXPrizewhichcastsanannualspotlightonfilmsthatgotothe eccentric, practicaljokelovingfather, Winfried. Sayingmuchmorewouldbeaspoiler:it’s andtouchingfrequently warm fullofsurprises,very followstheambitiousyoungbusinesswoman Inesandtheunpredictablerelationshipwithher directorMarenAde,thestory drama fromGerman queues aroundtheblock.It’s evenbeenincludedinacritics’pollofthetop100films21stCentury. Anextraordinary, groundbreakingcomedy- At thisyear’s CannesFilmFestival,Toni bysurpriseandbecamethebiggestbuzzfilmforyearswithsoldoutscreenings Erdmanntookeveryone FilmPalmed’OratCannes. see page118),winneroftheShort On 3rdNovember, PatersonwillscreenwiththebrilliantTimecode(JuanjoGiménezPeña,,2016,15min,[email protected], Director JimJarmusch, mean it.Theylovetheform.’ CharlesBukowskiworkedinthepostoffice.Theydon’t Art; doitforthemoney.the curatoratMetropolitanMuseumofModern Soyouknowthey the money. William CarlosWilliams wasafull-timedoctorandpediatrician.Wallace Stevensworkedforaninsurancecompany. FrankO’Harawas withtheimperialworldandthingscomefromsmalldetailsoflife…Ilovepoetsbecausenevermetapoetthatwasdoingitfor say thatyoustart ideas butinthings,’whichMethodManquotes.Ididn’t tellhimtodothat.HewrotethatrapandheincludedWilliam CarlosWilliams. Thatmeansto dayisavariationonthebeforeorcomingup.They’rejustvariations.William CarlosWilliams said‘no be ametaphorforlife,thatevery ‘I lovevariationandrepetitioninpoetry, Whetherit’s inmusicandart. inBachorAndyWarhol. InthefilmIwantedtomakethislittlestructure initssmallestdetails. thetriumphsanddefeatsofdailylifepoetry home tohisrestlesslycreativewife,Laura.Thefilmquietlyobserves each day. intoanotebook;hewalkshisdog;stopsinbaranddrinksexactlyonebeer;thengoes Hedriveshisdailyrouteandwritespoetry byAdamDriver. understatedcentralperformance wonderfully Patersonisabusdriverinthecityofsamenameandadherestosimpleroutine Jim Jarmusch’s latestzen-likecomedydramaishisbestfilmforyears:quirky,a featuringaslewoffuncameosand stylish,funnyandheartwarming (presentedinassociationwiththeLUXPrize) Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 USA Country Premiere Status Yorkshire Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Format DCP Running Time Year 2016 Country Premiere Status Yorkshire UK Distributor UK Distributor Affonso Gonçalves Adam Driver, GolshiftehFarahani Joshua Astrachan Jim Jarmusch Jim Jarmusch 113 min Martin Hossbach,MichaelMuehlhaus Martin Heike Parplies Patrick Orth Wittenborn Peter Simonischek,SandraHüller, Michael Maren Ade,JonasDornbach Maren Ade Maren Ade Romanian, English German, 162 min Soda Pictures Soda Pictures 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 13 20th Century Fox Doc and Film 120 min Nate Parker Nate Parker Jason Michael Berman, Aaron L. Gilbert, Kevin Preston L. Holmes, Nate Parker, Turen Penelope Armie Hammer, Nate Parker, Ann Miller Elliot Davis Steven Rosenblum À peine j’ouvre les yeux À peine j’ouvre United Arab , , , Emirates 102 min , French Tunisian, Leyla Bouzid Chambon Leyla Bouzid, Marie-Sophie Marzouk Sandra da Fonseca, Imed Ghalia Benali, Baya Medhaffer, Montassar Ayari Sébastien Goepfert Lilian Corbeille OFFICIAL SELECTION OFFICIAL UK Distributor Sales Company Contact [email protected] Country USA 2016 Year Running Time Format DCP Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Title Country 2015 Year Running Time DCP Format Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor (presented in association with the LUX Prize) the with in association (presented Nate Parker’s directorial debut is a searing account of the life of Nat Turner, the enslaved African-American who spearheaded an insurrection in directorial debut is a searing account of the life of Nat Turner, Nate Parker’s believed that revolutionary would awaken others to the infernal violence mistreatment of slaves, and he died for this cause. The Birth1831. Turner of a Nation seeks to ensure that he did not do so in vain. ‘In script and performance, the film is an articulate howl of anguish and rage given depth by a discerning comprehension of the ways various communities can rely on faith for very (The Playlist) different means.’ was a great first step in the conversation. The reality is we had I think 12 Years a Slave did have an impact on my urgency to tell the story. ‘12 Years Years was about never seen slavery for a film like this. Whereas 12 represented in a way that was honest and unapologetic. I think it set the this film was about the self-determination and resistance of a man and enslaved people and the effect that can the endurance and suffering of slavery, have on a corrupt system. as a religious fanatic that just wanted to kill painted That this was a man. In history he’s humanity. The thing I wanted to get right was Nat Turner’s the narrative that was important for white supremacy and the safety and conservationpeople. I think that’s of racism in that time. So they created I think we with us to do our research and know history. this narrative that was propagated and perpetuated all throughout time. Then the buck stops it was just a mess until it wasn’t it feeling like, ‘Well, all need a hero that fought against this system. If not, we’re all just kind of sat in this muck of Director anymore.’ No, no, no. People fought. People fought.’ Nate Parker, Leyla Bouzid’s impressive debut feature is a tale of rebellious youth and ‘n’ roll set in the months leading up to the Tunisian Revolution in set in the months leading up to the Tunisian is a tale of rebellious youth and rock ‘n’ roll impressive debut feature Leyla Bouzid’s who knows the dangers of rock band against the will of her mother, Farah, a female graduate who sings in a political 2010. The film follows this is a powerful place at the dawn of the Arab Spring, coming-of-age story is also about the which all too well. Taking being outspoken in Tunisia long before her music is but it isn’t fantastic music fuses traditional Arab Mezwed with political and social messages, awakening of a nation. Farah’s noticed by the wrong sort of people. were a lot of people that went out to film what was going on in theTunisia, there revolution arrived in ‘The film came from several ideas,. When the street, but my verywe’re finally going to be able to talk about old times, about the police state.’ It was very first idea was, ‘Whoa, great, important to me to try to talk about it before, so I started and talk about this because it was impossible about the energy of the youth and how little by little to write destroyed by the system.’ Leyla Bouzid, Director it’s My Eyes is one of three films nominated for the As I Open only. 16 Nov is a LUX Prize screening for LIFF30 Passholders The screening on Wed LUX Prize which casts an annual spotlight on films that go to the heart of public debate in Europe. The other two nominated European Parliament’s Courgette (), both of which are family animation My Life as I Toni Erdmann (Germany) and Claude Barras’s films are Maren Ade’s at LIFF30 are presented in partnershipscreening at LIFF30. The Lux Prize screenings with the UK Film Festival. The Birth of a Nation As I Open My Eyes My I Open As 14 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION Chi-Raq WomenCertain OFFICIAL SELECTION happening.’ Spike Lee,Director wherewegetsome ofthereasonswhytheseyoung Black menaredoingwhatthey’re doing. Wesermon/eulogy give areasonwhythesethingsare child isgoneforever. We well.JohnCusack’s tomakethatdistinction,whichIthink we dovery sceneinthechurch whichisa reallywanttotry of Chicago.Speakingtothosemothers, itreallydidn’t mattertothemiftheirchildwaskilledbyacopor agangbanger. Thefactremainsthat their children anddaughters,thosearen’t actors,they’refromanorganizationcalledPurposeOverPain,which runsoutofachurchintheSouthSide Black people.I’vespokentomany ofthemothers–atendmovie,weusestills,Women inWhite, thosepicturesareoftheirmurdered that wehavethesameindignation andhatredangerwhenwedoittoourselvesascops orwhiteprivatecitizensgundowninnocent ‘In thefilmthereareseveralinstances wherewegiveashoutoutacknowledgetheBlackLives Mattermovement.Atthesametime,Ithink Featuring anallstarcastincludingtheinimitableSamuelLJacksonasnarrator.stop theviolenceorwomenwillwithholdsexfromtheirpartners. by astraybullet.Lysistrata, oflocalrapperand gangleaderChi-Raq,leadsagroupofwomeninradicalsolution.Themessagetoallmenis partner Aristophanes. SetinpresentdayChicago’s Southside,wheregangviolencehasgotoutofhand,theplot beginswithatragedywhenchildiskilled Chi-RaqisSpikeLee’s entertaining, Loud, luridandbarnstormingly hip-hopmusicaladaptationoftheancientGreektragedy, Lysistrata by others.’ KellyReichardt,Director me, it’s alwaysbeenmyambitiontofilmpeople whoareoffthebeatentrack,not‘beautifulpeople’,moneymakers,winners...But always hasnegativeconnotations.Butwhatitmeans,isthattakesallthepressureoff.Idon’t reallyknowwhatindependentcinemameans.Butfor my ownlittleworld,whereIcanmakefilmswithfriends.Andanyway, Idon’t thinkmyfilmswouldappealtoalargeraudience.Beinganoutsider ofanadventure.Wetheir ownmoviesandwhocometobepart aboutwho’llseethem.Icreated projectswithoutworrying thinkofourfilmsasartistic peopleandMichelleWilliams. close.It’sthirteen Now, very oftenpeoplewithPhD’s, withmycollaborators,we’revery who’vewrittenbooks,made with atwomanteam:meandfriend.ThenOldJoy:teamofsix,actorsincabinthewoodsforweeks.Then,Wendy andLucy, 8 ‘After myfirstfilm,RiverofGrass(1994),ittookmealongtimetodoanotherone.SoIfinallymadeOde(1999),mediumlengthfilminSuper a lonelyranchhand. anambiguousbondwith tobuildherdreamhomeputsatoddswiththemeninlife;andayounglawstudentwhoforms whose determination film followstheinterconnectinglivesofalawyerwhofindsherselfcontendingwithbothofficesexismandhostagesituation;wifemother The theirownpathamidstthewideopenplainsofAmericanNorthwest. star asthreestrong-willedwomeneachstrivingtoform and LauraDern The latestfilmfromKellyReichardt(Wendy andLucy, Meek’s Cutoff)isabeautifullysubtletakeonfemaleresilience.Michelle Williams, KristenStewart Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 USA Country Premiere Status Yorkshire Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2015 USA Country UK Distributor UK Distributor Kelly Reichardt Dern MichelleWilliams, , Laura Neil Kopp,Vincent Savino,AnishSavjani Maile Meloy, KellyReichardt Kelly Reichardt 107 min Terence Blanchard Ryan ,HyeMeeNa Snipes Nick Cannon,Teyonah Parris,Wesley Spike Lee Kevin Willmott, SpikeLee,Aristophanes Spike Lee 127 min Vertigo Films Park Circus 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 15 Bac Films Visit Films Visit Romania, France 104 min Bogdan Mirica Bogdan Mirica Marcela Ursu Vlad Gheorghe Visu, Dragos Bucur, Ivanov Andrei Butica Roxana Szel 83 min Lisa Robinson Annie J. Howell, Howell Lisa Robinson, Annie J. Jenny Deller Hollyman,Betsy Brandt, Anna Margaret Zev Haworth, Sakina Chris Beetem, Jaffrey Jim Isler Xander Duell OFFICIAL SELECTION OFFICIAL Sales Company Contact [email protected] Sales Company Contact [email protected] Premiere Status UK Original Title Câini Country 2016 Year Running Time Format DCP Language Romanian Director Screenwriter Producer Leading Cast Cinematographer Film Editor Premiere Status UK Premiere CountryUSA 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Film Editor Original Music Part psycho-, part Balkan , Dogs is a macabre and moodily stylised debut by Romanian filmmaker Bogdan Mirica. Roman returns to the part Western, Balkan Part psycho-thriller, he is warned by the local cop Intending to sell this vast but desolate property, land near the Ukrainian border he has inherited from his grandfather. fight. Mirica makes good use of the vast open spaces tothat his grandfather was a local crime lord and his men will not let go of the land without a create a brooding atmosphere in his tourniquet-likenarrative. Supported by the Romanian Cultural Institute www.icr-.co.uk. anything in particular that I’ve always carried with me – ever since my‘There wasn’t that triggered the idea. There was a feeling, an atmosphere in rural Romania. Sometimes, during the summer nights I’d witness these savage fights between the locals. They’d use childhood at my grandma’s chain to planks or axes. And I remember that what puzzled me the most was not the violence but the all kind of improvised weapons from a bike’s need a reason to enter a fight – they just wanted to see who would come out on top. For all their savageryrandomness of it. These guys didn’t and what Dogs is all about. The first thing I lack of morals, there was a sort feeling. That’s of ancestral purity about their acts. I can still remember that I wanted them as Something crude, something poetic – making them larger than life in a way. looked for in all the actors was a certain physicality. really hard to single anything specific intertwinedarchetypes, more than anything. [...] I have so many sources of inspiration and they’re all so that it’s Romanian folk tales imbued with a Ellis. Cormac McCarthy. mostly music and literature. Nick Cave. Warren out. But if I were to narrow it down, it’s not the narrative that inspires me as much as the emotion.’ Bogdan Mirica, Director sense of fatalism. It’s A mesmerising central performance from Betsy Brandt (Breaking Bad) as Claire, a woman facing a life-altering crisis. Three weeks after Claire’s A mesmerising central performance weeks after Claire’s a woman facing a life-altering crisis. Three from Betsy Brandt (Breaking Bad) as Claire, The only person who doesn’t end their investigation and her son begins to grieve. disappears on a camping trip, the police husband Paul mysteriously on how well kept secret. Claire begins to lose her grip parts life she discovers troubling that he’s she digs deeper into Paul’s give up is Claire, and as twists the missing person thriller into an emotional take on uncertaintyshe truly knew her husband. Claire in Motion and loss. give Claire It was intriguing to been lost — both physically and spiritually. this film, we were interested in telling a story‘With about something that’s wanted this experience to be closely- all she knows to be true. We one that unravels her perception of a life crisis that leads to a bigger mystery, observed and to bring intimacy to every the camerawork. The world of the Appalachian element of the film: the acting, the landscapes, and especially Ohio college town where the storythrough streets and manicured homes, imposing cliffs and dark forests, are all filtered is set, with its lonely for more universal questions: How do wedestabilizing mind. Her quest to understand her shifting world after a crisis is a metaphor slowly Claire’s our own change and behavior surprise those closest to us, or even ourselves? Can we ever reallykeep changing throughout our lives? How does through the writing and directing of Claire in Motion.’ Lisa Robinson & Annie J. Howell,know anyone? These were the ideas that we explored Directors Dogs Claire in Motion in Claire 16 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION The First,theLast Don’t CallMeSon OFFICIAL SELECTION the alternative istoohorrifictobear thinkingabout.’BouliLanners, Director the alternative it’s thatmankind hasbeenafraidofthefuture, no? Idon’t thinkweshouldletthispessimistic wayofthinkinggetthe upper hand, thefirsttimeinhistory somethingofa mix betweenthetwo.Thefilmisall aboutexistentialcrisesinatime whenwe’reseeingahugeshiftin society.film orawestern, After all, come togetheraround thecharactersofCochiseand Gilou,becauseIdidn’t wantadogmaticfilmeither, Iwantedsomethingthatresembled a detective Andthenslowly butsurely, complexinshort! to started people. Iwantedtofindawayof addressing this,incorporatingGod,somethingvery thestory I’mnotpreachingchaos,butlove,Ithinkweshouldspend the timewehaveleftlivingourlivestofull,with spend thetimewehaveleftonthis Earth? think it’s the endoftheworld,andthroughatypeillnessthatleavespatient facingtherealityofimminentdeath.Butquestionwas:how do we world,thisslightlygloomytwilightfeeling.Iwantedtoaddress itthroughpeoplewho to addresstheextremelypessimistic feelinggrippingthewestern ‘I oftengettheseflashesofinspiration tomakefilms.Inthiscase,itwasthesetting,sightofhover traincrossingtheBeauce.Attime,Iwanted with theFrenchFilmFestival. gripping suspense,narrativetwistsandblackhumour, ofselfdiscovery. Lannerstakeshischaractersonaredemptivejourney Showinginpartnership leads themtoalittlelosttownwheretheymeetEstherandWilly, acoupleofyoungsocialoutcastsapparentlyontherun.Inanirresistiblecocktail bounty huntersCochiseandGilouarehiredtofindaphonecontaining embarrassingfilesthathasbeenmislaidbyitsinfluentialowner. Theirquest Actor-director BouliLannersrelocatestheAmericanroadmovietohis nativeBelgiuminthefabulousexistentialthriller, TheFirst,theLast.Inseparable Director discrimination andtheprocessofindividualisation.’AnnaMuylaert, times talkingaboutmothersandtheirkids,undermanydifferentperspectives–butmostofallIthinkliketotalkpowerrelationships,abuse, many newthingsthatdidn’t existwhenIwasyounger. excitinganddecidedtobringitintothisfilm.Ithinkallmyfilmsdialogue,many Ifounditvery Imetyoungpeopleanddiscovered tohaveanightlife.Andinparties enough totakecareofthemselves,Ifeltfreegetoutthehouseandstarted 21years ago.AlltheseyearsIdedicatedmylifeandfilmstobeingamother,was born stayingathome,educating.Nowthatmykidsareold thisisa youngerfilm,fulloflocationsanddifferentsituations,gapsmystery.son ofstorytelling, Ibegantomakefilms whenmyfirst In terms work with steadyshootingandthisoneisfullymadehand-heldcamera.Ialsomakefewcuts,hasamorefluidedition. I normally no onereallytalkedaboutthesituationofson.Don’t ofstyleit’s CallMeSonrepresentsabreak.Interms totallydifferentfromallmyotherfilms. famouscaseinBrazil.Thecharacterofthefirstmotherhasevenbeenusedsoapoperas, but ‘The basisoftheplotDon’t CallMeSonisavery ofadolescenceandtheexplorationsexualidentity. oftheturmoil and compassionateportrayal tomouldhimfittheirideals,Pierrehashisowndesignsforlife.Awitty to havehimbackandmakeupforallthelostyears,butwhiletheytry to behismother. SheisimmediatelysenttoprisonandPierreforcedmoveinwithhiswealthy, straightlaced,biologicalparents.Theyarethrilled bythewomanhewronglybelieves whenhefindsoutwasstolenatbirth Pierre isarebellious,cross-dressingteenwhoseworldunravelsovernight Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Portuguese Format DCP Running Time Year 2016 Country Original Title Premiere Status Yorkshire Cinematographer Leading Cast Producer Screenwriter Director Language Format DCP Running Time Year 2016 Country Original Title Premiere Status Yorkshire Contact [email protected] Sales Company UK Distributor Berna Ceppas Berna Helio Vilela Nunes Barbara Alvarez Naomi Nero,DanielBotelho,DaniNefusi Maria Ionescu,SaraSilveira,AnnaMuylaert Anna Muylaert Anna Muylaert 82 min Mãe SóHáUma Jean-Paul deZaetijd Clément Dupontel,BouliLanners,Suzanne Albert OlivierBronckart Bronckart, Catherine Bozorgan,Jacques-Henri Bouli Lanners French, English 98 min Belgium, France Les premierslesderniers Wild Bunch Loco Films 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 17 Curzon Artificial Eye The Match Factory 128 min Cristian Mungiu Cristian Mungiu Cristian Mungiu Dragus, Maria-Victoria Adrian Titieni, Rares Andrici Vladimir Panduru Tudor Mircea Olteanu Grüße aus Fukushima 108 min English, German, Japanese Doris Dörrie Doris Dörrie Molly von Fürstenberg Harry Kügler, Momoi, NamiRosalie Thomass, Kaori Kamata Hanno Lentz Frank J. Müller Ulrike Haage OFFICIAL SELECTION OFFICIAL UK Distributor Sales Company Contact [email protected] Original Title Bacalaureat Country France 2016 Year Running Time Format DCP Language Romanian Director Screenwriter Producer Leading Cast Cinematographer Film Editor Premiere Status Yorkshire Premiere Original Title CountryGermany 2016 Year Running Time DCP Format Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Cristian Mungiu (director of 4 Months, 3 Weeks and 2 ) returns with a powerful father-daughter character study, satirising the restrictive and 2 Days) returns powerful character study, with a father-daughter Cristian Mungiu (director of 4 Months, 3 Weeks planned for and has bureaucracy and corruption of contemporary town in Transylvania, Romania. Romeo is a physician living in a small mountain his daughter Eliza to study and live abroad when she turns 18. She has won a scholarship and just has to pass her final exams but is assaulted in an as he tries to secure her future. attack the day before they begin. Romeo is faced with a series of impossible ethical quandaries you startthings improve?’ For many asking yourself, ‘How can ‘When you look around Romania and see how people are disappointed in society, parents, the is education. Of course we speak about veryof difficult to identify the themes So it wasn’t well-educated children, the elite. I wanted to write about the stage in life when you need to make the most corruption and education - they are present within Romanian society. important decisions about your children. education system in Romania. But it has good results on a small scale - this is an elite group of students, and the teachers are have a strong don’t We of them come back. This is a problem that adds to localproud of this elite. But they often leave to continue their studies abroad and only a tiny number very difficult to make changes in the country. corruption. If you lose so many well-educated young adults, it’s need a generation that will raise children differently to how they were raised. If not, we are going to continue to promote this way of thinking it’s We easy to choose a solution that is not moral or ethical.’ Cristian Mungiu, Director German director Doris Dörrie’s delightfully absurdist comedy drama is set in the heart of the exclusion zone in Fukushima, a quirky, compassionate absurdist comedy drama is set in the heart delightfully the exclusion zone in Fukushima, a quirky, of German director Doris Dörrie’s twenty something Marie escapes the best of intentions, at the Berlinale. With that had a rapturous reception on its premiere response to tragic events from Germany survivors,She hopes to bring joy to 2011 nuclear disaster to work with the organisation Clowns4Help. to Fukushima but finds it more with cantankerous old Satomi, the last geisha of Fukushima. difficult than she thought and ends up staying were three catastrophes in Fukushima: the earthquake, tend to forget there the tsunami, and then the nuclear plant accident, within twenty ‘We 2011, six months after the catastrophe, because I really wanted to see for myself what this meant. Iminutes. I went to Fukushima in November of was still verywent into the zone, and back then the radiation slowly I started high, I was blown away by it. It was very writing about shocking. Very with it. I went to visit the people in the temporaryit, without really knowing what I wanted to do move housing, and they were convinced they would died or committed suicide, or they’re drinking or gambling. The still the same. Meanwhile, a lot of the men have it’s Five years later, out very quickly. real women. the real housing, the resilient. Everything women that I met are the ones who are far more in this film is real, it’s is It took me some time to find the character of Marie. The film I had to find my Germanvery perspective to talk about another country. bound to be the elephant, and as a I’m me – the elephant in Japan. As a tall woman from the West, autobiographical and Marie is, to a great extent, I cannot get everything Director right.’ Doris Dörrie, my role is to be the fool, because in such a ritualised society, foreigner, Graduation Fukushima, Mon Amour Mon Fukushima, 18 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION OFFICIAL SELECTION a homosexualcharacter, whichinKoreaactors canbeconsiderablyreluctant to do.’ParkChanWook, Director aristocratic elegance andpoise,akindofcoldness - butalsofragility. The characterneededboth.Also,Kim hadabsolutelynoqualmsabout playing who, whenhe’s notbeingaswindler, good-for-nothing. Kimhasan wouldn’t oflaxand an ordinary alwaysseemaristocraticandelegant,butsort angle. Ihadknowntherewouldcome adaywhenIwouldworkwithKimMin-heeandHaJung-woo.For hiscountcharacter, Iwantedsomeone toKorea,duringtheeraunder Japaneseimperialistrule.Ithoughtcoulddosomethingthatlooked attheperiodfromadifferent bringing thestory We institutionofinsaneasylums. Myproducersuggested neededanerawithacaste systememployinghandmaidens,butalsowiththemodern but changedthelattertobemoresuitable togenrecinema. way, ofthebook, that’s issomethingspecial.Theplottwistfabulous,too.Ikept tothefirstpart common,butahomosexualstory alsoagenrestory ‘I readthenovel[Fingersmiths,by Sarah Waters] a fourorfiveyearsago.Storieswithhomosexualprotagonistsfighting againstprejudiceare,in money. Lauded incompetitionatthisyear’s Cannes,The Handmaiden isseductive,kinky, anddevilishlygoodfun. Japanese heiressHideko.Theplan:toconvinceHidekoelopewith TheCount,whereuponhe’llcommithertoaninsaneasylumandstealall knownasTheCount, wilythiefSook-heeposesasahandmaidentowinthetrustoffragile Japanese. Underthedirectionofaskilledcon-artist A lurid,dizzyinglyinventivethrillerfromKoreanmaestroParkChan-wook (OldBoy).Itisthe1930s,andKoreaoccupiedbydecadent cast. Iwasexcitedtoworkwiththem.Ifyouhavetherightpeople,noneedforsteering,theydoit.’MelGibson,Director andreal. Hugo…I hadtobegHugo!Hesaidno.SoIsaid,‘PleaseHugo,’andheyes.Luke,lookathim,isaladykiller.warm Itwaseasyto subtlydonetoo,hedoesn’t needmuchdialogue.Thatwastheidealcasting,Icouldn’t havefoundanyonebetter.very Teresa, lookather, she’s so are. IknewAndrewwasinterested,thatabigthingformebecausesawhiminotherthingsandheiscapableoflot[whatdoes] production design,andspecialeffectsguy. Idon’t actuallyeverreadanyone.EvenifyoutalkwithsomeoneoverSkypegetanideaofwhothey and ifanyoneelsecanhelpmeseethembetterpleasecomeaboard.That’s actorsandreallycoolproducer, whywehavethesewonderful andthe I’m theguyonsidethatcallsplays.Ienjoydirectingmorethink,becausemaybemaniacal…Ilovetoseestorieswaythem Andrewwasthecoreofthisgame,heisballcarrier,‘Acting/directing isthesameprocess,itfallsundergeneralheadingofstorytelling. (CineVue) Congressional MedalofHonor. ‘Agruesome,poundingwarfilmaboutthecourageofadeeplyreligiousmaninnearunbelievablecircumstances.’ the the casualtiesfrombehindenemylines,andwaswoundedbyagrenadehitsnipers.Dossfirstconscientiousobjectortoeverearn medic,hesingle-handedlyevacuated agun.Asanarmy in OkinawaduringthebloodiestbattleofWWII,saved75menwithoutfiringorcarrying ofDesmondDoss(AndrewGarfield)who, ’s truestory firstfilmasdirectorsinceApocalypto (2006),HacksawRidgeistheextraordinary Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Format DCP Running Time Year 2016 Country Original Title Ah-ga-ssi UK Distributor UK Distributor Rupert Gregson-WilliamsRupert John Gilbert Simon Duggan Weaving Teresa Palmer, AndrewGarfield,Hugo Oliver, Tyler DavidPermut, Thompson William D.Johnson,BillMechanic,Brian Terry Benedict,PaulCurrie,BruceDavey, Schenkkan Andrew Knight,Robert Mel Gibson 131 min Australia, USA Yeong-wook Jo Jae-Bum Kim,Sang-beomKim Chung-hoon Chung Min-hee Kim,KimTae-ri, Jung-wooHa Syd Lim,ParkChan-wook Sarah Waters Seo-Kyung Chung,ParkChan-wook, Park Chan-wook Korean, Japanese 144 min South Korea Curzon Artificial Eye Curzon Artificial Films 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 19 Eureka Entertainment Inhebek Hedi Belgium, France, Tunisia 88 min Mohamed Ben Attia Mohamed Ben Attia Dora Bouchoucha Fourati Ben Messaoud Majd Mastoura, Rym Frédéric Noirhomme Azza Chaabouni, Ghalya Lacroix, Hafedh Laaridhi Omar Aloulou Fuchi ni tatsu France, Japan 118 min Kôji Fukada Kôji Fukada Ohyama, Masa Hiroshi Niimura, Yoshito Toyama Sawada, Tsuyoshi Mariko Tsutsui Ken’ichi Negishi Kôji Fukada Hiroyuki Onogawa OFFICIAL SELECTION OFFICIAL Sales Company Luxbox Contact [email protected] UK Distributor Premiere Status Yorkshire Original Title Country 2016 Year Running Time Format DCP Language Arabic Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Original Title Country 2016 Year Running Time DCP Format Japanese Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music An immersive and quietly moving character drama from Tunisia, Hedi is the eponymous story of a passive young man who lets others make his big An immersive and quietly moving character drama from Tunisia, sends him to the seaside town of Mahdia to seek outdecisions for him. His pushy mother is busily preparing his impending marriage and his boss lust for life quickly rubs off on him and a local resort.new clients. There he meets Rim, a free spirited globetrotter working as an activity leader at Rim’s Hedi is finally forced to make a choice for himself. the two begin a passionate love affair. it defines not only the main character but also the‘Hedi means calm, serene and if this name imposed itself as the title of the film, it is because Tunisians, Hedi Hedi is the calm before the storm. And just like many young situation in which he finds himself at the beginning of the story. young woman who likewise is crushed by the ofexperiences the stigma of tradition, in this case, through his imminent marriage to Khedija, a custom and religion. My initial idea was to tell the story of a young man torn between two worlds, two different voices, which each might determine in the midst of our first democratic elections and we were learning we were to discover ourselves above . his life. At that time in Tunisia Under Ben Ali, political censorship ended up anesthetizing us and eventually made everything us rotten. Just like Hedi at the beginning of the around this young man‘s journeyfilm, we tried to live our lives without asking too many questions. At that point,the parallel between and what was going on in my country Mohamed Ben Attia, Director became obvious, and it became crucial for me to centre the story Hedi‘s character.’ I was developing on When Yasaka walks into Toshio’s home workshop after 11 years in prison, he asks his old pal for a job and a place to sleep. Toshio obliges out Toshio asks his old pal for a job and a place to sleep. home workshop after 11 years in prison, he walks into Toshio’s When Yasaka Akié and starts wife to play the harmonium, teaching their daughter Hotaru the befriends Toshio’s as Yasaka however, of more than friendly duty; in the insights into the isolation evident altered. ‘Expertly fragile domestic bliss is forever realities … the film’s calibrated to reflect emotional family’s merely hit their ; they smash them parent-child connections and long-termrelationships most take for granted – marriages, – don’t friendships (Screen Daily) with a sledgehammer.’ me to write it. But there are two things that I wanted remember what inspired 10 years ago, so I don’t ‘I wrote the one-page synopsis for the film about or parent and child, I wanted to explore a married couple Through the depiction of a family, to explore in this project, and the first one is family. we all possess as individual human beings as partsolitude—the essential, fundamental solitude that of the human condition. The second thing I can happen to any of us and disrupt our daily lives. wanted to explore was this sense of violence that shooting when I’m a being shot as simple as possible. Basically, For any film that I make, I try between the camera and what’s to keep the relationship reason I do that, the baseline. And the drawing a flower in a vase. That’s frontal—as if you’re at the height of their eyeline, and it’s usually person, it’s being shot, what I want to do is to place things in the screen just like strangely enough, is because instead of trying the camera explain what’s to have what I try Director to do with my camera.’ Kôji Fukada, a picture. That’s Hedi Harmonium 20 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION It’s OnlytheEndofWorld The IslandFuneral OFFICIAL SELECTION to say. inhumannature.’ XavierDolan,Director toworkwithactorsIreallylikeand Iaskedthemtoexpressallthe shortcomings Ihadanopportunity life, peoplecry, ofwaysand meanstoavoidhearingwhatothers have awayfromthetruth. Peopleuseallsorts people explode,peoplelie, turn For me,whatismost intoxicatinginLagarce’s playisperhapstheunpleasant sideofthecharacterswhoremainhoweverdeeplyhuman.People shout,in are constantlycritical,perhapsbecause theyareafraidthatheisactuallygoingtospeak,they’re ofwhathemaysay. else,andpeople is constantlyescapingintoadifferent universe.He’s interruptseveryone inahousewherenoonelistens toanybodyelse.Everyone person whoislookingandwatching thefilm.Hetakesrefugeinadifferentwolrd,helooksthrough window, memories.He hethinksaboutcertain ofwhythebrotherhasfinallycomeback.Andforme, Louisisthe exceptwhattheyreally feelorunderstandinterms They talkabouteverything superficialoruseless. ‘I thinkwhatismostgrippinginLagarce’s allofthecharactersare,howthey expressthingsthatarevery textishownervous in thefinalscenes. Seydoux), Dolancreatesanatmospheresotense,itkeepsyouonthe edgeofyourseat,untilallthepent-upfeelingsfromLouis’longabsenceunload byitsstellar cast(includingVincent Cassel,MarionCotillard,andLéa imminent death.Featuringstunningcameraworkandoutstandingperformances totellhisfamilyof Lagarce, thebeautifullyshotdramaiscentredonsuccessfulexpatwriter Louiswho,afteratwelve-yearabsence,returns The latestmuch-anticipatedfilmfromXavierDolan,It’s OnlytheEndof World wontheGrandPrixatCannes.BasedonaplaybyJean-Luc clashwithintheirpastandmemories.’Pimpakafilm aboutanyonewhoislookingfortheiridealworldamidsttheconflictsofinternal Towira,Director Thaiborder,The IslandFuneralisnotafilmabouttheconflictandviolentsituationofsouthern ofanygrouppersonsinparticular. a norastory Itis stories toldfromtheirmemories.Iabsorbedthepowerofthosetaleseachregion,individual. andtheSouth.Igottotalkwithlocalpeoplecaughtaglimpseinto theirliveswhilelisteningtothe theNortheast to manyplaces–theNorth, each personrememberingwhattheyseeindifferentways,orchoosingtorememberthingsaswantto.Overthepastfewyears,Ihavetravelled will becomeforeverentrenchedinmymemory, isaspecialthing, andindeedinageneration’s foralongtime.Ifeelthathumanmemory memory would gettoseeinthislifetime:thatofthickcloudsblacksmokerisingaboveandcoveringtheentirecity. Theimageofwhathappenedthatday ThesituationseemedlittledifferentfromthatinPattaniwhereIhadjustcomefrom.Butsawanimageneverthought tankseverywhere. military ‘On 19May2010,IwasdrivingbackfromPattanitoBangkok.Uponreachingthecity, wasannounced,with togetdark.Acurfew itwasstarting overlap withthememoriesofthosearoundher, towardsanunknowndestination. whilefeelingsofinsecurityintensifyastheytravel further visit alonglostaunt.Overthecourseof1,000kmroadtrip,fragmentedimagesfromLaila’s fromherfamily, pastsurface, life,workandlove,which a predominantlyBuddhistcountry. Accompaniedbyherbrotherandafriend,shetravelsfromBangkoktooneofThailand’s provincesto southernmost andconfidentyoungwomanaMuslimin ofLaila,asmart A poeticThairoadmovie,TheIslandFuneralfollowsthephysicalandspiritualjourney Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Thai Format DCP Running Time Year 2015 Thailand Country Original Title Premiere Status UK Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language French Format DCP Running Time Year 2016 Country Original Title UK Distributor UK Distributor Inspirative, NoppananPanicharoen Uruphong Raksasad Harin Paesongthai,BenjaratChoonuan, Phuttiphong Aroonpheng Yossawat Sittiwong AukritPornsumpunsuk, Heen Sasithorn, Pimpaka Towira, ChatchaiChaiyon Pimpaka Towira, KongRithdee Pimpaka Towira 105 min Maha samutlaesusaan Xavier Dolan André Turpin Cotillard Nathalie Baye,Vincent Cassel,Marion Michel Merkt NathanaëlKarmitz, Grant, ElishaKarmitz, Sylvain Corbeil,XavierDolan,Nancy Xavier Dolan,Jean-LucLagarce Xavier Dolan 97 min France, Canada Juste lafindumonde Curzon Artificial Eye Curzon Artificial Day forNight 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 21 Swedish Film Institute Altitude Film Distribution En man som heter Ove 116 min Swedish, Persian Hannes Holm Fredrik Backman, Hannes Holm Nicastro Nicklas Wikström Annica Bellander, Rolf Lassgård, Bahar Pars, Zozan Akgün Göran Hallberg Fredrik Morheden Gaute Storaas 89 min Oldroyd William Alice Birch Nikolai Leskov, Fodhla Cronin O’Reilly Pugh,Christopher Fairbank, Florence Cosmo Jarvis Ari Wegner Nick Emerson Dan Jones OFFICIAL SELECTION OFFICIAL Sales Company Contact [email protected] UK Distributor Premiere Status England Original Title Country 2015 Year Running Time Format DCP Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Premiere Status Yorkshire Premiere CountryUK 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music In this moving comic crowd-pleaser based on Fredrik Backman’s eponymous bestselling novel, Ove is a grumpy widower who patrols his block every In this moving comic crowd-pleaser based on Fredrik Backman’s his tight-knit community knows morningtelling his neighbours exactly what he thinks of them. Thankfully, like clockwork, locking up stray bikes and wife. Fortunatelythat his cantankerous veneer hides the grief and despair he feels over the death of his beloved for everyone, the arrival of new in himself the man his wife loved. neighbours gives Ove an unexpected reason to keep going – and challenges him to rediscover about a grumpy old man who meets an immigrant, who is very immigrant-ish, ‘At my first meeting to decide whether to direct the film, I said ‘it’s And because it was a best selling book, I thought it was stupid to take interested at all in the story. correct?’. When they confirmed that, I wasn’t critics. I turnedsomething like that on at this point in my career – and people who love the book also are difficult it down. But I read my free copy of the novel – I like free copies – and found myself crying me. The grumpy old man is an archetype, but over it and found elements that really interested strange, when I got very in this story interested in the project. It’s we could go into his brain, and discover where the grumpiness comes from. That’s old record . It rifling through my parent’s but when I was reading, my mind started I could see myself as a boy on a rainy day, traveling. love, but their past remained silent to me through thosereminded me of their lives before they had me and my siblings, when they were so much in I had words for that silence.’ Hannes Holm, Director albums and old photos. When I read the book, and absorbed the flashbacks in it, suddenly Based on the Russian classic ‘Lady Macbeth of Mtsensk’, William Oldroyd’s impressive debut relocates this femme fatale to a country impressive estate in 19th Oldroyd’s ‘Lady Macbeth of Mtsensk’, William Based on the Russian classic century grows frustrated with her of convenience to a man twice her age, a young woman trapped in a loveless marriage England. Katherine, and her new found passion on an affair with a young worker on the estate husband is away on business she embarks oppressive life. While her unleashes so powerful ensue in this thrilling gothic tale. she will stop at nothing to get what she wants. Murder and mayhem important‘When preparing to direct Lady Macbeth it was director for me to continue to put the actors and script at the centre of the film. As a theatre and the script — it is quite common for the to be present throughout the rehearsal period andI approach each project with respect for the writer Even though the ‘authorship’ of a film is rebalanced in how best to realise the intentions of the writer. my main job is to help the actors to understand to abandon this practice when I had a script as good as the the one Alice Birch had written for Ladyfavour of the director I thought it would be foolish Macbeth. My short and error that film is a visual medium. I treated it film Best was useful preparation for Lady Macbeth as it helped me to realise by trial as script as she’d written it I startedan exercise in economic storytelling. and stripping back in the edit. a process of refining Alice’s Once I had shot I would have been more during the edit we were able to lose lines of dialogue if a look told the story. The script was quite lean in the first place but nervous Director Oldroyd, empowering in Lady Macbeth.’ William of this revision in theatre but found it quite A Man Called Ove Lady Macbeth Lady 22 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION Mimosas Mercenary OFFICIAL SELECTION Director isaninneroneaswell.’Oliver Laxe, physical andmetaphysical adventures.Thecaravan physicallytravelsacrossthemountains, butthejourney of –knowing thattheetymologicalmeaningof thewordreligionis‘torely’.It a film film. Thatiswhy I saythatMimosasisareligious western doing soMimosasbecameanopen filmthatcanspeaktoaudiencesfromdifferentculturesandideologies. Ithinkitisapositivelynon-territorialized did. Thereisalotofscepticism.To Itriedtoventureintotheessential,whether inthescriptorconstructionofimages.By face thisuncertainty so easytomakethesefilms. avoidstalkingabouttradition, eventhoughtheavant-gardealways We arelivingincomplicatedtimeswhereeverybody religious act.Whetherdirectlyorindirectly,not filmmakersofalltimehavemadereligious films,andIfinditstrangethattodayis the mostimportant we donothavethisneedtodifferentiate betweenfaith,religionandspirituality. creation, whichisadifferentkindof Andthisalsoappliestoartistic ‘I belongtoagenerationthathasno complexesaboutreligiousmatters,wemakeacleardistinctionbetween religionandreligiousinstitutionsso, with thecaravan,AhmedandSaid,aneccentricstrangerwhomeets themontheway. thecorpse.Thetaskfallstotworoguestravelling buried withhislovedonesbutwhenhedies,mostofthecaravaneers refusetocontinuetransporting Laxe theCriticsWeek Prizeatthisyear’s anelderlyanddyingSheikhthroughtheAtlas.Hislastwishistobe .Acaravanescorts traveloguethroughtheMoroccanMountains.Visually andwondirectorOliver striking,itresemblesapsychedelicwestern Mimosas isavisionary referring toWesterns cowboywitharedskinface.’SachaWolff, byClintEastwood,suchasUnforgiven.Forme,Soaneisasolitary Director final good-byetotheirfamilies,originsandtraditions.WhileIhavesamuraifilmslike YojimboorSanjurobyKurosawainmind,Iamalso likeaone-waytrip.Asiftheirfatewassealed,theysaid of thebodythroughviolence.AllplayersthatImetexperiencedtheirdeparture me inthedevelopmentofscreenplayaswellstagingfilm:freedomandweighttradition,familyfatherhood,subjection instead oftalkingaboutforeignworkers,IwouldfocusontheseFrenchpeoplewhocomefromelsewhere.Threecentralissues,allrelated,guided whenImeetPaki,aNewCaledonianrugbyplayerofWallisianimmigrant workers.Myresearchtookadecisiveturn origin.Ithendecidedthat reach thenextdivision.Very littleisknownaboutthehundredsofamateurteamswhoseprecariousfinancialsituationshapesdailylivesthese championship division,hasfifteen-or-so– foreignprofessionalplayerswhowerehiredtohelptheothermembersofteam–allamateur ofFrenchrugby’s inLeMondediscussingtheLons-Le-Saunierteam:team,whichispart ‘The ideafortheprojectcamefromanarticle fourth thecomplicatedrestrictionsofhisnewfoundfreedomandhighpricethatmustbepaidforsuccess. in France.Hesoonlearns of ayoungrhinoceros.Inanactrebellionagainsthisabusivefather, heacceptsatalentscout’s invitationtotravelacrosstheworld andplayrugby andtribulationsof19yearoldSoane,whocomesfromtheSouthPacificislandNewCaledonia,hasgreatathletic talentandthephysique fortunes moviebyfirsttimefeaturedirectorSacha A visceralandemotionallycompellingreinventionoftheinspirationalsports followsthe Wolff. Mercenary Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language French Format DCP Running Time Year 2016 France Country Original Title Mercenaire Premiere Status Yorkshire Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Arabic Format DCP Running Time Year 2016 Country Premiere Status Yorkshire Contact [email protected] Sales Company Luxbox Contact [email protected] Sales Company Luc Meilland Laurence Manheimer Samuel Lahu Toki Pilioko,IlianaZabeth,MikaeleTuugahala Bréhat Claire Bodechon,RachidBouchareb,Jean Léa Fehner, PerrineLottier, SachaWolff Sacha Wolff 103 min Cristóbal Fernández Mauro Herce Aagli Ahmed Hammoud,ShakibBenOmar, Said Felipe Lage Santiago Fillol,OliverLaxe Oliver Laxe 96 min Spain, Morocco,France,Qatar Be ForFilms 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 23 Altitude Film Distribution Be For Films 110 min McCraney Barry Jenkins, Tarell Adele Jeremy Kleiner, Dede Gardner, Romanski Rhodes, André Holland, Janelle Travante Monáe, , , Naomie Harris, Mahershala Ali James Laxton Joi McMillon, Nicholas Britell Austria, Italy 90 min Covi, Tizza Rainer Frimmel Arthur Robin Weber, Caroli, Wendy Tairo Rainer Frimmel Covi Tizza OFFICIAL SELECTION OFFICIAL UK Distributor Sales Company Contact [email protected] Country USA 2016 Year Running Time Format DCP Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Music Premiere Status UK Premiere Country 2016 Year Running Time DCP Format Italian Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor We are delighted to announce an exciting late addition to the LIFF30 programme, the profoundly moving new drama Moonlight, one of the most We man from childhood to adulthood as he Moonlight chronicles the life of a young black An intimate character study, acclaimed films of the year so far. Confronting and transcending stereotypes of race andstruggles to find his place in the world while growing up in a rough neighbourhood of Miami. and poetic meditation on identity and contemporary the film is a vibrant African American life anchored by extraordinary performancessexuality, from a tremendous ensemble cast. [McCraney] and I grew up with such similar Tarell the reason I came onto the project. Basically, say the queer narrative interests me—that wasn’t ‘I wouldn’t When I read the piece, I thought, this is a story that needs to be told by a lives that I felt like we were the same person with the exception of sexual identity. myself an ally to LGBT causes and it was an opportunity I’ve always considered to put that empathy into action. And what I decided was queer filmmaker. if I preserved voice, his voice, then this was a way that I, as a straight man, could bring a queer story into the world and do that if I was respectful to Tarell’s would. Once I got to that point, I took authorshipit with the same nuance and subtlety and respect that someone who had the first-person experience too. I inherently intersectional But you know what? The movie’s this thing where I’m a non-queer person telling a queer story. of it. And then it wasn’t addicted. It’s a poor black man, with a struggling single mom, who’s you know? And precious about any one section of the intersectionality, wasn’t Barry Jenkins, Director even believe that all that stuff belonged in the story I wouldn’t actually happen to not only me but also Tarell.’ if it didn’t funny, This gently melancholic paean to circus culture was one of our highlights of this year’s Locarno Film Festival. Returning of Covi to one of the subjects of this year’s paean to circus culture was one of our highlights This gently melancholic Caroli: a boisterous follows the travails of the twenty-year old Tairo a LIFF highlight from 2009, Mister Universo , and Frimmel’s but charming amulet – a piece of iron bent by former who goes on a quest to replace his stolen good-luck young lion-tamer Universe Arthur Mr Robin. to one the most underrated bodies of work in contemporarySubtly engaging and original, Mr Universo adds European cinema. ‘Our work preserves be long before there are no more lion and tiger trainers – and in the same form many things that will not exist in future. It won’t a lot, but they have a great deal to do with a good thing. They are professions that are dying out. Professions that you can criticize in principle that’s very important those jobs but also for the people who want to see them. It’s human nature, not only for the people who do for us to preserve that Covi, Co-Director without judging.’ Tizza Tairo. Not because Arthur taught him how to bend an iron bar Universo really was significant for ‘It was lovely to see that the encounter with Mister a very He’s happened on a mental level. And Arthuror how to increase his strength, but because something in turn also benefited from this encounter. into his life and turnsTairo bursts his dignified person who lives very rituals; everything much according to And suddenly always has to be ordered. wrong. But he liked him a lot.’ Rainer Frimmel, Co-Director world upside down. It could have gone terribly Moonlight Mister Universo Mister 24 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION The Odyssey Mother OFFICIAL SELECTION Director goodfilmmakerwhoknew howtotellstories.Hewasan inventor,a very anexplorer, agreat diver. Hewasakeyfigure ofhisera’.JérômeSalle, ahumanbeing withbigqualitiesandflaws. Hehadmanyfacets–hewas them considerhim asaint,othersdespicableman. Itriedtoportray Cousteau isacomplexcharacter. tellingpeopleabout myproject,whatstruckmewastheirextremelycontrastedreactions. Someof WhenIstarted wanted toavoidthat.Idecided focus onhisfamily, specificallyhisrelationshipwithson. find therightangle.Asaspectator, Ioftenfindbiopicsboring.Theclassic structureisachildhoodtrauma,theriseandfall,newfound serenity. I secretive.Andwhenthedoorsare closed,youwanttoopenthem–soIresearchedandendedupmaking afilm.Ittookmewhileto remained very tellingthemhisstory,had neverheardhisname.Istarted but Irealisedmyselfdidn’t knowmuchabouthislife.Hehadcontrolled hisimageandhad life.OnedayIfoundmyselftalkingaboutCousteautomy children anditappearedthatthey ‘What urgedmetomakethisfilm is adetailofeveryday spirited adventurersheisreadytocrosstheworld’s oceansbutwhenhissonsgrowup,theparadisethreatensto disintegrate. never content.Helivesandbreathesadventurewithhisinvention, theaqualung,hisrecentlyacquiredvesselCalypso,andacrewoffree- his wifeSimoneandtheirtwochildrenPhilippeJean-Michel.They liveinparadisetheirbeautifulhousebytheMediterraneanbutJacquesis A gloriousbigscreenadventurewithsumptuouscinematography, Cousteaufamily–Jacques, TheOdysseydramatisesthelivesofextraordinary throughdramaticresolutions.’KadriKõusaar, ofthecharactersthanserved Director observations people whosebestintentionstakethemintothewrongdirection,andaremeanttobepositivelyhaunting,whichisachievedratherthroughdeep experience ofbeingtrapped–sheliterallycannotgetoutthere,andnorcanwe.Allmyfilmshavedealtwithdark,mysteriousundercurrents and longingforlove.Asadirector, takesplaceinonehouse.Butasense,itonlyreinforcesElsa’s itwaschallengingformethatmostofthestory provincialEstonia,butitsthemesareuniversal–loneliness,disillusionment takesplaceincontemporary becomes evenmoretrappedinit.Thestory time inherlife,shedarestodosomethingpurelyforherself,selfish...However, bywantingtogetoutofherclaustrophobicsituation,she only 17.Now, atamatureage,raysofhopefinallyemergeinherdullexistence.Shefallsloveandwantstobreakfreeshackles.Forthefirst outabetterlife.ThemaincharacterElsabecamemotherwhenshewas specific small-townatmospherewhereadesperatesoulattemptstocarve ‘I wassoldonMotherassoonIreaditandinstantlyknewthatwantedtobeboard.ItstragicomictonesevoketheCoenbrothers’Fargo–a progressessomeofLauri’s ishidingsomedarksecretsandasthepoliceinquiry closesttiesarecalledintoquestion. everyone of hertether, ElsareceivesLauri’s visitorswhocometoupdatetheunconsciousLauriontheirlivesandfindoutwherehehidhiscash.Itseems caretaker ofhergrown-upsonLauri,whohasbeeninacomasincebeingshotundershadowycircumstances.Attentivedutiesbutattheend Estonia’s is‘asardonicviewofsmalltownEstonian lifewithaFargovibe’(Variety). Oscarentry ThepitchblackcomedyfollowsElsa,the full time Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Estonian Format DCP Running Time Year 2016 Estonia Country Original Title Ema Premiere Status English Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Format DCP Running Time Year 2016 France Country Original Title L’odyssée Premiere Status UK Distributor Contact [email protected] Sales Company Tambet Tasuja Jean-Noël Mustonen Noormets Tiina Mälberg,AndresTabun, Andres Aet Laigu Leana Jalukse,AlWallcat Kadri Kõusaar 89 min Alexandre Desplat Stan Collet Matias Boucard Wilson,Lambert PierreNiney, AudreyTautou Philippe Godeau Olivier Delbosc,NathalieGastaldo, Jérôme Salle,LaurentTurner Jérôme Salle French, English 123 min Joint UK Altitude FilmDistribution Film SalesCompany 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 25 Jušić Asian Shadows Ne gledaj mi u pijat Croatia, Denmark 105 min Lao shi China, Canada 80 min Johnny Ma Johnny Ma Lin, Sarah Stallard, Xian Jian, Chi-An Wu Jing Wang Wang Gang Chen, Nai An, Hongwei Ming-Kai Leung Mike Long Lee Sanders Hana Jušić Ankica Juric Tilic Arijana Mia Petricevic, Niksa Butijer, Culina Jana Plecas Jan Klemsche Hrvoje Niksic New Europe Film Sales , Director OFFICIAL SELECTION OFFICIAL Sales Company Contact [email protected] Premiere Status UK Original Title Country 2016 Year Running Time Format DCP Language Croatian Director Hana Premiere Status UK Premiere Original Title Country 2016 Year Running Time DCP Format Mandarin Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Sales Company Contact [email protected] ’s bold debut feature is a realist delight. Marijana’s life revolves around her family, whether she likes it or not. They live in a tiny apartment, whether she likes it or life revolves around her family, bold debut feature is a realist delight. Marijana’s ’s In Old Stone, first time director Johnny Ma uses the nightmarish, Kafkaesque bureaucracy of contemporary director Johnny Ma uses the nightmarish, Kafkaesque In Old Stone, first time China to transform a social realist drama The storyinto a strange and hallucinatory inspired by an alarming is in China. Lao Shi is a small rise in hit and run incidents . world is turnedtown taxi driver whose his conscience to do the who is taken to hospital. He struggles with upside down after he hits a motorcyclist, lead him through a series of difficult decisions and increasingly desperate measures. right thing but social attitudes and legal complications a story‘A few years ago while traveling, I had overheard of about a truck driver who hit and injured a man in the middle of the night. But instead no one was around to witness the accident, he drove backwards onto the injured man, killing him. calling for help, when the truck driver saw that confessed to the murder and explained that his act was due to a purely practical reason: if theAfter the police investigation, the truck driver finally man had died at the scene, the truck hospital bill for the rest of his life. But if the injured the man’s injured person had lived, he would be paying family as compensation. So after weighing his options, the truck driver decided it was the man’s driver would only have to pay a one-time fee to started to pop into my head and I knew had to find a way to try and express Immediately, more practical to kill than to save a human life. the truck driver had made scared me even more because I had The decision driver to commit murder. this unbelievable dilemma that drove this truck actually understood his reasoning. In a sort him, I of ‘if I was in his shoes’ situation, with the same lot in life and knowledge about the society around Johnny Ma, Director the answer.’ really know It scared me to the core that I didn’t wondered how I myself would’ve decided to act. Hana Jušić Whilst she works two jobs to her controlling father has a stroke, Marijana takes his place as the head of the family. When driving each other crazy. keep everything to the edge, Marijana finds comfort afloat, her mother and disabled brother do their best to scupper the ship. Driven in seedy sex with random strangers, and this taste of freedom leaves her wanting more. ‘I have always felt that people are like warm – they need love and closeness, but they are often suffocating and cruel, especially to the little beasts terms,ones they love. And they behave worst of all towards the rest of their pack, which is, in human their family. but with emotional characters are animalistic and quirky, The style of the film hovers between Rabelaisian grotesque and psychological realism – my ; the storydepth and real conflicts. On the one hand I have tried to avoid the pitfalls of a typical social has a lot of dark and it is be emotionally detached from Marijana, nor for her familyslightly twisted, but my characters are not flat caricatures, and I do not want the viewer to to resemble cartoon villains. and some dark, twisted charmMy basic intention in Quit Staring at My Plate was to give both an interesting aesthetic dimension to the mentality and ferocious love; this is a childish aggression, but above all on people that I love and know so well. A virtual prison built on mutual co-dependency, world through which I tried to explore the eternal – what does it mean to break free?’ Hana Jušić question Quit Staring at My Plate Quit Staring at My Old Stone Old 26 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION The Shepherd Scarred Hearts OFFICIAL SELECTION this casewiththeexcuseofprogress ontheirside.’JonathanCenzualBurley, Director thanthem,in world abetterplace,themessage is againstgreedandthepeopleforcingtheirwillonotherswho areweakerorlesspowerful end. Itisnotafilmcampaigning against progressorpromotingasimplerwayoflife,Ibelievetechnology andprogresscanreallyhelptomakethe unravelsfromasimpledisagreementregarding thesaleofsomelandsanditcrashesintoaviolentbutinevitable townswhereeverything dormitory flatlandsand conflictwhichtakesplacesinaruralworld ofdeserted aboutaneternal themselves tobecomecorruptedby promisesofriches.Astory ofmanwhoisforcedtofightforwhatrightfullyhis, againstthepeoplewhoallow ‘The Shepherddealswiththesadreality ofgreed.Itisthestory aroundhimhasastakeinthedevelopmentandincreasinglyextremeopposition fromhisneighboursleadstobitterconflict. everyone plains. Whenheisapproachedbyaconstructioncompanylookingto buyhisland,casualrefusalsendsripplesthroughthecommunity. It seems direction ofyoungSpanishfilmmakerJonathanCenzualBurley. intheSpanish lifeonasmallfarm shepherdwholivesaspartan Anselmoisataciturn climaxundertheskilful psychologicaldramaandaparableofcorporategreed, steadilybuildingtoapowerful The Shepherdisaslowburning Jude, Director of whatsomebodythinksaboutsomeaspectslife.WhatchangedisthatIlostconfidenceinthepowerhavingaconnectionwithreality.’ Radu reality. Idonotbelievethisanymore,I’mmoreinterestedinthecinemalikeamind-game… sotospeak;notarepresentationoflife,butpresentation naivefilm. filmwasavery It’s naive becauseIwassoinexperiencedandsomehowbelievedinthepossibilitiesofcinematorepresent My firstshort not comefromsearchingtobedifferent,originalorsomethinglikethat,Iamabledothat. tomakethingsthatpleaseme.Therearesomeideasbehindthechoicesbuttheydo Having adistinctivestyleisnothingthatI’mconsciousabout.Itry wanted mycharacterstohavespace. always lyingdown,theobviouschoicewouldhavebeentogowithawideframeandcinemascope–butIwantedagainstwhat’s obvious.I ‘On onehand,Iwantedtogobackaclassicaltypeoffilmmakingwiththefilmacademyratio.Onotherbecausemaincharacteris laughter, whilstalsotakingahauntingsidewaysglanceattheriseofIronGuard. excruciatingpainandhysterical wehavecometoexpectfromRaduJude,thefilmimmersesusinaworldwhichisequalparts young manbeingtreatedforbonetuberculosisinasanatoriumontheBlackSealate1930s.With thepitchblackhumourandmagisterial A looseadaptationofthewritingswoefullyunder-appreciated RomanianauthorMaxBlecher, ofEmmanuel:a tellsthestory Scarred Hearts Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Romanian Format DCP Running Time Year 2016 Country Premiere Status Yorkshire Cinematographer Leading Cast Producer Screenwriter Director Language Spanish Format DCP Running Time Year 2016 Spain Country Original Title Premiere Status Yorkshire UK Distributor Contact [email protected] Sales Company Catalin Cristutiu Marius Panduru Spahiu Serban Pavlu,SofiaNicolaescu,Gabriel Ada Solomon M. Blecher, RaduJude Radu Jude 141 min Romania, Germany Jonathan CenzualBurley Juan LuisSara AlfonsoMendiguchia, Miguel Martin, Jonathan CenzualBurley Jonathan CenzualBurley Jonathan CenzualBurley 97 min El Pastor Verve Pictures Beta Cinema 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 27 Visit Films Visit Elle Driver , Germany 104 min Greek, English Argyris Papadimitropoulos Argyris Papadimitropoulos, Syllas Tzoumerkas Argyris Papadimitropoulos Phaedra Vokali, Dimi Hart Makis Papadimitriou, Elli Tringou, Christos Karamanis Napoleon Stratogiannakis Veslemes Yannis Romania, France, Bosnia andRomania, France, Croatia, Republic ofHerzegovina, Macedonia 173 min Cristi Puiu Cristi Puiu Anca Puiu Apostu, EugeniaMimi Branescu, Mirela Bosânceanu Barbu Balasoiu OFFICIAL SELECTION OFFICIAL Sales Company Contact [email protected] Sales Company Contact [email protected] Premiere Status Yorkshire Country 2016 Year Running Time Format DCP Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Premiere Status Yorkshire Premiere Country 2016 Year Running Time DCP Format Language Romanian Director Screenwriter Producer Leading Cast Cinematographer Winner of best international of what happens when infatuation turns feature at Edinburgh Film Festival, Suntan is an unflinching depiction to obsessionWinner island taking over the local clinic but his whole life is turned finds himself on a small Greek upside doctor, during a mid-life crisis. Kostis, a 40-year-old he buys the drinks and he goes out of his way to keepdown when he meets a group of pleasure-seeking young tourists. They let him tag along because to win back her affection. he takes desperate measures Anna turns sour, when his infatuation with 21-year-old up with their partying antics. However, ‘Suntan was shot during the summertime tiny island of Antiparos, when the place was packed with non-stop party-goers. on the Shooting a film during for me, it was an obvious choice. In his early forties,the busiest time of the season on a Greek island might sound like an impossible mission, but he is a prisoner of his age. Just like them, however, Kostis is an atypical specimen of the adult world. He has no family of his own, unlike most men unable to resist the merciless passage of time. He is faced with five prime examples stand by and watch it wither away, forced to of his own body, he probably never lived to the fullest. It is a time of frolicking, leisure, and, most of youth – and youth is a time of life that has long passed Kostis by, carelessness where the body is king. The eternal of physical Greek Summer provided the perfect for this extravagance of background importantly, craving and everything that goes with it: flirting, boundaries to see how far your body can go. In the casual sex, drugs, alcohol and pushing the I came across a terra incognita of my own – somewhat boundaries and his journey to the unknown land of physicality, exploration of my hero’s a : the coming of middle age film.’ Argyris Papadimitropoulos, Director I ended up discovering ironically, Cristi Puiu (The Death of Mr Lazarescu) takes the dysfunctional family drama to an intense new cinematic high in his latest feature, Sieranevada. Set drama to an intense new cinematic high in his Mr Lazarescu) takes the dysfunctional family Cristi Puiu (The Death of swings from room to room as parallel the camera Bucharest apartment during an incendiaryalmost entirely in a four-roomed family get together, for the priest’s death. The guests wait Neurologist Laryconflicts spiral out of control. meal to commemorate his father’s and his wife, attend a family arrival but start arguing about 9/11. Politics segues into family history guest throws the commemoration into turmoil. and the arrival of an uninvited in 2012, one of my co-producers asked A few years later, the dinner that followed the burial of my father. ‘The idea of the film came from my past, with to veryme if I had any new projects and I had this idea subjectively portray that followed the burial. It also stemmed from my what happened at the dinner piece of using that, as the up to the viewer to build their own observation real pieces of fiction. Then it’s that the stories that make up our pasts are I also wanted to go in a rather extreme direction. The subject story in Sieranevada could take place anywhere: I invite the viewer to work with me. Finally, incidentally difficult to address in broad terms. I try to do my best to reproduce what I’ve experienced and beenof the truth is one that gnaws at me. It’s the long discussions in the first part risk losing the attention of the viewer with, for example, of the film that You through with the precision of my subjectivity. a lot of things, some things But in life, we often talk about sparked a lot of debate amongst the project partners when we were working on the screenplay. the manipulation of information make sense, and others still that are just stupid. And ever since during the Romanian that make sense, others that don’t Cristi Puiu, Director a sort of confusion that I’m trying of truth and lies. There’s revolution, I have been haunted by the subject to portray honestly.’ Suntan Sieranevada 28 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 OFFICIAL SELECTION A UnitedKingdom Two LoversandaBear OFFICIAL SELECTION what wouldyouhave doneifyouwereintheUKgovernment’s shoes?’Amma Asante, Director the ColdWar, Britain’s economicsituationpost-war, andtheinter-continent pressuresthatensued.Thus,giving thefilmchancetoaskquestion: briefly,— foundthemselvesinoncethecoupledecidedtheywantedtolive inAfrica andIwantedtopresentthepredicamentthat the UKgovernment toinclude pointsofviewfromtheotherside,evenifonly to includethatpossiblepointofview andseeitthroughtheireyes.Ialsosawanopportunity uncles —howtheymighthavefelt atthattimewerealeaderfromtheirnationtobringhomeanoutsider tobequeen,andIwantedtheopportunity ofsuchacontroversial move,evenbytoday’sduring colonialtimes,theenormity standards,was huge.Ithoughtaboutmymother, my aunts,my extentbecauseofthat.ThechallengeSeretse’sgaze, andtoslanttheperspective to acertain choicetotakeawhitewomanAfrica tobeaqueen betoldsolelythroughwhiteandmaleeyes— my —thatmightnormally totellatruestory wastheopportunity ‘What drewmetothisstory fromourdowdy post-warpast.’(TheGuardian) relish–directorAmmaAsantegivesusaromantictruestory irresistible storytelling Both sweepingandintimate,AUnitedKingdomillustrateshowlovecan challengetheharshestconstraints.‘With andidealism– terrificwarmth stirwhen hemarriedRuthWilliams,In thelate1940s,PrinceSeretseKhamaofBotswanacausedaninternational awhitewomanfromLondon. In AUnitedKingdom,twoluminousactors,DavidOyelowoandRosamund Pike,bringtolifeoneofthegreatforbiddenromances20thcentury. those statuesconjuredupthattalking,grumpybearwhoiskindofademigod,intheGreeksensehowgodsareperceived.’KimNguyen,Director of twohugefigures,bronzestatues,sittingandleaningback.Andsomehow, Murakami’s work,myunderstanding,experienceoftheArcticand of theworld,literally, Isawasculpture realitykindofbecomessomewhatephemeralandtiedtotheunconscious.Then,atAmsterdamairport, howwhenyou’reattheend IthoughttherewassomethingthatrelatestolifeintheNorth, powerful. interestingandvery and Ithoughtthatwasvery lovers, withoutthebear. readingalotofHarukiMurakamiandnoticedhisbooksfeaturedflawedGreek-stylegods, Thereweretwothings.Istarted camebacktome.Itwasn’t called what filmIwantedtodoandthatstory Two LoversandaBearatfirst.ItwasreallyLucyRoman.two as ifitwassetinthetwenty-secondcentury. We workingonit,butcouldn’t started naildowntheplot[...].AfterWar thinkingabout Witch, Istarted abouttheArctic,butinanewway, and Iwasimmediatelycompelledtowritethescriptforthisamazingstory Arctic,almost kindofthecontemporary setintheNorth story ‘After myfirstfilm,RogerFrappierandImetdiscussedpotentialfutureprojects.Heimmediatelycametomewiththisshort withRoman’s intotheblankwhitewilderness handle itandtheyenduponalife-changingjourney spiritguide,ascenestealingpolarbear. past. LucyandRomanaretwosuchpeopletheirloveaffairissopassionate,itcanbeselfdestructive.Whenduetoleave,can’t toescapeatraumatic effect.ThefilmissetdeepinNunavut,aCanadianregionsoremotetheonlystrangerstherearetrying fantasy toextraordinary A dizzyingArcticsetindieromancedirectedbyKimNguyen(), Two LoversandaBearcombinesintenseemotionalrealismwithhallucinatory (presented in partnership withBrooks (presentedinpartnership Macdonald) Original Music Film Editor Cinematographer Leading Cast Producer Director Language English Format DCP Running Time Year 2016 Canada Country Premiere Status Yorkshire Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 Country UK Distributor Contact [email protected] Sales Company TF1 Jesse Zubot Richard Comeau Nicolas Bolduc Pinsent , DaneDeHaan,Gordon Roger Frappier Kim Nguyen 96 min Patrick Doyle Sam McCurdy Carmichael Rosamund Pike,,Laura Lewy, David Oyelowo Mason, RickMcCallum,JustinMoore- Brunson Green,PeterHeslop,Charlie Guy Hibbert Amma Asante 111 min UK, USA,CzechRepublic 20th Century Fox 20th Century 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com OFFICIAL SELECTION BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 29 The Match Factory Verve Pictures Verve 97 min Nicolette Krebitz Nicolette Krebitz Sascha Verhey Lilith Stangenberg, Georg Friedrich, Silke Bodenbender Reinhold Vorschneider Felix Hüsken Zjednoczone stany milosci Zjednoczone , Sweden 106 min Wasilewski Tomasz Wasilewski Tomasz Kobus Agnieszka Drewno, Piotr Cielecka,Julia Kijowska, Magdalena Dorota Kolak Oleg Mutu Beata Walentowska OFFICIAL SELECTION OFFICIAL Sales Company Contact [email protected] UK Distributor Premiere Status Yorkshire Country Germany 2016 Year Running Time Format DCP Language German Director Screenwriter Producer Leading Cast Cinematographer Film Editor Premiere Status Yorkshire Premiere Original Title Country 2016 Year Running Time DCP Format Polish Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor On her way home from a mundane office job, Ania catches sight of a wolf near her apartment block. Gazing into its wild eyes sets off a deep desire Determined to capture and tame the beast Ania herself becomes increasingly wild, embracing a sexual awakening and a letting go of inside her. all social norms. to some, her animal magnetism attracts others who share her secret yearning. Whilst her new behaviour is repulsive This bold and subversive love story features a daring performance by Lilith Stangenberg alongside a real wolf. looked at each I turned‘I was dreaming that I was running through a forest. I felt that there was something behind me. around, and it was a wolf. We I dreamt the same thing again. I wondered, why am I dreaming this? I started finding out more about wolves, and then I woke up. The next day, other, At the same time, news was coming in that wolves were coming back to Germany due to the open borders what they mean, and what they stand for. not much economic War II. There’s World been any wolves since where there hadn’t from the East. They were finding their way back to Germany, Wolves are living a bit like a ghost town. It’s cities are empty. a fleeing population. Those So there’s activity going on in the east part of Germany. a strange combination of the wild on old military bases. They find their homes in what used to be places where people lived, fought, trained. It’s fascinating when you see a fox in the street. You It’s either tame wild animals or we make them go away. left from human [activity]. We and what’s like they’re claiming back their remember the wildness within yourself. On the other hand, wolves coming back to Germany in those ghost towns, it’s Nicolette Kribetz, Director territory.’ Tomasz Wasilewski is a Polish director growing in ambition and confidence, and of Love is his best film yet. Reminiscent of Kieslowski but and United States of Love is his best film director growing in ambition and confidence, is a Polish Wasilewski Tomasz his own, the storywith a distinctive style of uncertain is set in 1990, the first euphoric, The film follows the intricately year after the fall of communism. marriage, an their lives: a young mother trapped in an unhappy time to change apparently happy women who decide it’s crosscutting stories of four a lonely formerheadmistress in love with the father of one of her students. beauty queen, and a older teacher fascinated with her neighbour, ‘I started had when they were my age. When I started thinking about the choices my parents talking to them about that period, the end of communism, a totally different life to the one I have. That inspired me to go back to that time, but not use politics,I realised that they had totally different choices, were the ones I wanted to And they surrounded by. remember the politics from that time. I just remember the people who I grew up because I don’t my father eyes. After communism collapsed, along with the very this era through women’s few life choices available to them. I solely remember portray, – he felt it was the only way to secure a better for a few years, to earn some money to buy my family an apartment in Warsaw left Poland for New York in the Actually, Germany. moved to West So he left, just like the husband of one of my characters, who’s future for my sister and me. And he was right. the porn one of the original VHS tapes that my father had sent us (minus scene). This happened to that’s scene where they’re watching the video of him, my friends, And there were all of these women, my mum’s at home with my mum and my older sister. a lot of families – a lot of the men left, and I stayed Director Wasilewski, eyes.’ Tomasz were my only environment at home. So I only remember that transformative friends; they time through women’s sister’s Wild United States of Love States United

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 3131 CINEMA VERSA CINEMA Cinema Versa showcases some of the most innovative documentaries of the year alongside a showcases some of the most innovative Cinema Versa profiles radical like Kirsten series of exciting partnership events. Underground Voices personal and mosaic style of documentary Johnson, whose Cameraperson is a completely new, Who Jump, where Danishfilmmaking and original perspectives on political issues like Those Wagner share cameras and directorial credits with African filmmakers Moritz Seibert and Estephan mavericks from Thorsten Schutte’s migrant, Abou Bakar Sidlibe. Music on Film celebrates musical Clan in Denis Hennelly and Tang to the Wu Eat That Question: Frank Zappa in His Own Words classic Rock the Bells. The Forum features collaborations with the Leaf Label and Casey Suchan’s including live performancesJumbo Records with Analogue showcase Patch-work by Richard Formby Matthew Bourne and and we curate a weekend of films at Left Bank Leeds to urban spaces. exhibition, exploring abandoned complement the Abandoned Yorkshire 32 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA Bugs Action Space UNDERGROUND VOICES food systems,what weeatandhowproduceit. Actually, weshould havedoneitdecadesago.’Andreas Johnsen,Director This filmisabout ourfutureonthisplanet,it’s allofus.Sometimein the future,wehavetoreconsider our aboutfood,so without adoubtitconcerns something thatis produced inamoresustainableway, somethingthatmightevenbehealthierforme,mycommunity andtheplanet? simply:WhydoIeatwhat eat?CouldIbeeating I wantpeopletobecuriousother foodsandthenIwantpeopletoaskthemselvesvery the politicallayerhasroomitneeds. Ihadpreviousversionsthatweremorefocusedonthepersonal sideofthecharactersandtheirrelationship. took quiteawhile,andIworkedwith severaleditorssimultaneously. focusedfilm,where I’mquitehappywiththeresult;wemanaged to makeavery year researchprojectonedibleinsects, Iknewwantedtogetonboardandifpossiblemakeitintoafilm. Becauseoftheabundancematerial,it ‘I lovecookingandIthesocial aspectoffood.AndalsoI’mextremelycurious,sowhenmyfriends atNordicFoodLabtoldmeabouttheirthree- ceviche. pillaging giant wasp nests in Japan. Along the way, they use their own haute cuisine skills to whip up dishes as diverse as cricket ravioli and bee larva diversity anddeliciousness,theysetoffonaglobetrottingmissiontochallenge thepoliticsofpalate,samplinggrubsinAustralianoutbackand experimental NordicFoodLabinDenmarkinvestigatethetastinessof insectsacrosstheworld,saidtobefutureoffood.With afocusonfood Threecharismaticyoungchefsfromthe ‘A thought-provokingdocforadventurousfoodiesandenvironmentalists alike’(HollywoodReporter). importantly, thenewinflatablegavespacetofeelingoffuturepossibilitieswhichwehadallfeltduringbuilding.’Huw Wahl, Director insideit.Itwasusedasabreathingmetaphorforbeginningsandendings.Most musicians respondedthroughimprovisation.Myfatherperformed making processwasusedinthefilmasamaking-presentofpast,butcruciallynot‘re-making’.Archivefootageprojectedintospaceand sort offilmsetorpresent-dayarchivespace.Theinflatable was howtotranslatethisintothefinalfilm;whichwouldusenewinflatableasa tellers.Whatresultedwasanongoingconversationbetweenthemakers,andchallenge the willoffilmmakertooriginalstory approximations; use ofsketchescomparedtothearchitectsCADdiagrams;measuringmillimetrebydesignersartists ofActionSpace(1968–1978)throughabondingprocess. new inflatable,wesetaboutactivelyexploringthehistory We grappledwithmyfather’s a designers,architects,musiciansandfilmmakerswhocametogethertobuild a familyrelationshipandresultingincollaborationbetweenartists, practice.Stemmingfrom blurringofboundariesandanexperimentinmultidisciplinary ‘The MakingofthefilmActionSpace(2016)wasanecessary new inflatablesculptureinaphysicalandreflexiveprocessthatraisesquestionsaboutcommunity, ofradicalideas. familyandthehistory onSuperEightfilm.InthisnewfilmHuwby theartists Wahl,whoisthe Turner’s a son,contraststhe originalfootagewiththemakingandtestingof education,publicspaceandplay. imaginativelymobilisedideasofparticipation, works ofart Thedelightthattheirsculpturesinspiredwascaptured Turner practices. Theirinflatablepublic periodofnewandexpandedarts KenandMary foundedActionSpacein1968duringafertile British artists Original Music Film Editor Cinematographer Producer Screenwriter Director Language English Format Digital Running Time Year 2016 UK Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format Blu-Ray Running Time Year 2016 Denmark Country Premiere Status Yorkshire Contact [email protected] Sales Company Autlook Contact [email protected] Sales Company AMM, PhillMinton Huw Wahl, AmandaRavetz Huw Wahl, AmandaRavetz,GrantGee Huw Wahl, AmandaRavetz Huw Wahl Huw Wahl 87 min Nikolaj Hess,Spacelab Anders A.C.Christensen,MikkelHess, Menno Boerema Andreas Johnsen Flore,BenReade Josh Evans,Roberto Sigrid Dyekjær Andreas Johnsen Andreas Johnsen 76 min Huw Wahl 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 33 Cat & Docs 84 min Simon Stadler Simon Stadler Catenia Lermer, Cameleon Film The Ju/Hoansi Bushmen Simon Stadler Matthias Raue Fair, Boris Assmann, Trance 102 min Kirsten Johnson Kirsten Johnson Ness Kirsten Johnson, Marilyn Kirsten Johnson Kirsten Johnson Nels Bangerter Sales Company Autlook Contact [email protected] Sales Company Contact [email protected] Premiere Status UK Country Germany 2016 Year Running Time Format Blu-Ray Language Ju’hoan Director Screenwriter Producer Leading Cast Cinematographer Original Music CountryUSA 2016 Year Running Time Blu-Ray Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor UNDERGROUND VOICES UNDERGROUND A warm and funny reflection on our lifestyle as viewed through the eyes of one of the oldest cultures on the planet. The Namibian Government’s A warm through the eyes of one of the oldest cultures on the planet. The Namibian Government’s and funny reflection on our lifestyle as viewed to our modernhunting ban has put the Ju/Hoansi Bushmen under great to adapt their traditional lifestyle ways. In order to make money they tribe are invited on a trip to Europe suddenly the tablessell their goods to holidaymakers who view them as a fascinating tourist attraction. When the are turned, by the western and they are both mesmerised and bemused world which begins to look very peculiar. ‘A friend of a colleague works for an organisation in Namibia that supports the traditional tribes. They organized a journey for the Ju/Hoansi through decided very experience for the group of former spontaneously to accompany that trip, which was an unaccustomed hunters. We their home country. Tribes met each other and interacted these I realized that it was the first time When we were travelling with the Ju/Hoansi to a Himba Village, moment to share this first contact. The biggest challenge was to get close to them to capture their emotions and It was was an impressing together. was a tough decision between being in empathy andstatements, and at the same time to assist them in these unfamiliar situations. A lot of times it shooting a film. From the Sometimes it was very difficult to ask the people about their view and to film simultaneously. I am the director and the cinematographer. the atmosphere we had come that close without disturbing beginning the concept of Ghostland was to show a neutral and observing perspective. To Director work for only three people.’ Simon Stadler, to be a small, flexible team. That was the advantage, but at the same time it caused a lot of Kirsten Johnson is a documentaryBack to Hell. Cameraperson is from Citizenfour to Pray the Devil cinematographer with an incredible filmography made over the last quarteran extraordinary century many films she’s film, a mosaic of intimate moments from the memoir world adding around the from the daily routine of a up to an unusual documentary encounters that have personally affected her, in a class of its own. She selects a series of and bonding with a family from rural Bosnia. A poetic meditation on truth and the camera. Nigerian midwife to a boxing match in Brooklyn ‘The joys of being a documentary intimacy with the people I film, pursue remarkable cameraperson are endless and obvious: I get to share profound travel, collaborate, and see my work engage with the world. I experience physical freedom, thestories, be at the center of events as they unfold, chance at artistic expression and discovery And yet, moment I hold a camera. No wonder I’ve been doing it for 25 years and love my life. in each are formidable.the dilemmas I face while holding my camera I must face in the moment - how to frame, find focus, There are the concrete challenges choose the direction to follow… this know that much as possible on the evidence of my experience in the footage I shot in the moment. We In making Cameraperson, we decided to rely as fragmentary portrait Our hope is to convey the immediacy of finding is incomplete and are interested in the way it points to how stories are constructed. oneself in new territory the audience a sense of how the accumulation of joys and dilemmas a cameraperson must juggle with a camera as well as giving to you and an acknowledgement of how complex it is to film and be filmed.’ Kirsten Johnson, Director builds over time. Like in the film, this is an invitation Ghostland Cameraperson 34 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA The IslandsandtheWhales The HappyFilm UNDERGROUND VOICES a feelingamongst manythatthiswasatradition wouldend,andthatitshouldbe documented.’MikeDay, Director us.As muchastheydefendthehunting againstoutsidecriticism,theyknow thatitisdeeplyunpopularoutside oftheFaroes,buttherewas supported There couldn’t havebeenafilmwithout theFaroesecommunity, intimewewerereallyembracedanditwasincrediblymoving howmuchpeople Faroes… thatweallneededtohear,that theyweretoxictoeat.Itseemed thesefarawayislandshadastory thepollutionwascomingfromusnot fromthe andPCBs seabirds wereinrapiddecline,the birds’foodsourcesgoneandtheirbelliesfullofplastic;whilethewhales weresoriddledwithmercury wasaboutalotmorethanhuntingseabirdsand whales.Their fewplacestoeatseabirds. Itsoonemergedthattheirstory they areoneofthevery oftheIsleLewis!Whenwetoldthemaboutseabirdhunters they werekeentoshowustheirownhunting,as doing outthereinthegalesnorth ‘I metagroupofFaroesesailorswhile IwasshootingmypreviousfilmTheGugaHuntersofNessfor BBC Scotland.Theywonderedwhatwewere the controversysurroundingwhalingbutincreasingtoxicityof whalemeat,contaminatedbypollutedoceans. and seabirdskeptthemaliveforgenerations,alifetheywouldpasson totheirchildren,buttodaytheyfaceagravethreattothistradition,notfrom Atlantic.The FaroeIslandershavealwayseatenwhatnaturecouldprovide.Huntingwhales Whales isabouttheFaroeIslandsinremoteNorth asbothabeautifullyshottravelogueofanunusuallocationandfascinating newperspectiveontheenvironmentalcrisis,TheIslandsand Serving quantitative process(likescience)saidmoretomeaboutthemeaningandpurposeofthisfilmthananyclearconclusion.’BenNabors,Co-Director toanswer,questions weyearn whetherthereareanswersornot.Theinherentpitfallsofapproachingaqualitativesubjective (likehappiness)witha mundane, personalanduniversal,Stefan’s toseeourmostbasichumanpreoccupationsinsharpfocus:the experience givesustherareopportunity atoncegrandand tobeabetterperson.Bybecomingthesubjectofdocumentary bold begantotakeshape:anhonestpictureofamantrying our data.Ratherthangeneratingcleangraphsandfigurestoanswerthehappinessquestion,somethingmoreambiguous,funny, sad,sensitive,and Stefan’sin 18months—agoodplan.Butdespiteourbestefforts, lifekeptgettinginthewayofourresearch,bleedingintotrialsandskewing We succinct,andsolvable thework.Itseemedstraightforward, meticulouslydesignedtheexperiments,establishedsomerigid parameters,andstarted pointforthisproject. ‘Finding ananswertothecentralquestionofTheHappyFilm—canapersontraintheirmindbehappier?wasstarting documentary,process. Afascinatingandentertaining bothideasandfilmareinfusedwithSagmeister’s ingeniousdesigntechniques. person. Pursuingaseriesofcontrolledexperimentsandselfanalysis,hetriestotrainhismindbehappy. Butreallifecreepsinandconfoundsthe Stones, Jay-ZandtheTalking andbecomeabetter Heads.Sowhyisn’t himselfintoadesignprojecttotry heahappierperson?Hedecidestoturn Stefan Sagmeisterisoneofthetopgraphicdesignersinworld.HelivesadreamlifeNewYork City, designsalbumcoversfortheRolling Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 Country Original Music Film Editor Producer Director Language Format DCP Running Time Year 2016 Country Contact [email protected] Sales Company Contact [email protected] Sales Company Matt Abeysekera,ColinHuebert Sam Citron,AkikoIwakawa-Grieve Ben Wolf Nabors, StefanSagmeister, JessicaWalsh Jonathan Haidt,SheenahHankin,Ben Ben Nabors Sagmeister BenNabors,Stefan Hillman Curtis, Sagmeister BenNabors,Stefan Hillman Curtis, 93 min UK, USA,Austria,HongKong,Indonesia Antony Partos, MikeSheridan Antony Partos, Claire Ferguson,DavidCharap Lampson,NicoleHálová,MikeDay,Mary Mike Day Mike Day Faroese, English,Danish 84 min UK, Denmark,USA Intrepid Cinema Ben Nabors 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 35 Doc and Film Les vies de Thérèse 55 min Sébastien Lifshitz Muriel Meynard Thérèse Clerc Paul Guilhaume Pauline Gaillard France, USA 89 min Williams Roger Ross Ron Suskind Williams Julie Goldman, Roger Ross Jonathan Freeman, Gilbert Gottfried, Alan Ron Suskind Rosenblatt, Owen Suskind, Thomas Bergmann David Teague Griffin, Dylan Stark Todd Sales Company Contact [email protected] UK Distributor Dogwoof Original Title Country France 2016 Year Running Time Format Blu-Ray Language French Director Producer Leading Cast Cinematographer Film Editor Country 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music UNDERGROUND VOICES UNDERGROUND A tender and inspiring portrait of Thérèse Clerc, one of France’s fiercest activists during the last months of her life. Thérèse evolved from a subdued A tender and inspiring portrait of Thérèse Clerc, one of France’s French housewife in the 50s to a feminist activist who fought for abortion Her four children all claim to have had ‘a different mother’, and gay rights. of terminaldepending on what phase Thérèse was experiencing at the time. Confronted by the final stages illness she asks us to witness that which is so rarely talked about: ageing and death. couldn’t know what film I wanted to make, given the circumstances, and this totally unexpected, unsettling request from Therese. But I ‘At first I didn’t I also felt it could be a kind of crutch to help her go through her last moments. say no. Her request was so strong, and it made so much sense to her. her life to convey a message on issues that were veryAnd, above all, it was a politic gesture: keeping on being an activist and using her body and I find it beautiful that she manages until the end to find a way to fight with her age, the place of women, sexuality... such as death, important to her, on the observationown means. Then, the delicate question was to decide what I wanted to tell. Should I just focus of the last moments of her life? Or Invisible Ones?’ Sébastien Lifshitz, Directorshould I talk about the past, and how to do that without reproducing what I had done in The A Love Story (Gabe Schimmel, Monica The film will be screened alongside the UK premiere of the touching documentary short Alzheimer’s: Petruzzelli, Riani Singgih, Amanda Le, USA, 2015, 16 min, [email protected]) Life, Animated is the inspirational storyLife, Animated is the inspirational he discovered a unique way man who was unable to speak as a child until of Owen Suskind, a young autistic characters leads affinity for animated Disney Disney films. Over time, Owen’s by immersing himself in the world of animated to communicate, developed communicate, and connectwatching them, he finds the tools he needs to understand, dialogue in these films, and by repeatedly him to memorize all of the remarkable transformation. has captured the magnificence of Owen’s director Roger Ross Williams with the world around him. Academy Award-winning ‘It was really importantstory not to just re-tell the in the book, because the book all happens in the past. I chose to follow Owen in the present, fallen in love, he is about to become about to graduate from school. He’s and follow him in this really transformative year in his life when he’s a coming-of-age story about a not a film about autism, it’s It’s me it was always a coming-of-age story. independent, and that was really exciting. For life. really about the power of story to transform this young man’s It’s love, and the power of story. young man, and the themes are family, I realised with autism, so I needed to be enlightened, so to speak. I think as I became enlightened, know anyone understand autism, I didn’t I didn’t grown up Owen is wise about life because he’s reality. the audience needs to take that journey about taking the audience into Owen’s too. It was on this diet of story hasare classic morality tales; classic fables that have been told for thousands of years that Disney and myth and fable and these sort of a roadmap, and Owen becomes an expert need to connect as people. It makes us human. It’s taken and updated. Those stories are what we Director on that.’ Roger Ross Williams, The Lives of Therese + Alzheimers: A Love StoryThe Lives of Therese Life, Animated Life, 36 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA Mirrors to Windows: The Artist AsWomanMirrors toWindows:TheArtist &Niki Martha UNDERGROUND VOICES be confinedinany onerole.’SusanSteinberg,Director andawoman,tonot self-esteem, theircommitment totheirwork,vision andtheirhighlypersonalapproaches towhatitmeansbeanartist womenasunderdogs,butratherengagethe audiencewithwomenwhoareempoweredthroughtheir thatthefilmdoes notportray was important aim wastomakeanintimatefilm about anartist’sIt artists’ studio. life.Afilm thatwouldleavetheaudiencefeelingtheyweredroppinginto the to bothgenders.’MirrorsWindows andlifetocreateanintimatecollective biography thatwillstandthetestoftime.My putsthelensbetweenart tomake theirownpaththroughtheworld,hasnotbeenproperlytoldand itisafarmorerelatablestory commitments, compromiseanddetermination filled withthegrittyrealismofnegotiations, ofthefemaleartist, culture asaromanticideal,butwe areliterallymissinghalfthepicture.Thestory –awell-knownprotagonist,hisarchetypehasbeen accepted, celebratedandembracedinpopular ‘There havebeenmanyfilmsonthe maleartist are allunitedbyapassionatebeliefintheirwork.Therewillbepost screeningQ&AwithdirectorSusanSteinberg. careerscoveradiversearrayofmediumsbutthey includingHelaineBlumenfeld,CharlotteHodesandAliceAnderson. Theirindividualartistic artists fromtheirstudiostothegallery, ofthe21stcentury. journeys become artists givingarareinsightintothelivesoften Thisfastpaceddocumentary ofthe evolutionoftenwomen,aged22to82,asthey walls,SusanSteinbergrevealstheintimate journey After threeyearsfilmingbehindthegallery them totheirvictory. Theycrushedallmalecompetitors,whichwasafirst,thatbigdeal.’ Director Tora MkandawireMårtens, move.Theywerepioneersandrepresentedsomethingcompletelynewtothegame–beamingwithcharismaaconfidencethatled each andevery and isquitestrikingtowatch.What’s nottolove aboutM&N?Theirlovefordanceissomethingtheytreatwithpurehonestyandthatcomesacrossin Dancing isreallywhatkeepsthemconnected,it’s callsitan‘infatuation’–whichcomesacrossinthefilm alsothebeautyoftheirconnection.Martha upfront. Words andcommunicatingarehoweveranareathey’re lackingin,theycommunicatebestthroughdanceandexposethemselvesentirely. isrealand –nothingwasheldback,everything andthatkindofhonestywasexactlywhatIwantedtoportray abouteverything and straightforward honest differentasindividuals,whichmakestheirrelationshipthemoreinterestingtoexplore.They’revery decided tocapturethatonfilm.They’revery ‘The firsttimeIsawthemdancewason I Youtube. Iwasinstantly amazed,evenfeltseduced,almostobsessed!Isoexcitedabouttheirenergythat friendship andthepowerofdance. tofigureouttheirrootsandculturealongtheway.with variouslifequestions,andtry &Nikiisadeeplymovingaccountofthefragility Martha inAfricabutnowlivingSweden,thepairgrapple to competitionsacrosstheworldandhighlightsgrowingpressuretheyface.Bothborn asthefirstwomentobecome dance competition,makinghistory followstheirjourney World ChampionsinHipHop.Thisintimatedocumentary street withendlessenergyandhugeamountsoftalent.In2010theywonthebiggestinternational &Niki,youngstreetdancersarmed Meet Martha Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Format Blu-Ray Running Time Year 2016 Sweden Country Premiere Status UK Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format Blu-Ray Running Time Year 2015 UK Country Premiere Status Yorkshire Contact [email protected] Sales Company Contact [email protected] Sales Company Das EFXN.O.R.E,TheRoots,MethodMan Jungle Brothers,PeteRock&C.L.,Smooth Tora ThereseElfström Mårtens, Berhe,Tora Mårtens Erik Vallsten, NiklasNyberg,Senay Nabwire,NikkiTsapossMartha Tora Mårtens Tora Mårtens Tora Mårtens Swedish, English 90 min Nick Watson Rufus Bruce-Chwatt,RaphaellaFearns, David Chilton Blumenfeld Maliheh Afnan,AliceAnderson,Helaine Susan Steinberg Susan Steinberg Susan Steinberg 78 min Susan Steinberg Swedish FilmInstitute 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 37 Thomas Lallier Heymann Films 74 min Thomas Lallier Matthieu Buchsenschutz Jaz, Hopnn, Add Fuel, Eime, Mario Belem Thomas Lallier Ermanno Corrado End2End Beats Germany, Israel, Netherlands, Sweden Israel, Netherlands, Germany, 100 min English Hebrew, Heymann Tomer Heymann Tomer Barak Heymann Avi Belleli Naharin, Ohad Naharin, Tzofia Itai Raziel Ron Omer Alon Greenberg, Ido Mochrik, Ishai Adar Sales Company Contact [email protected] Sales Company Contact [email protected] Premiere Status UK Country France 2016 Year Running Time Format Digital Director Producer Leading Cast Cinematographer Film Editor Original Music Country 2015 Year Running Time Blu-ray Format Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music UNDERGROUND VOICES UNDERGROUND Tower 13 was a apartment the world capital of street art. building slated for demolition that became, for a single month in October 2013, Tower Curator Mehdi Ben Cheikh invited over 100 artists to take over all view of a unique artistic endeavour. fascinating film is an insider’s Thomas Lallier’s Tour Paris 13, secretly and without means. More than 400 artworks were made accessible to the public for 4500 square metres and 10 floors of the the tower from its final – and artistic30 days. But, despite hours of queuing, major media and online coverage, nothing could prevent – destruction. their taste for experimentation, I know that everything‘I know the street artists’ can change in the process. So we worked practices, their vocabulary, its shape, not everything Step by step the film found from the start. was planned I triedlike them: the shooting took a direction, then another... with want to know in advance the approach of the artists in the project. I wanted to go with the flow, to work without prejudice. I didn’t involved had to spend a lot of time there, often without even shooting, just their way of doing, to let myself be guided by the human aspect of this project. We to feel the place, see if we were going in the right direction. The documentary shows how the artists took over the place and made it their own, but and it is about to collapse. It is of Babel, it is brimming with different cultures Like the Tower me, it is a living body. also how I worked with them. To simple: you put artists a hive. The idea is in there and you see what comes out of it. The spectators are looking at a piece of art withouta laboratory, that matters, and that I wanted to conveyYork. For me, it is this aesthetic emotion without knowing if one had an exhibition in or New filter, Director through my work. Street art Thomas Lallier, is not just graffiti.’ Enter the world of Ohad Naharin, renowned choreographer and artistic director of the Batsheva Dance Company. Eight years in the making this Eight years in the making Naharin, renowned choreographer and artisticEnter the world of Ohad director of the Batsheva Dance Company. mesmerising documentary captures the elusive beauty of contemporary process behind Batsheva’s and immerses the audience in the creative dance unique performances. Mr Gaga tells the archive materials and stunning dance sequences, intimate rehearsal footage, extensive unseen Using fascinating story of an artistic genius who redefined the language of modern today. dance to become one of the most talented choreographers working ‘When I started years ago, I had one fantasy in my heart doing this project, almost 8 was to share something that happened to me 20 years which even know have a script, I didn’t a clear narrative, I didn’t have I startedago. That was the only thing I had in mind when filming Mr Gaga. I didn’t much about my character. any kind of dance in my life, in Israel. I had never seen Aviv, Tel who had just moved to a big city, When I was 21, in 1991, I was a young man because I was born with your father in the farm. in a small village, where you work a relative and she told me about this I got a phone call from so I went, and it changed my life thought, I had never heard of him. She told me I must see his show, guy in town, Ohad Naharin – strange name I I entered the theatre in the of my family by going with her. I was sure it was going to be boring, I was just doing a favour to this member forever. hard to put it in words. It was a turning point in my It’s left the theatre feeling like a bird. I wanted to fly. and aftrer 85 minutes, I Aviv, centre of Tel Heymann, Director life.’ Tomer Paris Tower 13 Paris Tower Mr Gaga Mr 38 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA Story ofNight Story S1 UNDERGROUND VOICES impressive density outofthesecarefullyfilteredimpressions.’ UlrichGregor, filmhistorian light and fewnoisesbutdevelops anincomparableintensityof observation, landscapes bynight. Itisborderlineimperceptibleand workswithvery ofNight”(1979),thisintensive,purely visualstudyofEuropeancities’ ‘I willneverforgettheimpressionwe gotwhenwefirstwatched“Story Clemens Klopfenstein,Director, 1978 irritated,butalso putateasebythecities’emptysilence.’ the audience.Theystandinimage justastheaudiencestandsinfilm:bleary-eyed, asbridgesfor ofvariouscitiesand willthushavegreatgeographicalamplitude:(…)Thefewpeople youcanstillseeinthelongshotsserve parts ‘With thisfilm,Iwanttorealisethe physiognomyofaEuropeancitywhichdoesn’t actuallyexistinreal lifebutwhichwillbemadeupofdifferent ofNightisarediscoveredmasterpiecewithhauntingimagesthatlinger inthememory.life itself.Story Screeningfromanewlyrestoredprint. to ,thismesmerisingandsometimesdreamliketableauxofsounds andimagesisapoeticmeditationonsilence,civilisation,perhapseven late 70swhencitydwellersweremovingoutintothesuburbs.Shotover 150nightsincitiesacrossEurope,fromIstanbultoDublin,andHelsinki ofNightisthefirstClemensKlopfenstein’sStory NightFilms(Nachtfilme),odestotheeeriebeautyofurbanlandscape afterdark,madeinthe Giles Barkley, Director cygnets, experiencingsuchaspecialeventastheeggs’hatching.Throughsharingtheirstory, toengagewithnature.’ IhopethatS1inspireseveryone I livebuthavenssuchastheseareconstantlyunderthreatfromencroachingdevelopment.Itwasaprivilegetospendtimewiththeswanandher thatthereisacanalandriversystemwithponds,fieldspocketsofwoodlandrunsclose tothetownwhere on ourdoorstep.Iamfortunate species ofanimalsfromfar-flung locationsaroundtheworld,insomewaysmakingnaturefeelsomehowdistant.Itcanbeeasytooverlookwildlife theirlocalducksandswans.Wildlife filmmakerscanoftenseemtolookforthemostexotic especially children,enjoyfeedingorevenjustobserving IntheUK,muteswansareeasilyrecognisableandcouldbeconsideredaniconofwildlifeintheseplaces.People, and therapeuticforeveryone. parks, lakesandriverscanbefoundinurbansuburbanenvironmentsprovidinganoasisofcalm.Beingconnectedtonaturecsopositive ‘Many peoplearelosingtouchwiththenaturalworld.Town and citydwellersmayfeelthattheydon’t havemuchaccesstowildlifeandnature,though hatch. Thecygnetsbreakfreeandafterrestingawhileatthenest,theytaketowater. to ismissingandshelefttocopealone.Filmedoverfourdays,beginningastheeggsstart has anesthiddenamongthewillowtrees.Herpartner Ona nature filminfavourofadirectencounterwiththenaturalworld,accessibleandrecognisabletoeveryone. Yorkshire lakeinJune,amuteswan eschewingthedidacticvoiceover,S1 isabeautiful,minimalistDIYnaturedocumentary complextechnologyand exoticlocationsoftheBBCstyle Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format Blu-Ray Running Time Year 2016 UK Country Premiere Status World Cinematographer Screenwriter Director Language German Format Digital Running Time Year 1979 Country Original Title Contact [email protected] Sales Company Contact [email protected] Sales Company Giles Barkley Giles Barkley Swan &cygnets Giles Barkley Giles Barkley Giles Barkley 60 min Clemens Klopfenstein Serena Kiefer, ClemensKlopfenstein Clemens Klopfenstein 61 min Germany, Italy, Switzerland Geschichte derNacht Swiss FilmArchive Giles Barkley 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 39 Elle Driver Wide House Wide 118 min French, Finnish, English Cyril Dion, Mélanie Laurent Cyril Dion Bruno Levy Olivier De Schutter, Anthony Barnosky, Cyril Dion Alexandre Léglise Sandie Bompar Fredrika Stahl 80 min French, Bambara Sidibé, Moritz Siebert,Abou Bakar Estephan Wagner Moritz Siebert, Wagner Estephan Signe ByrgeHeidi Elise Christensen, Sørensen Abou Bakar Sidibé Estephan Wagner Sales Company Contact [email protected] UK Distributor Premiere Status Yorkshire Original Title Demain Country France 2015 Year Running Time Format Blu-Ray Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Premiere Status Yorkshire Premiere CountryDenmark 2016 Year Running Time Blu-Ray Format Language Director Screenwriter Producer Cinematographer Film Editor UNDERGROUND VOICES UNDERGROUND Although you could hardly criticise the veracity of the bleak messages in the majority of environmental docs, it’s refreshing to see one as constructive docs, it’s Although you could hardly criticise the veracity of the bleak messages in the majority of environmental the The film follows a group of pioneers who are reinventing agriculture, energy, Tomorrow. and positive as Cyril Dion and Mélanie Laurent’s and education in order to work towards a sustainable future. From urban farming in the desolate suburbs of Detroit to Incredible democracy, economy, Devon, the film is a real inspiration. from participatory democracy in to local currencies in Totnes, Edible in Todmorden, who have forsaken modern‘People often seem to associate environmentalism with the image of sandal-wearing idealists society for an isolated to show that durable do wanted this film to tell a different story, existence in the mountains doing something rustic like sheep herding. We in San Francisco, for example. exist, and that these solutions can also work on a large scale, as is the case with zero waste this model of development remains the example that many other has forged a model of development that is now showing its limitations. Yet The West who are bringing into existence a different vision of the world. West in particular, wanted our film to show people, in the countries are following. We population, and We begin by looking at agriculture, essential to feeding the world’s structured the film by following our own thought processes. We economy and education. The film is structured around 4 questions that are fundamental to the ability of human society to the then we look at energy, raise the questions, then we question the system. And with each question, we go out in search of the answers, of possible responses, and function. We of large-scale solutions, in capital cities, whole regions or entire countries.’ Cyril Dion, Co-director An unprecedented, first person perspective on the experience of African migrants on the threshold of Europe, Those Who Jump is one of the most migrants on the threshold of Europe, Those person perspective on the experience of African An unprecedented, first In Europe on African land. On the mountain Morocco lies the Spanish enclave of Melilla: innovative and powerful documentaries of the year. Mali is one of them – the separating Morocco and Spain. Abou from hopeful African migrants, watching the fence above, live over a thousand person behind it. For 16 months the camera follows his many attempts to cross the border. protagonist in front of the camera, as well as the the stringer we work with, who is a photojournalist first met Abou through in Melilla and Spain and has been working on the issue for over a ‘We because on this hill, in this makeshift camp, people organize themselves in national communities. Hedecade. And he knew the Malian community him, we got into that community and we met several of these men and ended up giving two camerasknew the people from Mali quite well. Through Abou was far quickly we realized that actually the footage we were getting from Baba. Very out – one to Abou and one to another man called Gougourou – it is hope and despair and life and death.’ And that shows ‘This is Mount would say, beyond what we could ever have imagined. Abou death, but on the other hand, we have a lot of joy there, a lot of camaraderie and solidarity betweenalready this juxtaposition. It says, we are living this film, we took the decision to combine this material with the CCTV material which is for us theus. Being transmitted into the process of making so material is so subjective, it’s at the people not as people but only as black dots. And then Abou’s material of violence, of this machine which looks and Moritz Siebert, Directors Estephan Wagner personal, and really gives the people a face.’ Tomorrow Those Who Jump Who Those 40 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA Tony Conrad:CompletelyinthePresent UNDERGROUND VOICES His spiritisvastandtrulyunknowable,butI’mholdingontighttogetasclosethesunpossible.’Tyler Hubby, Director only theyknew, ifonlytheysaw. Tony timeIworkwithhim,wholenewfacetsare revealed. haskeptmeonmytoesandguessingfor20years.Every society. Iamdrawntodifficultandobscuresubjects:theonesthatareharddescribe andhardertoquantify;theonesworldwouldembraceif only ishissabrerattlingatthefoundationsofWestern in cultureinvigorating,itisalsojust, andhasdeeplyresonatedwithmyideasoftheroleart multidimensional subjectwhoseworkhasoccupiednearlymyentireadultlife.Hebeeninspiringandchallenging,inclusiveelusive.Not and whatitmeant.Iwasfilmingwhen a Tony Conradplayedoneofhisfirstpublicshowsasaviolinsoloistandhavebeenfilmingsince.Heis ofmusicianswhowerechallengingwholeconceptswhatmusic was schooltofollowatouringrogues’gallery ‘In theSpringof1994Ileftart video. down withTheFlickerandasanearlyadopterofactivistpublicaccesstelevisionhedemocratisedtheemergingmediumportable onandrecordedthesoundtracktoJackSmith’s theparadigmsofcinemaupside FlamingCreatures.Heturned Underground. Heperformed legendary one oftheoriginatorsminimalismwhoworkedwithStockhausenandLaMonteYoung, ofThe andwasalsoakeyfigureintheformation Velvet thefilmisplayful,irreverentandasradicalitssubject. A tributetooneofthegreatAmericanartists, Tony Conrad’s influenceishuge:hewas Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 USA Country Contact [email protected] Sales Company Tony Conrad Tyler Hubby Procopio Damian Calvo,Fortunato John Cale,Tony Conrad,DavidGrubbs Hubby Paul Williams, ChristineBeebe,Tyler Tyler Hubby Tyler Hubby 102 min Burning Bridges Burning 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 41 MUSIC ON FILM ON MUSIC Zack Taylor Indie Film Netherlands, Germany, UK, USA Netherlands, Germany, 92 min Zack Taylor Petzold Georg Zack Taylor, Zack Taylor Damien Jurado, Ian MacKaye, Thurston Moore Zack Taylor Georg Petzold Daniel Monico, Jordan Moser Arktisk Superstjerne 70 min Norwegian, Sami Simen Braathen Simen Braathen Stig Andersen André Svehagen,Ole Kristoffer Hætta, Lars Nils Rune Utsi Kristoffer Kumar Zaklina Stojcevska Nils Rune Utsi Sales Company Contact [email protected] Sales Company Contact [email protected] Premiere Status Yorkshire Country 2016 Year Running Time Format Digital Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Premiere Status UK Premiere Original Title CountryNorway 2016 Year Running Time Blu-Ray Format Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Cassette is an infectiously enthusiastic examination of the history, cultural influence and unexpected revival of a revolutionary musical format.Cassette is an infectiously enthusiastic examination of the history, Even film is full of labels and tape fairs. Zack Taylor’s after the resurgence of vinyl, few would have predicted a thriving new underground of DIY cassette the mixtape, from Henryanecdotes of surprise success and testimony from influential musicians who have embraced Rollins and Thurston Moore to the compact cassette in 1963, Lou Ottens. diffident Dutch octogenarian who invented Rob Sheffield and Daniel Johnston. The film also tracks down the a radio, the cassette was my way of participating‘Having always had an appreciation for music but never the ability to play anything besides in a tape was laborious and required real time, but themusic. I could never write a song, but with cassettes I could record my own . Compiling the closest we would ever come to gift currency, hard work made it feel legitimate. For those of us who grew up with them, tapes were the ultimate bartering and representative of a specific time and place. with furs or precious stones. Handmade cassettes from the right person were sought-after I thought it fitting to pay my respects to When I read in 2011 that the term to be removed from The Oxford English Dictionary, cassette tape was Soon after beginning my research, I was surprised by the I figured someone ought to give the tape a proper eulogy. the format with a documentary. oration I was planning evolved into an investigation asnumber of boutique cassette record labels that had popped up around the globe. The funeral for themselves within the 21st Centuryto why the cassette tape refuses to die. No matter how small, cassettes have created a niche musical landscape. Zack Taylor Director, No matter what you see in cassettes, each one functions as a tiny doorway can become a creator.’ through which the listener Arctic Superstar is a terrific new documentaryArctic Superstar is a terrific He lives with his mother in the Nils Rune Utsi, better known as SlinCraze. about the only Sami rapper the Norwegiantiny hamlet of Masi on the world who understand it big but there are only 20,000 people in arctic tundra. He dreams of making and his Karasjok, Tromso, four years, going on tour to Murmansk,Simen Braathen followed SlinCraze for almost his language. Director New York, no word for ‘yo!’ coming from a small place. 100 words for snow, hometown. Arctic Superstar is about big dreams York at the time and as I stumbled into 4 years ago. I was working in advertising‘Arctic Superstar is my debut film and it was something in New a side project, photographer Martinportrayed Johansen and I wanted to make a photo exhibition that Norwegian rappers and the places they up their signs on top of mountains and fjords. instead of reppin’ Brooklyn, Bronx or Compton, you would have rappers throwing know, represent. You in living in one of strangest, most desolate places I’d ever been, but he was also rapping when we came across SlinCraze – who was not only That’s speak. this ancient language less than 20.000 people Sadly most Norwegians know veryour people and the things we do know are usually based on stereotypes. I think what made little about the Sámi and foremost interested in music and we shared so many musical references we could connect through.process a little different was that we were first explore this part motivation for making this film.’ Simen of the world and being able to hang out with some really cool people have been a major To Braathen, Director Cassette: A Documentary Mixtape Arctic Superstar Arctic 42 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA Eat ThatQuestion:FrankZappainhisOwnWords A DivorceBeforeMarriage MUSIC ONFILM to graspthecomplexity ofhischaracter, and to feelwiththemanbehindmedia persona.’ThorstenSchütte,Director timetogetintothemodesof Zappa’s bad olddaysofrock ‘n’roll.Thefilmprovidesthe necessary ofhislanguage, expression andintothepatterns itisanexploration ofthephenomenonFrank Zappa,whilestilltakinginto accountthe andamultitude ofliveperformances, with lengthyinterviews who insisttheyknewhim.Loadedinstead withcontemporariesorexperts My filmconsciouslyavoidstheusual trappingsoftalking-headinterviews of speech. use. Hiscommentsonthemusicindustry, religionandtherole ofthestateresonatestronglytoday. epitomizesthe freedom Hisbodyofworkvirtually culture andsociety, ZappaheldcoreAmericanvalues. Althoughhemockedprudishmoralconventions,wassurprisingly anti-hippieandanti-drug andfamily-focused.Perceived asanoutspokencriticofAmerican andmorality—but whowasatthesametimeinherentlyconservative of music,art ‘Beyond theenfantterriblewethink weknow, asensitiveandlevelheaded individualemerges,anindependentthinkerwhopushedtheboundaries of dissentinpopularmusic.Tragically asanessentialdocumentofalostgenius. dyingofcancer atage52,thefilmserves torockmusicinhisearlytwenties.Uponthe1966release ofhisdebutalbum,FreakOut,heswiftlybecamethemostquotablevoice turning fourteen Zappa. Aself-taughtcomposer, musician, bandleader, producerandindependentthinker, hefirsttranscribed avant-gardecompositionsontopaperat music,Frank voicesintwentiethcentury Eat ThatQuestionisaskilfulmontageentirelyconstructedfromarchive footagefromoneofthemostarticulate fortheages.’MatthewHopkinsandBenjaminLankester,captured auniversalstory Directors anincalculable amountaboutchildhooddreams,ambition,familyandgrowingup.We’velearnt andinsodoing focusedourcameraontheordinary freedomalive.Asfilmmakers,weourselvescanrelate.Overfouryears,we’ve Britain canunderstand:leadingdoublelivestokeepartistic in modern creative betweensuccessandfailure.ADivorceBeforeMarriageisn’t justafilmaboutband,itrepresentsstrugglewhichevery musical purgatory a themselvesthroughdeadendjobsandlowpaidgigs.Theywerewritingthebestmusicoftheircareers,butstrandedin to financiallysupport differentsituation-abandfightingfortheirlivestoexistinwildlymusicallandscape,trying when wegrewtoknowthemfoundavery we setouttotellinADivorceBeforeMarriage.ILikeTrainsstory werealwaysoneofourfavouritebands.Ineyestheyrockstars.However, untouchable.Butitdidn’t championedtheideathatmusiciansarespecialpeople-magical,apart, work.Thisis ‘Popular musicinthe20thcentury take over. Told aboutabandstuckinthemiddle. overaperiodof4years,thisiscomingagestory to differentmusicallandscapeasjobs,familyandlifestart playing soldouttoursaroundtheworld.Fiveyearslatertheyfindthemselveslostinavery LeedsbandILikeTrainsthe rock’n’rolldreamaliveasreallifeintrudes.In2007,legendary weretoastofmusicindustry. Theyweresignedand Breaking newgroundfortherockumentary, passionanddedicationtokeep ADivorceBeforeMarriageshowsthestruggletomaintainnecessary Original Music Film Editor Cinematographer Leading Cast Producer Director Language English Format DCP Running Time Year 2016 UK Country Premiere Status Yorkshire Film Editor Leading Cast Producer Director Language English Format DCP Running Time Year 2016 Country Premiere Status Yorkshire UK Distributor Contact [email protected] Sales Company Ian Jarrold,DavidMartin Guy Bannister, AlistairBowis,SimonFogal, Matt Shaw Matt Shaw Ian Jarrold,DavidMartin Guy Bannister, AlistairBowis,SimonFogal, Matthew Hopkins,BenjaminLankester Matthew Hopkins,BenjaminLankester 73 min Willibald Wonneberger Frank Zappa,SteveAllen,Angel Estelle Fialon Thorsten Schütte 93 min France, Germany Sony PicturesReleasing The ProgressFilmCompany 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 43 MUSIC ON FILM ON MUSIC Gebrueder Beetz Germany, Mali Germany, 90 min Lutz Gregor Christian Beetz Fatoumata Diawara, Ahmed Ag Kaedi, Bassékou Kouyaté, Master Soumy Axel Schneppat Michelle Barbin, Markus Schmidt 108 min Jim Jarmusch Jim Jarmusch José Ibáñez, CarterLogan, Fernando Sulichin , , Krueger Tom KurnitzAffonso Gonçalves, Adam Sales Company Contact [email protected] UK Distributor Dogwoof Premiere Status Yorkshire Country 2016 Year Running Time Format Blu-Ray Language French Director Producer Leading Cast Cinematographer Film Editor Premiere Status Yorkshire Premiere CountryUSA 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Following Fatoumata Diawara, shooting star of the global pop scene (and an actor in the recent film Timbuktu), Mali Blues is a musical journey, Timbuktu), Mali Blues is a musical journey, film Following Fatoumata Diawara, shooting star of the global pop scene (and an actor in the recent On rich musical culture and its threat by radical Islamists who had recently attempted to outlaw music under strict Sharia Law. discovering the country’s express themselves through their music, like world famousour way we meet other committed musicians, who are fighting for unity and the freedom to band leader Ahmed Ag Kaedi. Ngoni player and traditional Griot Bassekou Kouyaté, street rapper Master Soumy and Tuareg marriage. ‘I left to be able to write down my ownAs a young girl, singer and songwriter Fatoumata Diawara fled from Mali to escape a pre-arranged her parents’ consent. Fighting this pain ‘Even though I knew it would be difficult for a black woman like me, who split without she says today. story,’ Timbuktu she even appeared in the highly awarded film strongly influenced me and my music.’ Abroad, Fatoumata Diawara made it big as a singer; by . When northern was overrun by radical Islamists, she decided to become active again on behalf of her home country. Mali but also a personal desire. ‘When I learned that music is Now she plans for her very first concert in Mali which is not only a political necessity, need music to survive. It heals our pain.’ way we’re all psychopaths. We musicians are sick, in a prohibited in Mali, my world stopped turning. We in common: their music is stirring, it moves and connectsFatoumata Diawara, Ahmed Ag Kaedi, Master Soumy and Bassekou Kouyaté have one thing people, it comforts the power to fight radical Islam, fight for a peaceful future marked by tolerance. and heals – and it lends them One of the few rockumentaries with some justification for its claim to profile the greatest rock’n’roll band in history, Jim Jarmusch’s terrific new film on Jim Jarmusch’s profile the greatest rock’n’roll band in history, with some justification for its claim to One of the few rockumentaries a fascinating, intimate interviewThe Stooges centres around Ann Arbor Michigan, amidst James ‘Iggy Pop’ Osterberg. Emerging from with his friend, ’ powerfula countercultural revolution, landscape of the late 1960s. of rock ‘n’ roll blew a crater in the musical and aggressive style R&B, and free jazz, the band planted the seeds for punk and alternativeAssaulting audiences with a blend of rock, blues, rock. been calling it a love letter to The Stooges. Why The Stooges? Because it is more a kind of essay – I’ve ‘For me, Gimme Danger is not a documentary, Akron, Ohio, and when I was a teenager the bands, for me and my I come from the Mid West, for me they are the greatest rock’n’roll band ever. has been what spoke to us. And when you look back, you see The Stooges Underground, that’s friends, were the MC5, the Stooges and the Velvet the source. influenced everyone, but that’s imitated, it’s with Jim [Iggy Pop], and he was telling me about some films that were going to be made about hisMaybe seven or eight years ago, we were talking amake would somebody wish ‘I said memorymy but wrong be may I out. coming were that books some sorteda in he, that is way, offended of career, it was you.’ The next day I startedreal, good movie about The Stooges, and I wish how I was going to make this film. It was difficult because thinking about Alive, then Paterson, and I was making Gimme DangerWe made Only Lovers Left I started financing it myself, and then I realised I was out of money. I was going from one editing room in the morningbetween and around these films. In the last months to the other in the afternoon.’ Jim Jarmusch, Director Mali Blues Gimme Danger Gimme 44 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA shot from 8am that morning to4amthatnight.’CaseySuchan,Co-Director shot from8amthatmorning together alotofexcellentpeoplewhowerewillingtoworkforwhatlittlemoneywehad,andtheybroughttheircamerasshot.20cameras.We Wepromoters simplydidn’t trying. attemptanymorebecausesomanyhadbeenburned meeting.Thedayoftheshow wescrambled shotevery we’dcometoappreciateabouthiphopculture.GettingWu-Tangspirit thatencapsulatedeverything togetherseemedimpossible;itwassomething telling,andChanghiscrewwerecompellingcharacters.Therewassomethingintheirunderdog,D.I.Y. worth a dramaticstory risk-everything DVD.SowemetwithChang(theconcert’sinteresting concert founder, promoter, andfinancier). We realizedthatputtingthefestivaltogetherwas and itsaidthattheWu Tang acts–andwethoughtitwouldmakean Clanwasgoingto bethere–togetherwithadiverselineupofsupporting projects wherewecouldseeourvisionallthewaythrough.We intheLAWeekly readanarticle abouttheupcomingRock The Bellshiphopfestival, doing In2004,wewentoutonourowntostart ‘Denis andIhadbeenproducinghiphopdocumentariesforafewyearsatQD3Entertainment. the filmfollowsaguerillaproductionteamastheybattlebrokenequipmentandriotouscrowdsforarrivalofallnine Wu-Tang members. onthelineforhisimpossibledream.Furiouslypacedandricochetingbetweendizzyingdramatichighsdesperatedisastrouslows, his mortgage) Wuthe legendary Tang Weisberg California. ClanfortheRockBellsfestivalinSan Bernardino, (hisreputation,hissanity, putseverything hisfamily, ofentrepreneurChangWeisberg whichtellsthecompellingstory A rarechancetoseetheclassic2004hiphopdocumentary andhisattemptstoreunite Two Trains Runnin’ Rock theBells MUSIC ONFILM Because thecivil rights movementneverreallyended.’ BenjaminHedin,Writer inthedochave adifferentmind,Ithink—though Iamhesitanttospeakforthem. this recognition.But themembersofmovementwho participated white Americacan layclaimto.Itisalegacyand contributionthatbelongssquarely toAfricanAmericans.Thewhites inthefilm,then,testify to of ademocracy—voting,thenuance ofelections,thedebtwehavetoourfellowcitizen—isponderedand reinvented.Thisisnotsomethingthat —a bunchofwordswithoutany corroborativereality—untilthemovement.Invotingrightsmovement inMississippi1960sallthestaples but nobodythoughtthatbeforethe timeofourmovie.Andinthecivilrightsmovementsomethingsimilar happened.Americandemocracyisjusta saysthebluesis America’s ofthiswakingupto blackculturethatoccurredinthe1960s.Nowadayseveryone greatestgifttoworldculture— part then reflectonhowtheansweris different forthewhitecharactersandAfricanAmericans.The whitemembersofthecastcansay:wewere ‘I don’t wishtogeneralizetoobroadly, butitwouldbe interesting towatchthemoviewithquestionofpersonalanduniversal themesinmindand seemed losttotime.Findingthemwouldnotbeeasy. Finally, onJune21,1964,thesetwocampaigns collidedinmemorableandtragicfashion. yearsbefore,SonHouseandSkipJames hadrecordedsomeofthemostmemorablemusictheirera,butnowthey him outofretirement.Thirty would beknownasFreedomSummer. Thatsamemonth,twogroupsofyoungmenheadoutontheerrand:tofindanoldbluessingerandcoax what Mississippi 1964.Theheightofboththecivilrightsmovementand folkrevival.HundredsofcollegestudentstravelledtoMississippi,starting Contact [email protected] Sales Company Original Music J-Force Film Editor Cinematographer Leading Cast Producer Director Language English Format DVD Running Time Year 2006 USA Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format Blu-Ray Running Time Year 2016 USA Country Contact [email protected] Sales Company Seventh Art Releasing Seventh Art Hennelly,Denis Henry CaseySuchan Jeff Bollman,LeifJohnson D.J. Abilities,Babu,JeromeBaldwin Suchan Lowenfels,Casey Dalton,Henry Kurt Denis Hennelly, CaseySuchan 103 min Gary ClarkJr,Gary ChristopherNorth Dava Whisenant Natalie Kingston Taylor ClarkJr., Branch,Gary Common Benjamin Hedin Benjamin Hedin Samuel D.Pollard 80 min Benjamin Hedin 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 45 FORUM Delirio Films Norwegian Film Institute 80 min Delila Vallot Christopher Leggett Rafael Marmor, Ron Finley Asako Ushio David Andrew Sitek , Palestine Norway, 80 min Mohamed Jabaly John Arvid Berger Abu Marzouq Nanna Fran Møller Sales Company Contact [email protected] Sales Company Contact [email protected] Country USA 2016 Year Running Time Format Blu-Ray Language English Director Producer Leading Cast Film Editor Original Music Country 2015 Year Running Time DCP Format Arabic Language Director Producer Leading Cast Film Editor Just 10 miles from Hollywood in South Central is the gangland area of Compton, where in urban farmer Ron Finley’s words ‘the first thing where in urban farmerJust 10 miles from Hollywood in South Central Los Angeles is the gangland area of Compton, Ron Finley’s social challenges who are overcoming the neighbourhood’s you think about is definitely not potential’. Then we meet his crew of renegade gardeners her deft and sensitive approach allows the young people from the by growing their own food. In this new documentary by a young LA filmmaker, future.area, some of whom have other crops on their mind, to reflect on their past and dream of the residents are retaliating by turning patches of Compton’s Finley describes the area as a ‘food prison’ which is exploited by fast food chains, but South soil is still stigmatised by its painful associationunused land into thriving kitchen gardens. In a community where planting and digging the American unemployed teenagers out of is keeping the area’s another reason for the project and that but there’s this is quite an achievement, with slavery, Crips and Bloods, Finley says he can ‘change thetrouble. When the kids are motivated towards community resilience and resistance rather than vernacular some of whom have other crops on their mind, reflect on their past, talk about how they can of what gangster is’. The young people, sensitive approach allows the personalities of the overcome the challenges they face in the here and now and dream of the future. The film maker’s sense of optimism as an inspired group of people of allstreetwise kids to really shine. Her insider perspective on the area lends the film an incredible Garden project has the potential to inspire urbanages, now with the extra option of local healthy food, show the world how the Compton Community neighbourhood activists everywhere. Presented in partnership Ambulance is a extraordinary with the Leeds Palestine Solidarity Campaign, of the last war in Gaza first-person account through experience the war an ambulance crew as war approaches. We and Gaza City resident Mohamed Jabaly joins in July 2014. Filmmaker learns the constant risk of sudden death. Mohamed among broken bodies, terrified families, and eyes as he comes of age to rely on his Mohamed’s captain and crewmates, who in turn support make a film that expresses both the trauma and hope of the too-often invisible citizens of Gaza. him to I was making a documentary Gaza, and while I was for a local hospital in ‘I worked as a photographer and a filmmaker in Gaza prior to the war. hospital and some of the doctors, so I was familiar with working in the medical environment. On theworking there, I got to know the director of the so it really began as a kind of experiment know the driver or the ambulance crew, 8th July 2014, when the war started, I was at the hospital. I didn’t be like, really living in the moment. I wanted to be closer to what was going on, and to relayat first. It was a challenge for me to see what it would people of Gaza know how hard it is to live a life under constant attack, but not all of the people seewhat was happening from my perspective. The lived through 2 wars and 2 Intifada before, nothing prepared me for my experience during the last war. the details up close. Even though I myself had Our ambulance could my neighbours… Every the next… it got worse and worse. It could be my family, phone call was bad news. The next call and like this. I startedbe hit at any time. It was the first time in my life that I was so close to a situation to understand that each TV image is just a small part Director moment to moment.’ Mohamed Jabaly, Even though I had lived all my life in Gaza, I was shocked every day, of a big story. Can You Dig This? Can You Ambulance 46 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA Homo Sapiens The DeclineofWestern CivilisationwithGlenMatlock FORUM by a salt lake, and then the water had sunk again, leaving everything whitefromthesalt…’Nikolaus Geyhalter,by asaltlake,and thenthewaterhadsunkagain,leaving everything Director a criticallookbackwards atmankind…We did alotoffilminginEuropeandthe USA. We foundaplacein Argentinathathadbeenswallowed up point was tofindplacesthatmatched our premise:wewantedtocreate film somehowhad tomoveonconstantlynewaspects. Themostimportant dimensions orbecausetheywerein anadvancedstateofbeingreclaimedbynature.Andwhilewewere editingitquicklybecameapparentthatthe We thatcouldbereadwithoutexplanation,places thatwereimpressiveduetotheir beganconcentratingon searching forplaceswithahistory thattheplaceshadstories withoutnecessarilymakingyousympathizewiththem. interesting.Itwasimportant ruined house–thatwasn‘tparticularly quickly becametrite.Whatweneeded wereplacesthathadstoriesattached,whereyoucouldseewhat theyhadoncebeen.Anemptyfactory, a it inthesenseofabandoned. Placeslikethatareeasytofind,butwediscovered places.Deserted ‘At firstwewerejustlookingfordeserted changing environment. Left BankLeedsandtheAbandonedYorkshire photographyexhibitioncreatedbyacollectiveofurbanexplorersdocumentingour lost heritageand with by anyvoiceoverordialogue,thefilmhasadisquietingpowerand an eeriesenseofthefragilityhumanexistence.Presentedinpartnership outnightclubs, oldcinemas,ruinedfactoriesandemptysilos.Uninterrupted abandoned anddecayingurbanspaces.Emptyofficebuildings,burnt Ironically titledasafilmwhichactuallyhasnohumanbeingsinit,Homo Sapiensismadeupofaseriesbeautifullycomposedtableauxshots Director showandhewaslike,‘Thisisprettyfreaky—maybeweshoulddoit.’’but I’lldoapunkrockmovie.’ItooktheguytoGerms PenelopeSpheeris, it occurredtomethatIneededmakeamoviewaswhenbusinessmanoutintheValley movie,andIsaid,‘Hellno, askedifIwoulddirectaporno tocapturethemoment.I’mstillratherastoundedthat[Decline]gotsomuchinterest…Ihadbeengoingshows. Buttheexactmoment important equipment there.Itriedtoshootasmanyshowscould…didknowthatI’dneverseenanythinglikeinrock‘n’rollbefore,andfeltitwas go domyjobandshoottheStaplesSingersorFleetwoodMacDoobieBrothers,thenIwouldtoapunkclubatnightusesame a researchbankIcouldtapinto,buthadfilmcompany, andIalwayshadequipmentcheckedoutontherecordcompany’s account.SoIwould ‘At thattime,punkwassofreshinL.A.TheymayhavebeenmakingfilmsEnglandorNew York, buttherewasreallynothinghere.Ididn’t have at theBrudenellSocialClub,makingforabrilliantcelebrationofpunkmusicfrombothsidesAtlantic. ItscreenspriortoaneveningwithoriginalSexPistolsbassplayerGlenMatlock andX,featuringtrulywildliveperformances. Black Flag,TheGerms Western Civilization.Filmedfrom1979-1980,itlooksatsomeoftheearliestandmostenduringlyinfluentialLApunkhardcoregroups,including Before directing90sclassicWayne’s World,of withTheDecline filmmakerPenelopeSpheerishadalreadymadeanepochdefiningdocumentary Cinematographer Leading Cast Producer Director Language English Format Blu-ray Running Time Year 1981 USA Country Cinematographer Producer Screenwriter Director Language Format Blu-ray Running Time Year 2016 Austria Country Premiere Status Yorkshire Contact [email protected] Sales Company Contact [email protected] Sales Company Steve Conant Alice BagBand,CircleJerks,X,TheGerms Penelope Spheeris,JeffPrettyman Penelope Spheeris 100 min Nikolaus Geyrhalter Wolfgang Widerhofer Nikolaus Geyrhalter, MarkusGlaser, Nikolaus Geyrhalter Nikolaus Geyrhalter No Dialogue 94 min Austrian FilmCommission Shout Factory 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 47 FORUM Gregg Mitman 120 min Leeds Beckett University UK, USA, Liberia 60 min Gregg Mitman Sarita Siegel, Gregg Mitman Sarita Siegel, Gregg Mitman Miatta Fahnbulleh, Joseph Emmanuel Urey, Saye Guannu Sarita Siegel Sarita Siegel, Reg Wrench Rob Waugh Sales Company Contact [email protected] Premiere Status World Country UK 2016 Year Running Time Format Digital Language English Director Various Sales Company Contact [email protected] Premiere Status World Premiere Country 2016 Year Running Time Digital Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music This powerful documentaryto understand quest 1926 Harvardweaves together rare archival footage from a man’s expedition to Liberia with a young explosive mining and logging concessions. An granted to multinational corporations for agricultural, land has been why 25% of his country’s land grabs transforminvestigation of how large-scale to a one-day environmental world. Followed by Directors Q&A and linked livelihoods across the Taylor Cinema is located in Clothworkers North Building just behind the Parkinson Building on the University of Leeds filmmaking workshop. The Phil campus. Sponsored by the ENHANCE ITN. granted by the Liberian government more than 25 percent of land has been corporations for agricultural, mining, and logging to multinational ‘Today, concessions in the name of international plantation agriculture is altering livelihoods and development. Liberia is a microcosm of the ways in which survivingcultures across the globe. When the earliest known motion picture record of Liberia resurfaced, first corporate documenting the country’s to repatriate the footage to a countryland grab in 1926, it began a collaborative project seeking to write a more inclusive history of its past after This effort investigation into Our Feet, a journey has been at the center of The Land Beneath that became a four-year a brutal 14-year civil war. you displace people from their traditional lands, you also sever their relationships and present-day land conflicts in Liberia. When memory, history, but also a story This film is a storyto histories, memories and stories tied to the land. about empowerment, about loss and memory, and as people Gregg Mitman, Director history.’ government Liberia’s struggle with how to officially recognize community rights to land for the first time in (Jennifer Granville, Jonathan Bairstow, UK, 2016, 4 min) Orgreave. Government v miners, miners v police and brother v brother. 2016, 4 min) Orgreave. Government UK, v miners, miners v police and brother v brother. The Enemy Within (Jennifer Granville, Jonathan Bairstow, family drama that reflects on the realities of what it meant to be Blacker than Black (Natashia Mattocks, UK, 2016, 13 min) Blacker than Black is a 1960’s Mary. daughter, old miner’s seen through the eyes of 14 year a miner, whilst the UK, 2016, 12 min) A young woman becomes a wife, mother and teacher in the heart of coal mining country, A Piece of Coal (Laura Torenbeek, communities around her are in turmoil. community and a lost life. a lost farewell to a lost industry, She Had A Dream (Gabrielle Russell, UK, 2016, 9 min) One man’s trained to be soldiers then they marched to the lines.’Respect (Suzy Catliff, UK, 2016, 9 min) ‘From shops and from fields and from factories and mines. They Respect, tells the story of Jesse, a veteran of WW1 and his daily journey to honour his fallen comrades. freshly deceased, is still - Maggie Thatcher, Coke Not Coal (Jennifer Granville, UK, 2016, 17 min) Here we go, here we go, here we go…Oldthorpe 2013 a veryhated with an undying passion. The villagers unite and come together to give the late milk snatcher irreverent, Oldthorpe send off. (featured image) UK, 2016, 3 min) The Community Shop, a social enterprise, empowering The Community Shop: More Than Just Food (Jennifer Granville, David Turner, individuals and building stronger communities. fight has seen the campaign go from soap box to Facebook, from UK, 2016, 3 min) A 30 year & Justice Campaign (Patricia Doherty, Orgreave Truth banners to tweets to build an entire network of causes and campaigners. Mining the Memories The Land Beneath Our Feet Our Beneath Land The 48 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 CINEMA VERSA November disbelieve MR James:WhistleandI’llCometoYou FORUM they can still change the world. Though this kind of belief might be held as naive, I think they still deserve therighttodream.’ Achero Manas,Director they canstillchange theworld.Thoughthiskindof belief mightbeheldasnaive,Ithink theystilldeserve dangerous, becauseyoungpeopleneedtobelieve anddreamthat way beenpassed downtothenextgeneration.Ithink thisdisillusionmentisvery goesbymercantilerules.What happenedwasthatthepreviousgenerations sawtheirdreamsgo to thedogsandtheirdisillusionhas ina even art Quixote, oftenfoolish,butsometimes wiseaswell…WhatIdidwastakethesamespiritoffreedomand applyittotoday’s consumersociety, where same thinginthe80sand90s,with alotofidealism,almostkindanachronisticnaivety, believingthathecouldchange society?’He’s likeDon Thebasisofthe scriptforNovemberwas,basically:‘Whatwouldhappenifsomeone, ayoungguy,small villages,inthecountryside. didexactlythe in thefilm.Theydidsobecausethey feltthattheyhadtobringtheatreoverpeoplewhocouldnotafford goingtothetheatre,likepeoplelivingin as many independenttheatretroupeslike that,andthemostsurprisingthingaboutthemwasthattheydidnot askforanymoneyfortheirperformances, were ‘El PiojoPiconwasatroupewhich my mothermanagedbackintheseventies,alongwithothertroupesthat hadappearedatthesametime.There with Leeds BeckettUniversityandDisrUPt. no limitsandcensorship.Presentedinpartnership which isfreer, capableofmakingpeoplefeelalive’.Hisconcepttheatreisoutinthestreetsface-to-face,withpublic, straightfrom the heart, of jawdroppingstunts,outrageouslyfunny, shockingandthoughtprovokingallatonce.AlfredoarrivesinMadridintentoncreating‘aperformance styledramafollowingaradicalstreettheatregroupviaseries Spanish dramaNovemberisanundiscoveredgemmadein2003,a confronted byaquestionofthat:‘doIbelieveinghosts?That’s interestingquestion.Thequestionis,isthereasenseinwhichIcouldbesaidto avery toadoptthephilosophicalstylethatpeoplewouldhavehad, Having spentalotoftimestudyingwithphilosophersatCambridge,ItrainedHordern there’s wherethereisnosuchthingasthesupernatural, which wasseeminglysupernatural, onlythenatural. wasplaying,tohimselfbedisturbedbysomething andhowitwaspossibleforanintelligentacademic,asHordern the romanceofsupernatural ofunknowablethreat.ButatthesametimeIwasalsointerestedin theideasofnoisescomingatnightrepresentingsomesort of thesupernatural, becauseasachildIwasfrightenedbytheidea fascinatedbyghosts,partly whichIhadreadasachildandI’dalwaysbeenvery ‘This wasastory Forfulldetailsseealchemyanew.co.ukseries ofliveperformances. andleedsfilm.com screening ofthebestmanyadaptationsJames’s andfollowedbya masterlyghoststorieswillbeenhancedbyhauntinginstallationsandartworks 1968 adaptationofM.R.James’WhistleandI’llCometoYou inacuratedspaceattheatmosphericMillHillChapel.The starring MichaelHordern Shade,LIFFpresentsaspecialscreeningofJonathanMiller’sIn collaborationwithAlchemyandtheireventTheHaunting:GhostsofEvery classic inghosts?’’Jonathan Miller, Director Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format Digi-beta Running Time Year 1968 UK Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Spanish Format Blu-ray Running Time Year 2003 Spain Country Original Title Noviembre UK Distributor Contact [email protected] Sales Company Egeda Pam Bosworth George Woodbridge AmbroseCoghill, Michael Hordern, Jonathan Miller M.R. James,JonathanMiller Jonathan Miller 42 min Eduardo Arbide Nacho RuizCapillas Juan CarlosGómez Óscar Jaenada,IngridRubio,JavierRíos José AntonioFélez Achero Mañas,FedericoMañas Achero Mañas 104 min British FilmInstitute 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com CINEMA VERSA BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 49 FORUM Same Trade as Mozart Same Trade 60 min David Buckton UK Distributor Film CountryUK 1969 Year Running Time Digi-beta Format English Language Director An evening showcasing new short films and artists’ moving image works by artists based in the Creative Director Bryony Bond and North by The Tetley’s of England selected from an open call exhibition, The Scientific Method, upcoming artist and co-curator of The Tetley’s Curator Zoe Sawyer, Chris Fell. For more information Northern about the Open Artists Amelia Crouch and Director of LIFF, Screening see #TheTetleyOpenArtistsFilm. including exhibition opening times, visit www. For more information about all the events at the Tetley thetetley.org See pages 136-137 for details of the short films included in the showcase. How do we make sense of today’s information post-truth politics to mind-boggling overload, from How do we make sense of today’s which Tetley, quantum physics and neuroscience? The Scientific Method is the new exhibition at the shows how artists have revealed universal structures and systems of knowledge, subverting the accepted and confounding the expected. This exhibition brings together recent works by artists such as Pattison, Kate Liston, Amelia Crouch, Patricia Esquivias, Sian Robinson Davies, Liz Magic Laser, with LUX. John Latham, Semiconductor and John Smith. Presented in association KP Brehmer, on first Thu of Exhibition open 22 Oct – 15 Jan, Mon-Sat 11:00 – 18:00*/ Sun 11:00-16:00 (*20:00 each month). Abandoned Yorkshire is a collective of urban explorers whose stunning photography captures lost Abandoned Yorkshire Left Bank Leeds, a once abandoned building heritage and documents our changing environment. easy to overlook of change and development, it’s is a fitting venue to exhibit this work. In an era give us an insight into the past. The exhibition is buildings that are no longer in use but these remains event on 2 Nov 6pm - 9pm. LIFF hosts a series of open from 3-6 Nov 12pm - 6pm, with an opening complementary film screenings at Left Bank on the closing weekend. An unmissable evening dedicated to analogue electronic music presented in partnership dedicated to analogue electronic music presented An unmissable evening Records. Distinguished with The Leaf Label and Jumbo musicians Matthew Bourne Richard Formby and present a collaborative performance Modular and a demo of their analogue electronic equipment, classic documentary era. Followed by a rare screening of the both iconic electronic instruments of the analogue and Moog synthesisers, Same Trade Karlheinz Stockhausen. and iconoclastic composer as Mozart on early electronic music, featuring Daphne Oram of the BBC Radiophonic Workshop music for a In 1957 I was asked to do some incidental extension of the arm‘I want machines, rather like computers to be an of the composer... in the middle of the night, all the tape recorders that I could find in the and I did this in Broadcasting House by getting together, television play, and working until they had to be put back the next morning,studios, collecting them together in one studio sleeping a little bit then coming back in to do my normal chamber music work. I begin with a drawn pattern, this is freehand drawn at the moment, part what of an empirical process to find out pattern makes what sort then I define the pitch by putting digital of sound, having drawn this on a slide, I then present that slide to the equipment, information by drawing in on a 35mm film a wavy line, which onto what I call the programme. I then can also change the pitch in analogue fashion then wavers verygoes up or down the film for pitch change and slightly for giving vibrato and this I think is a very important part of musical sound. I process in the mind of a human being and in this way I get a bit lost when computers come along,think that music should be a projection of a thought give us music by the yard.’ Daphne Oram, BBC Radiophonic Workshop and taking a random number table, then can The Tetley Open: Artist Film Showcase The Tetley The Scientific Method Exhibition at The Tetley at The The Scientific Method Exhibition Abandoned Yorkshire Photography Exhibition at Left Bank Abandoned Yorkshire Patch-work: Analogue Electronic Night Electronic Analogue Patch-work:

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 51 FANOMENON Since launching in 1999, Fanomenon has been a favourite member of the LIFF family of programmeSince launching in 1999, Fanomenon - marathon events likesections for fans of cult and fantasy cinema. Headlined by Fanathons a wide selection of exclusiveAnimation Day and Night of the Dead - Fanomenon also features sensations in Retros. previews from around the world in Fanorama and classic film programme includes the latest (and first non-Japanese) film from Studio Ghibli, The Red This year’s the terrifyingly supernatural Under the from acclaimed animator Michael Dudok de ; Turtle, foreign language entry into the which has been selected as the UK’s Shadow, which has been causing a stir at film festivals around the world. 2017, and the remarkable Raw, off the amazing screen and 7.1The Retros section includes a selection of films chosen to show print of ’s Hall, including a new digitally restored surround sound in Leeds Town favourites, Aliens and . Heat, as well as other audience classic action thriller, 52 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON The MasterCleanse I AmNotaSerialKiller FANATHONS: DAY OFTHEDEAD inspired bythework inWheretheWild ThingsAreandAttack theBlock.’BobbyMiller, Director something tangible, aswitnessedwiththerecentsuccess ofMadMaxandStarWars. Atthesame time,IbelieveCGIisessentialto theprocess.Iwas effects inthefilm. That’s right!Gloriouspuppetsandanimatronics!Ibelievewe arewitnessingabacklashtoCGIintheculture.Audiencescrave first; butifweletitfester, itpreventsusfrommeaningfulrelationships and personalgrowth. To accomplishthisvisualmetaphorweutilized practical For me,themainideainTheMaster Cleansehastodowiththepersonalbaggageweallholdontoin life. Thatbaggagemightbecuteorquirkyat to work. waking upat5amtoaccommodate thissplitpersonality, allowingthe(arguablyweirder)Tub guytore-writehisfeaturebeforelettingtheother guygo like Google,MTV, film] SoulPancake,andBuzzfeed, andtherewastheguywhohadmade[theshort Tub andwantedtomakeafeaturefilm. Ibegan ‘From 2010-2014,Idecidedwould splitmyselfintwo.Therewastheguywhomadealivingwriting/directing/acting indigitalcontentforplaces unusualway. discovers thatthedetoxprocessworksinavery the‘elimination’stepofprogramme,finalstageis‘termination’. Havingsurvived foraspiritual retreatofferingauniquecleansingprogramme.Acceptedasoneofthetestsubjects,Paul the altarwhenhecatchesalate-nightadvert inside.Paul (Galecki)isstrugglingemotionallyfrombeingdumpedat abouttheemotionalbaggagethatweallcarry Houston inadarklycomicstory castincludingAnnaFriel,OliverPlattandAnjelica fame)isaccompaniedherebyaheavyweight support Johnny Galecki(ofTheBigBangTheory between childhoodandadulthood,givingJohnWayne Cleaverarangeandpoweronlyglimpsedatas13-year-old.’ BillyO’Brien,Director andthecharacterofJohn,farfromdelayinshootingbeinganissue,his17-year-oldasateenagercaught selffittedperfectly faith inthestory over,year losingthesnowseasonandhavingtostart wasMax.Would mybiggestworry hestillbeinterested?Andwouldtooold?Maxheld skills asfilmmakerswedecidedtodowhatbest,andgoshootsomefilm.Overthenextfouryears,cameclosebeingfinanced,each Ryan, DP, NickRyan, producer, andmyself–lovedthebookallfeltitwouldmakeanincrediblefilm.Buthowtogetfunded?Lookingatour years off,thoughwedidn’t knowitthen.SincereadingthebookandacquiringrightsfromauthorDanWells in2009,allthreeofus–Robbie locally foundactorsandahugeblizzardmarkedthefirstfilmingofIAmNotASerialKiller. Butthiswasn’t themainshoot,thatwasstillfourwhole ‘Max was13.ThelocationthetownofBayCity, 2011.ThreeIrishfilmmakers,MaxandhisdadShawn,some Michigan,anditwasFebruary playing againsttypeinaroleaboutasfarremovedpossiblefromthelovableDocBrown)whoharboursstrangeandterrifyingsecret. killers toinvestigate,eventhoughitmeansembracinghisinnerdemons.Histrailleadshimaseeminglykindoldneighbour(ChristopherLloyd a misfit,hestrugglestosuppresshishomicidalthoughts.Whenseriesofgrislymurdersoccurinthetowndecidesusehisknowledgeserial John Wayne Cleaver(MaxRecords,WheretheWild ThingsAre)isatroubledteen livinginaremotetowntheAmericanMidwest.Bulliedforbeing Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format Blu-Ray Running Time Year 2016 USA Country Contact [email protected] Sales Company UK Distributor Adrian Johnston Nick Emerson Robbie Ryan Lloyd Max Records,LauraFraser, Christopher Nick Ryan, JamesHarris,MarkLane Billy O’Brien,ChrisHyde Billy O’Brien 104 min Ireland, UK Eskmo, RussHowardIII,RobSimonsen Josh Crockett Michael Fimognari Galecki, OliverPlatt Anjelica Huston,AnnaFriel,Johnny Margot Hand,JohnRaymonds,AlanSimpson Gilbert, Jason Cloth,JohnnyGalecki,Gary Bobby Miller Bobby Miller 81 min The FestivalAgency Bulldog Films 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 53 Signature Entertainment South Korea 118 min Sang-ho Yeon Sang-ho Yeon Lee Dongha, Jang Kyung-ik Jeong Yu-mi Gong, Soo-an Kim, Yoo Lee Hyung-Deok -mo Yang Jang Young-gyu Spain, USA 90 min Carles Torrens Jeremy Slater Kelly Wagner Nick Phillips, Carles Torrens, Solo, JeanetteDominic Monaghan, Ksenia McCurdy A. Burton Timothy Elena Ruiz Zacarías M. de la Riva UK Distributor Studiocanal UK Distributor Original Title Busanhaeg Country 2016 Year Running Time Format DCP Language Korean Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Country 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music FANATHONS: DAY OF THE DEAD THE OF DAY FANATHONS: A box office sensation in South Korea and thrilling audiences around the world, Train to Busan is a highly entertainingTrain zombie action horror layered A box office sensation in South Korea and thrilling audiences around the world, are fighting their way through a countrywide passengers viral outbreak while trapped on a Terrified with social commentary and . -filled, blood-drenched bullet train ride to Busan, a southern resort city that has managed to hold off the zombie hordes… or so everyone Sangho, director of acclaimed including The King of Pigs (LIFF26). to Busan is the debut of Yeon hopes. Train depicts Seoul infested with zombies. While thinking of these‘The story to Busan originates from Seoul Station, an animated film. Seoul Station of Train Busan, which became the inspiration for the live-actionzombies, I wondered what would happen if one of the zombies hopped the train bound for quite a different life from us, but we usually take themfilm. The motif of the animated film is the homeless always residing in Seoul Station. They live for granted as a part myself whether people would easily notice the difference if a homeless person with only half a face of the station. So, I asked Phillips (2013) rather than zombie movies. These filmsleft roamed around the station. I referred to the films such as United 93 (2006) and Captain are fighting zombies in a limited space as well. I also wanted to Busan display incidents realistically in a limited space, since the characters in Train to add a bit of the mood portrayed (2007) and The Road (2009). The former in The Mist explores people stuck inside a market not knowing what’s and son wandering around post-apocalyptic earth.happening outside and how this creates a unique power structure. The latter shows a father Sang-ho, Director and his daughter Su-an (Kim Su-an), I wanted to build an apocalyptic feeling.’ Yeon Through Seok-wu (Gong Yoo) nimal shelter worker. lonely animal shelter worker. as Seth, a socially awkward and desperately psychological thriller starring Dominic Monaghan Pet is a taut and violent some mild cyberstalking he finds girl he remembers from high school. Following the bus he bumps into Holly (Ksenia Solo), a popular home on Travelling even and decides to treat her like humiliated he becomes obsessed with getting plans to ask her out. When he is rebuffed and out where she works and and alone, Holly must use her to survive and figure out how to escape. until she learns to respect him. Terrified one of the animals at the shelter, Hollywood for a while. The character was originally written for Dominic, back when he was playing‘Pet was a screenplay that had been going round get him!’. let’s crazy, idea he was attached to this project, and when the writer told me I thought ‘that’s in the first season of Lost, years ago. I had no I met Dominic and he told me he had been wanting to make Pet for a so we decided to reverse the ages of the characters. But now he was a bit older, Director join forces and do it.’ Carles Torrens, long time. I said ‘well, I’ve been trying for a while too, so let’s to make Pet very important it’s as an actor to tryMy and find things about him that I can understand and empathize with. ‘I like the complexities of the character, try is way in over his head. Carles and I were constantly talking about the fact that he and have him be a sympathetic character who thing was, let’s across as just a gorgeous young lady – but very character comes quickly you’ll realize ‘OK, messing with, and Ksenia’s know who he’s really didn’t Dominic Monaghan I’ve picked on the wrong person.’’ Train to Busan Train Pet 54 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON Peelers The AutopsyofJaneDoe FANATHONS: NIGHTOFTHEDEAD she wasatastrip clubinLasVegas. SevéSchelenz, Director Fromthere,Peelerswasborn.’ aboutsomething thathappenedtoherwhile and somegoodtwists.Devits’eyeswent wideandthenshetoldmea story who kickedass,a deftstory [writer LisaDeVita] andaskedherif shewouldbeinterestedinwritingthescript.Ihadthreerequestsof herandtheywere:astrongfemalecharacter stripper horrorfilmsandoftheones Ifound,theyjustweren’t thatgreat.So,Ifelttherewasanuntapped sub-genreofhorrorthere.IwenttoDevits outtherewerenotalotof I thought,‘Wherewouldweseenudity andacceptitwouldbethere...Astripclub.’SoIdidsomeresearch anditturned blood inthere,noproblem,butwhat aboutthenudity?’Ijustwasn’t interestedinhavinggratuitousbreast shots.Therehadtobeareasonforit.So, that didn’t interestme.Iwasmoreinto anticipation-buildingandpsychologicalhorror. ButIwentawayandthoughttomyself,‘Iknowcan getthe another horror. IaskedhimwhathethoughtwouldsellandI’dseeifit interestedme.Hesaid,‘Morebloodandmoreboobs.’Well, quitehonestly ‘After myfirstfeaturefilmSkewdid itsfestivalrunanddistribution,mysalesagentaskedme,‘So,what’s do next?’HetoldmeflatoutthatIshould bitingpeople,all hellbreakslooseandBlueJeanmustdefendherbar, upandstarts elsewhere. Butwhenaninfectedminerturns hergirlsandlife. anewlife an ex-baseballstar, developersoshecanstart toaneasyclosing night,havingjustsoldthebartoasleazyproperty islookingforward director SevéSchelenzwhowillbeintroducingthefilmandgivinga Q&Awiththeaudienceafterscreening. Tough stripclubowner BlueJean, Night oftheDeadwouldn’t from bethesamewithoutazombiefilmsoprepare yourselfforPeelers,anunashamedlygooeyundeadhorrorfest could feelthatonthepage.ItfeltlikeyouwerereadingaStephenKingnovel.Thesuspensewasbrilliant.’AndréØvredal,Director fascinated bythewholeworld,anddetailofwhatwasthere.Thescriptsocarefullyconstructed,thoroughlyworkedthrough,you read,andsointriguing.Iwasjust into mybedroomandIreaditin45minutes.usuallytakehourstoascript.Itwasjustanamazing,scary ‘Okay, nowlet’s justdoaproperhorrormovie.Let’s justfindaproperhorrormovie.’Then,monthlater, Iwassentthescriptandloved it.Iwent was flooredbyit.Ithoughtitsuchaclever, superbly, well-directed—amasterclassinhorrordirection.Iliterallyjustcalledmyagentandsaid, a coupleofyears,butthennonethemreallymaterialized.Then,Iremember, itwasthesummerof2013,andIcameoutTheConjuring, horror andfantasytoadegree,monstermoviesgenrestuff.Someofthemwerereallyintriguing,Iwasworkingoncouplefor ‘To dotheoppositeofTrollhunter wasabig,big thingforme.AfterTrollhunter, Iwasofferedalotofscriptsinthespacefoundfootage,andalso intofullblownhorror. turns mystery insidethemorgueand injuriesthat belieherpristineoutwardappearance.Astheysearchforcluestoidentityeventstakeacreepyturn internal buriedatthesceneofamysterioussuburbanmassacre.With was foundpartially noapparentcauseofdeaththeybegintheautopsyonlytodiscover ofthecorpseayoungwomanwho father andsoncoronerswhosebusinessisinthebasementoftheirhome.Lateoneeveningtheytakedelivery The directorofTrollas withhisfirstEnglishlanguagefilm,ashockingAmericanGothicbody-horrorstarringBrianCoxandEmileHirsh Hunterreturns Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 Canada Country Premiere Status Yorkshire Contact [email protected] Sales Company UK Distributor Lionsgate Danny Bensi,SaunderJurriaans Peter Gvozdas,PatrickLarsgaard Roman Osin Emile Hirsh,BrianCox,OpheliaLovibond R.Aitken Eric Garcia,FredBerger, BenPugh, Ian B.Goldberg,RichardNaing André Øvredal 99 min UK, USA Vincent Mai Seve Schelenz Lindsay George J.Loos Wren Walker, CazOdinDarko,Madison LisaDeVita, BrendanSmith,Todd Giroux Lisa DeVita, SevéSchelenz Sevé Schelenz 95 min Sevé Schelenz 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 55 Signature Entertainment Matt Stuertz 90 min Steven Kostanski, Jeremy Gillespie Jeremy Gillespie, Steven Kostanski Jonathan Bronfman, Casey Walker Kathleen Aaron Poole, Ellen Wong, Munroe, Kenneth Welsh Samy Inayeh, Cam McLauchlin Blitz/ Menalon Music, Joseph Murray, Berlin 84 min Matt Stuertz Matt Stuertz Sweet Chris Benson, Jamison Larris White Ray, Jenna McDonald, Frankie Chris Benson Matt Stuertz Golczewski Wojciech UK Distributor Sales Company Contact [email protected] Country Canada 2016 Year Running Time Format DCP Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Premiere Status Yorkshire Premiere CountryUSA 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music FANATHONS: NIGHT OF THE DEAD THE OF NIGHT FANATHONS: The Void is a descent into hell complete with monsters, madmen, and mutilation. Created using practical effects, the film recalls creatures from films is a descent into The Void happens upon a blood-soaked figure on a deserted When a police officer stretch of road, as diverse as The Thing, From Beyond and Hellraiser. only to discover that patients and personnel are transforming into he rushes the young man to a nearby rural hospital staffed by a skeleton crew, something inhuman. In a desperate bid to end the nightmare, he leads the survivors hospital. on a hellish voyage into the subterranean depths of the ‘Aaron [Poole, who plays Daniel Carter]amazing. He is the heart was of the movie. I feel that he brought so much to the role and so much to the One concern was that people were going to come that we all had and mainly because he took it seriously. He elevated the whole project character. but he would get right in there and he would bring up things that we into this project and be like this is just a bunch of rubber monsters. Whatever, creature which is something I never thought about! Yeah, never even thought about. Like how the characters would have an aversion to the smell of the was on the page. I guess these creatures would smell horrible. I really think he went above and beyond what We think goes hand-in-hand with being jokey necessarily. agreed on a kind of tone for the movie that we wanted to achieve, and that tone I don’t ‘We of the movie. I think this is like a different kinddiscussed a lot of movies like Prince of Darkness and also The Thing where they have the overall ourselves to tryof tone than what we were used to doing and we wanted really to commit to that and challenge and grow as filmmakers and try to like got a bit more atmosphere to it.’ Steven Kostanski, Co-director make something that’s The gory slasher territorythe Dead 16 takes us deep into 70s and 80s to Night of a group of horny with a remote cabin in the woods, college holiday cabin, her friends team up with When a girl goes missing at her ways and a seemingly unstoppable killer. kids destined to die in horrible they find themselves fighting for their lives. the truth about their friend is revealed and As midnight approaches look for her. a couple of slackers to films and want to be surprised by some pure love slasher people who love horror, for watching with an audience of tailor-made She Comes is Tonight insanity on screen. of characters and letting them have a bit of fun (perhaps too much fun) before throwing something I’ve always loved about taking a handful ‘There’s She Comes was bornTonight out of that very the title in my head for concept. I’ve had how they react. them into a figurative or literal hell just to see wildly different personalities that I always envisioned it as a mix of before becoming the film it is today, years, and while it went through many variations ways in an attempt to stay alive through the night. During the making of the film, there were a few keywould be forced to work together in unexpected immediatelyelements that were crucially important interesting enough that people wouldn’t to me. First off, the characters needed to be both fun and these very since I would be writing, directing, and editing characters for importantwant them all to die horrible deaths. This was also for my sanity, said, at its heartthousands upon thousands of hours. That being these characters inevitably do die horrible deaths, this is a , so when I things that I’ve never even seen before on screen.’ Matt Stuertz, homage to Director and 80’s 70’s wanted to see a wide variety of kills ranging from The Void Tonight She Comes She Tonight 56 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON Kizumonogatari 1+2 Belladonna ofSadness FANATHONS: ANIMATION DAY the animation—the sensation of being dragged into the story whether helikesitornot.’Tatsuyathe animation—the sensationofbeingdraggedinto thestory Oishi,Director endeavored todepictthebeginning ofthese‘stories’fromKoyomi’s pointofview. Andfromthoseencounters,wereally wantedtocapture—through encounters, andyoumighttastefear atothers.Howdothethingsthathappeninthese‘firstencounters’ connecttothe‘stories’thatfollow?We’ve someone forthefirsttimeis,wouldn’t yousay, anexperience thatmesseswithyouremotionsinavarietyofways? You mightfeeljoyatsome where charactersthatappearinBakemonogatari meetforthefirsttime.Hence,wetookcaretoexpress theideaof‘firstencounters’.Meeting to depictthatstreamofemotionsclearly. One thing wekeptinmindwasthatTekketsu isboththeprologueofKizumonogatari andalsotheepisode encounters apparitionsandspecialists forthefirsttime.‘IfIwereinhisposition,whatkindsofemotions wouldIbegoingthrough?’We werecareful inwhichhe atapointwhereheknowsquitelot,but Kizumonogatariisthestory ‘By thetimewegettoBakemonogatari, Koyomiiscertainly vampire criesoutforKoyomitosaveherassheliesinapoolofown blood,allfourofherlimbscutoff. blondeandgolden-eyed Acerola-orion Heart-under-blade,akatheKingofApparitions.Blindingly beautiful,yetchillinglyterrifying,thelegendary by NisioIsinandillustratedVofan. Onefatefulevening,secondyearhighschoolstudentKoyomiAraragihasashockingmeetingwithKissshot animefeaturesfromthe youthhorrortrilogyKizumonogatari,basedonaseriesof‘lightnovels’written A doublebilloftheacclaimedfirsttwoshort rather, inextricablycodependent.’GlennKenny, TheNewYork Times attributesbutare, arenotcontradictory the picture,youareleftwithnaggingsuspicionthatitsretrogradeideologyandravishingimagery Belladonna ofSadnessisundoubtedlyalandmarkanimatedfilm,andarguablymasterpiece.Butit’s disquietingone.Afterexperiencing avery andmuchmore—isdizzying.[...] pornography psychedelia,undergroundcomics,arty fashion magazines,popart, line,getsitsownfour-minute productionnumber.Death, which,ofcourse,spicesupthestory Thevarietyofgraphicmodes—withreferencesto the powertoshock.Thenarrative,howeverimplausible,isseductive.Andmeticulouslyexecutedvisualfreakoutsareawe-inspiring:Black isfrequentlygraphic,andstill,afterover40years,ithas ‘Belladonna ofSadnessiscompulsivelywatchable,evenatitsmostdisturbing:theimagery atmosphere. magical abilities,whileafolk-rocksoundtrackhelpsdefinemedievalyetalsootherworldly French historianJulesMichelet’s ofJoanArcseesherbanishedfromvillageandmakeapactwiththedeviltogain novelLaSorcière. Thisstory dreamy, violent,eroticandvisceral,illustratorJuniFukai’s styleisvividlybroughttothescreenbydirectorEiichiYamamoto inthisadaptationof This rarelyseenJapaneseanimefeaturefrom1973ishailedasoneofthemostinnovativeandhighlyimaginativeanimatedfilmsalltime.Surreal, Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Japanese Format DCP Running Time Year 1973 Japan Country Original Title Premiere Status UK Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Japanese Format DCP Running Time Year 2016 Japan Country Original Title UK Distributor UK Distributor Masahiko Sato Masashi Furukawa Shigeru Yamazaki Shimegi Katsuyuki Ito,AikoNagayama,Shigako Yoshiyuki Fukuda 93 min Kanashimi noBeradonna Satoru Kosaki Rie Matsubara Takayuki Aizu Sakamoto Hiroshi Kamiya,Takahiro Sakurai,Maaya Kubota Mitsutoshi Ishin Nishio Tatsuya Oishi,AkiyukiShinbo 64 +60min Nekketsu-hen Kizumonogatari: ITekketsu-hen &II Ltd. Anime Ltd. 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 57 Basque Films La tortue rouge France, Belgium, Japan 88 min No Dialogue Michael Dudok de Wit Pascale Ferran Michael Dudok de Wit, Maraval, Pascal Caucheteux, Vincent Suzuki Gregoire Sorlat, Toshio Celine Kelepikis Laurent Perez del Mar Psiconautas, los ninos olvidados Psiconautas, 76 min Pedro Rivero, Alberto Vázquez Pedro Rivero, Alberto Vázquez Farruco Castroman Ivan Minambres Aranzazu Calleja UK Distributor Studiocanal Sales Company Contact [email protected] Premiere Status Yorkshire Original Title Country 2016 Year Running Time Format DCP Language Director Screenwriter Producer Film Editor Original Music Premiere Status Yorkshire Premiere Original Title CountrySpain 2015 Year Running Time DCP Format Spanish Language Director Screenwriter Producer Film Editor Original Music FANATHONS: ANIMATION DAY ANIMATION FANATHONS: A truly enchanting and visually stunning new animated feature from Dutch filmmaker Michael Dudok de Wit and the first non-Japanese coproduction Dudok de A truly enchanting and visually stunning new animated feature from Dutch filmmaker Michael from the legendary Studio Ghibli. Entirely dialogue free and combining realism with fairy followsmagical realist storytelling, tales and The Red Turtle a man who is stranded on a beautiful but hazardous deserted island. He struggles against the elements to survive and tries to build a boat to escape before a series of encounters with a mysterious red turtle. if I wanted to make a feature asking me in , ‘It was one of the biggest surprises of my life, such a shock: I received a letter from Studio Ghibli so I was extremely keen. There were three kinds of Away, film. This studio makes truly incredible films, such as Grave of the Fireflies and Spirited ‘actors’: actors who made human sounds, actors who performed certain actions to inspire the animators, and then obviously the animators and visual aesthetic, while retaining their individual style in their assistant animators. Each animator and assistant adapted their talents to the film’s Ghibli, certaindrawings, acting and timing. I was influenced by many things, including the films of Studio cartoons by Hergé and Moebius, and drawings by French cartoonist Sempé. Nature was a particularly important just mean animals and source of inspiration to me. And by that I don’t Director we have with them.’ Michael Dudok de Wit, landscapes, but also light and shade, unique atmospheres and the emotional relationships that Screening with the Oscar winning short, 8 min, Father and Daughter (Michel Dudok de Wit, UK, Belgium, Netherlands, 2000, [email protected]) Psychonauts is a hauntingly strange Basque animation based on the cult graphic novel by Alberto strange Basque animation based on the Psychonauts is a hauntingly in its subversion of the typical Vázquez. Unsettling iconography of cartoons, Psychonauts tells a dark and poetic story and Birdboy are both trying Dinky in the form to a socio-ecological allegory. of Both are persecuted for has been polluted by a terrible industrial accident. atmosphere of the island where they live, which escape the suffocating authorities. Featuring some unforgettably strange and powerfulbeing different, by their families and overbearing animation. As a feature, it is the Award in 2012. with a Goya also based on this graphic novel which was awarded culmination of a journey that started with the short film Birdboy, Birdboy was also shortlisted its category for the Oscar in and earned national and international an extensive list of awards at festivals. the tools of animation and the tools of fairyWe can use ‘This film works like a fairy tales, of this type of fable tale but it is a fairy modern tale in times… One of the forces of narrative in filmmaking is to get empathy and sometimes it creates nice movieswith cute animals to tell stories about all lives… for dreams, these things are sometimes not verywith strong characters but I think there is a margin to easy to show with live action. When we want we the main character, animation is better to transport us to this universe. In a movie, the nightmares of Birdboy, enter inside the mind of a character, a code for representation, sometimes we can qualify in a better way and with bigger animation. Animation is can understand perfectly because it’s lot of tricks, emphasise the sound, in fantastic films, there is a style of using sound and surprises andmeaning. Sometimes with live action, we use a ideas.’ Pedro Rivero, Co-Director with animation and people who work with animation think more about how to represent simpler sometimes it’s The Red Turtle + Father and Daughter The Red Turtle Psychonauts, the Forgotten the Psychonauts, Children 58 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON Assassination Classroom: Graduation A SilentVoice FANATHONS: ANIMATION DAY /FANORAMA some Japaneseyoung adultinsanityandhatsoffto this graduatingclassofassassins.’ BrianKelley, FantasticFest inawaymanysequelsfailtodo.Sosetyour sightsonfun,pullthetrigger develop itscharactersandbackstory takes plentyoftimetofurther ‘Assassination Classroom:Graduation isthesequelwe’veallbeenwaitingforsincelastyear. Inmanyways,itdeliverswhatwewanted,but italso major protagonistsratherthanthe entire ensemblecast.’MarcusGoh narrative focusthatleadstoadefinite endpoint.It’s thatmakes thesequelmoreimpactful,aswellconcentratingonlyon thistighterstorytelling ‘While thefirstAssassinationClassroom wasmorelikeacollectionofanecdotesfromthetitularclassroom, AssassinationClassroom2hasastronger sequel featureslessactionandmoreteacher/classbondingthatat some pointsevenbecomesquitemoving… comes theconcludingsequel,withclassgraduationsetasdeadline forsomehowobliteratingUT(UnkillableTeacher) beforeit’s toolate.The seemedtocapture themood.Butfirstfilmhadanopenendingandforfanswhowantsomeclosure a classofassassinstokillitsavetheEarth of anindestructiblegiantyellowOctopus-likealienteachertraining Assassination ClassroomwasanaudiencefavouritelastyearatLIFF29 –thestory USAMagazine the originalforgreaterimpact.Mostimportantly, Yamada addsasenseofthree-dimensionalitysometimeslackingintheoriginalmanga.’MattSchley, Yamada displaysexcellentfilmmakinginstinctsthroughoutthe film’s impressive130-minuteruntime,tighteningdialogueandrearrangingscenesfrom From thefirstscene(whichroarstolifenotwithasinglefromlatestJapanesebandofmonth,butTheWho’s 1965anthem‘MyGeneration’), her ownasaFilmmakerwithcapitalF. And Tamako Market.WhileYamada’s wereextensionsofthosetwoseries,withASilentVoice, previoustheatricalefforts itfeelsasifshe’s comeinto of31-year-old comes courtesy directorNaokoYamada,That form alreadyaveteranatKyotoAnimation,whereshe’s helmedtwoanimeseries,K-On! material. ButwheretheanimatedversionofASilentVoice shines–andevenimproveson theoriginal–isinform. ‘The mangaASilentVoice, writtenandillustratedbyYoshitoki Oima,isanimpressiveworkinitsownright),andthefilmstickslargelytosource Shoya makeupforhispastmistakes,orwillneverforgivehim? aroundhim.Sixyearslater,Shoko toleavetheschool,andShoyatakesallblame,becomingostracisedbyeveryone thetwomeetagain–can Shoko, agirlwhocan’t hear, entersanewschoolclass,shebecomesthefavouritetargetforabuseofShoyaandhisfriends.Theircrueltyforces A SilentVoice newanimebasedonamangaabouttheconsequencesofschoolbullyingforvictimandperpetrator. isapowerful When Original Music Cinematographer Leading Cast Producer Screenwriter Director Language Japanese Format DCP Running Time Year 2016 Japan Country Original Title Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Japanese Format Blu-Ray Running Time Year 2016 Japan Country Original Title Contact [email protected] Sales Company UK Distributor Kensuke Ushio Kazuya Takao Miyu Irino,SaoriHayami Saiichi Akitake Yoshitoki Oima,ReikoYoshida Naoko Yamada 129 min Koe nokatachi Naoki Sato Mircea Olteanu Tomoo Ezaki Ryosuke Yamada Kazunari Ninomiya,MireiKiritani, Takashi Ishihara,NaokiWatanabe Yusei Matsui(manga),Tatsuya Kanazawa Eiichirô Hasumi 118 min Ansatsu kyoshitsu:sotsugyohen Pony Canyon Anime Ltd. 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 59 FANORAMA Michael Fritz Schumacher Kuripi itsuwari no rinjin 130 min Kiyoshi Kurosawa Kiyoshi Kurosawa, Chihiro Ikeda Osumi Tadashi Takeuchi, Hidetoshi Nishijima, Yuko Kagawa Teruyuki Akiko Ashizawa Koichi Takahashi Habuka Yuri France, Germany, Columbia France, Germany, 65 min Pablo González Salazr Prince Pablo González, Camilo Michael Fritz Schumacher, Ludovic Henry, Philippe Grivel Michael Fritz Schumacher, Laura de Boer, Christian Wewerka Carlos Vasquez Floriane Allier Matthieu Deniau UK Distributor Eureka Sales Company Contact [email protected] Original Title Country Japan 2016 Year Running Time Format DCP Language Japanese Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Premiere Status UK Premiere Country 2015 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Having won best director prize for Un Certain Regards section at Cannes last year, Kiyoshi Kurosawa returns with a terrifying psychological thriller. Kiyoshi Kurosawa returns with a terrifying psychological thriller. Having won best director prize for Un Certain Regards section at Cannes last year, moves to a quiet suburban town seeking peace and solitude, but soon begins to suspect that Ex-police detective and criminal psychologist Takakura daughter approaches him with houses and takes over their lives. One day Nishino’s his neighbour Nishino is a psychopath who comes into people’s vows to put Noshino behind bars before he can kill Takakura a total stranger.’ a shocking confession: ‘That man in my house is not my father… He’s again. ‘It is very I came across this wonderful on which the story novel difficult to make a horror/ with an original story in Japan. Fortunately, is The original story is based on real-life right next door. based. I thought it was a brilliant idea that a criminal you are searching for is actually living events. There were a few very I suppose you can find the continuity from my earlier similar cases to this that took place over 20 years ago in Japan. If a storywork in that the film exists in a space between the ordinary starts and the extraordinary. in a real and ordinary setting, I’m interested in For example, I sometimes have ghosts appear in my films, and I’m interested in conjuring them in quite ordinary gradually morphing into fantasy. recreate the actual crime. I had no intention of bringing any sociological points want to it was based on a real case, I didn’t though settings. In Creepy, problems in contemporary it might touch on some Japan, whether I since it is set in a real society, of view into this film; it is an entertainment. However, meant it to or not. This is why shooting on real locations is more interesting and very filming in a studio.’ Kiyoshi Kurosawa, Director different from González’s feature debut is a dark post-apocalyptic body-horror that asks what would love be like if there was no society, no family, no friends, no no family, love be like if there was no society, body-horror that asks what would feature debut is a dark post-apocalyptic González’s no government, , no internet… no cities, no masturbation has engage in sexual intercourse due to disease, In a world where people no longer him and a sex addict make a deal; she will allow a dealer of masturbation machines of sexual experience. In this bleak reality, become the paradigm spirals out of control. their relationship pleasure. Soon however, to test new devices on her body in exchange for romantic, pink, easy emotion that some pretend it to be, but love as a complex, sometimes good and‘Cord is a movie about love. Of course, not the and tendernesssometimes not so good thing. Love where affection jealousy and manipulation. Love as a disease. Or are as present as possession, as a condition. If you have it, you have to learn thing out of to deal with it. It will change your life and you can either make a good maybe better, it, or you can let it ruin you. The idea was very any of the things that we have today? It was a question: how would love be if there weren’t simple. would probably still want to have sex. And because there thought that, whatever happened, they other the same way? We people love each Would sex would probably become the essential way of communicating wooing and approaching each other, would be none of the conventions we have for it. He lives in a world where this ‘idea’ is no longer recognize finds love through sex but he can’t ‘romantically’. In the first half of the film, Czuperski there. The other half is him trying cope with this new ‘sickness’ that has fallen upon him.’ Pablo González, Director to understand and about the relationship between a girl and her robot. 20 min, [email protected]) Screening with Keep Going (Geon Kim, South Korea, 2015, Creepy Cord + Keep Going Keep + Cord 60 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON Headshot Francesca FANORAMA everything can be a weapon, including furniture andofficesupplies.’SlashFilm canbeaweapon,including furniture everything ofdesperation.Turnsof thefuncomesfrom theresourcefulnessborn withamadmanoutfor blood,anythingand outwhenyou’recaught inacorner ‘Headshot‘s bigpromises areno-holds-barredviolence andasky-highbodycount, theMobrothersdishthatoutwith gleefulgenerosity. Somuch ofblood.’Variety ratchet upthefrequentdigitalspurts chopsticks) thrownintofurther variety, arts upinmassivequantities isshowyactionofboththebullet-balletandmartial this one.Whatitdoesserve withotherimplements (including ofsheer,[...] Interms punchyphysicalvigor, Headshot is aknockout.Ofcourse,realismhardlyonthemenuwithpure adrenalinefantasylike teams withdirectingduoTimo TjahjantoandKimoStamboel(a.k.a.TheMoBrothers)tofillanother twohourswithterrificallyvisceralfightscenes. withHeadshot,inwhichtheIndonesianstar/action-choreographer ofthosefilms,IkoUwais, ‘Fans oftheRaidmovieswillbeon happilyfamiliarturf Uwais kicks,punches,ducks,andflipshiswaythroughtheIndonesian underground. out andthepuzzleofhisidentitybeginstocometogether. TheMoBrothershaveakeeneyeforaction,andtheykeepitcomingatspeedyclipas to theforewhenhetakesonhenchmenofavengefuldruglord.As hebattlesthroughaseriesofdeadlyfights,fragmentshispastareteased The indomitableIkoUwais(TheRaid)starsinthefast,furiousandbrutal Headshotasanamnesiacwhosemysteriouspastakillingmachinecomes and NicolásOnetti,DirectorWriter budgettomakeabigproductionthenatleastwehadsetourselvesthosedetails.Andthinkitworked.’Luciano we didnothavethenecessary also visually, Imeanthecolorcorrection,shootingstyle,usedlenses.Themusichadtosound likeinthoseyears.Theambientsoundandvoicestoo.If the atmosphereofthoseyears.Theideawastofindanaestheticthathaddowith60sand70s.Notonlylocationsanyotheritemsbut We thinkthattheideaofdirectorsattimewastoshoot itwithstyle,usinggloves,traumas,zooms,theunfocused,greatmusic,etc.We love We havenodoubtthatwhatattractedustotheGiallogenrewas itsstyle.TheGiallonarrativewassodifferent,andevenusuallyithadscripterrors. style.Francescaisthat.Somethingsimplebutdifferent. the stylewasunique.That’s buttokeepthatparticular whywedecided to tellasimplestory ‘We simplebut oftheGiallogenre.Ifwerefertogreatgenrefilms,canseethattheirstorieswerevery cansaythatFrancescaisaclassicstory wake. daughter ofarenownedstoryteller, poetanddramatist,wasabductedfifteenyearsago,buthasnowreappeared,leavingatrailofbodiesinher Moretti andSuccoaretaskedwithsolvingthesecrimes,whichappeartobelinkedanunsolvedcasefrommanyyearsago.Francesca,the detail andauthentic70’s style.Apsychopath inaredcoatandleatherglovesisstalkingthecity, cleaningitof‘impureanddamnedsouls’.Detectives Francesca issuchabeautifulandbloodyloveletterto1970’s Italiangiallofilms,it’s hardtobelieveitwasmadein2015,suchistheattention Leading Cast Producer Screenwriter Director Language Italian Format DCP Running Time Year 2015 Country Original Music Cinematographer Leading Cast Producer Screenwriter Director Language Indonesian Format DCP Running Time Year 2016 Indonesia Country UK Distributor UK Distributor Jinga Raul Gederlini Luis EmilioRodriguez,GustavoDalessanro, Nicolás Onetti Lucian Onetti,NicolasOnetti Luciano Onetti 80 min Italy, Aria Prayogi,FajarYuskemal Yunus Pasolang Islan, ,DawidHendrawan,Chelsea M.Wiluan S.Nishimura, W.Olindo, J.Radel, Kimo Stamboel,Timo Tjahjanto 117 min Arrow Films 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 61 FANORAMA Pony Canyon Altitude Film Entertainment Kodomu keisatsu 100 min Yûichi Fukuda Nobuhiro Azuma, Akihiro Yamauchi Marius Katsuji, Yo Fuku Suzuki, Ryo Kudo Shin Hayasaka, Tetsuya Jun Kuriyagawa Eishi Segawa 95 min Simon Rumley Giglio, Marc Haimes, Ben Ketai, Tony F.Mancuso Rob DeFranco, P.Facinelli, Erin Cummings, Mike Doyle, Sean Flanery, Devin Bonnée Milton Kam Robert Hall Simon Boswell Sales Company Contact [email protected] UK Distributor Original Title Country Japan 2013 Year Running Time Format Blu-Ray Language Japanese Director Producer Leading Cast Cinematographer Film Editor Original Music Premiere Status Yorkshire Premiere CountryUSA 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music From one of Japan’s wildest comic film creators Yûichi Fukuda – director of HK: Forbidden Superhero (LIFF27) with its knickers-masked crime fighter From one of Japan’s have been transformed– comes the delightful spoof Kids Police. Chief Onuma and his Special Investigative Division back into their child selves by makes taking over Japan? Kids Police using a mysterious gas. Can Onuma and his juvenile squad still stop Red Venus terrorist organisation Red Venus Naked Gun if Frank Drebin was 8, and countless serious police dramas that it sends up wonderfully. you think of Malone if it was funny, capitalize on the big idea that won us over in the first‘It seems like a lot of films based around bizarre but interesting conceptual hooks fail to actually and of itself. This sortplace, as if the brilliant idea behind them should be enough to justify a whole in of foundation works well for shorts welcome. want to wear out its the film it creates doesn’t or anthologies, but even the coolest film idea in the world needs thorough, clever mining if Police, a film about a hot shot police investigation unit de-aged into children by their nemesis, a large criminal organization known as Red Kid’s gets this pretty much right on. It knows what strings to pull in order to maximize the comic potential of a plot the involves kids acting like police Venus, one of those exploratoryofficers. But at the same time, it feels slightly held back from going totally nuts with it. This is first entries that could be ground a lot already televisions series in Japan, so there’s work for a truly triumphant sequel, should we be lucky enough to get one. (It was a ten-episode not a film filled with huge belly laughs, yet the comedy concept really deserves emphasis. It’s Police’s more where this came from.) The genius of Kid’s on display is almost exhausting after a while.’ Evan Saathoff, Birth Movies Death Following ten years on death row, Garett is executed but not before cursing everyone Garett is executed but As people start involved in his conviction. mysteriously dying,death row, Following ten years on reservationsAdam, a juror who had to set the story about the guilty verdict, takes steps next victim. Simon Rumley straight before he becomes the sense of unease imbuing the viewer with a off-kilter, disturbing films that always feel a little is a master of creating edgy, (Red, White & Blue, LIFF27) reflects Adam’s is no different and his use of editing and music creates a truly unsettling tone which Last Word and foreboding. Johnny Frank Garrett’s mental state. ever-deteriorating Frank Garrett. We pretty amazing and looks uncannily like the real Johnny Devin Bonnée plays Johnny Frank Garrett. He’s have a great cast. ‘We based in Austin The casting director was Karen Hallford, who worked on Red White & Blue. She’s were lucky to get such a good bunch of actors. we really needed the accent. Generally speaking, we tried to be as close to story, a Texan because it’s and the majority of the actors are from Austin; still verythe facts as possible, because every sensitive subject matter. real.’ It’s kind of thing where people watch it and go, ‘But this isn’t film gets that drew me in. what incredibly unusual and that’s family is still alive. If you do some research about this case online, though, it’s Johnny Frank Garrett’s a verythe film. Hitchcock was very write this script, so it’s much like that, too. But I didn’t done, that’s I’m a stickler in the way that once the script is see my flavour to this film in the directing. In the can You about pushing the audience in ways I had done previously. different approach—it wasn’t Director Rumley, Simon or have no control over.’ written experience, to do something I haven’t script, not so much per se, but it was an interesting Kids Police Johnny Frank Garrett’s Last Word Last Garrett’s Frank Johnny 62 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON also based on the mermaid myth,aboutamotherlynchedtodeathwhileswimmingoffshore. also basedonthemermaid Accompanied byKindil(DamienOunouri,Algeria,,USA,2016,41min,[email protected]),aharrowingdrama Nine InchNails.’IndieWire expect fromAgnieszkaSmoczynska’s dementednewmusicalthatbridgesthegapbetweenHansChristianAndersenand TheLure, awonderfully andyou’llhaveafaintideaofwhatto ‘Imagine ifGasparNoéand(thelate)AndrzejZulawskicollaboratedonaremakeofTheLittleMermaid Mindhorn The Lure+Kindil FANORAMA that Mindhorn is embraced with the long-haul fanboy fervour thatsomething likeShaunoftheDeadreceived.’ LittleWhiteLies isembracedwiththe long-haulfanboyfervour that Mindhorn isagrotesquewhoyoufinally cometoempathisewith–there’sMoon ispresent, but Thorncroft humanity athiscore.Fingerscrossed ahard earned feels likehe’s pushingtoohardforeffectordebasinghimselftherequirements ofthestory. The flouncing,pretentiousghostofjazzwarriorHoward –it’s expositionhe’sperformance astounding justthesheernumberoffunnylineshenails,aswellamount ofdry abletofunnyup.Andit never ‘All hailJulianBarratt,starofthisexceptional –andexceptionallysillyBritishcharactercomedy. [...]Barrattdelivers apantheon-levelcomic co-star/paramour PatriciaDeville. days,professionalcredibilityandevenromancewithformer greatest triumphsforonelastchance toreignitehisglory the islandhadeverseen…Decades later, tothesceneofhis returns ashisnemesis,Thorncroft whenaderangedManxcriminal demandsMindhorn escapedandfledtotheIsleof Man,torecuperateintheisland’sthe truth’.Mindhorn temperate microclimate, andbecamethebestplain-clothesdetective a capturedMI5Special Operative,BruceMindhorn’s As eyewasreplacedbyasuper-advanced opticalliedetector, whichmeanthecouldliterally‘see Washed-up playingthetitularIsleofMansleuthwitharatheruniqueability. peakedwithhit’80sdetectiveshowMindhorn, actorRichard Thorncroft feature filmdebut. We’re delightedthatJulian,SimonandSeanwilljoinusforaQ&Aafterthescreening. Two ofBritain’s withaward-winningtheatre directorSeanFoleymakinghis reuniteinMindhorn, bestcomedyactorsJulianBarrattandSimonFarnaby what my imagination soaked with. I was much more inspired by Homer than Disney in terms of a mermaid tale.’AgnieszkaSmoczy ofamermaid what myimaginationsoakedwith.IwasmuchmoreinspiredbyHomerthanDisneyinterms is vodkas,theglamouramidstpoverty fromtheCommunisterawhichendedwhenIwasabout12.Theweirdlostcharacters,warm dance hallparties ‘The Lureisagenrehybrid.It’s alovestory, amusicalbutalsoreveriefantasyhorror. Iwasmostly inspiredbythekitschyworldofbig Anadultfairytale. Kitsch, surreal,anarchicandunashamedlyfeminist,thisdarkmusicalcomedyhorroristheantithesisofDisney’s TheLittleMermaid. anewlife. unsuspecting humansbutwhenSilverfallsinlovewithamemberofthehouseband,sheriskstheirdreamswimmingtoAmericastart GoldenandSilverwashupinWarsawWhen mermaids theyareadoptedintothecabaretata localstripclub.Goldenishappytofeastonthe Director Agnieszka Language Polish Format DCP Running Time Year 2015 Poland Country Original Title Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2016 UK Country Contact [email protected] Sales Company WFDiF Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter UK Distributor 92 min Córki dancingu Keefus Ciancia,DavidHolmes Mark Everson David Luther Harriet Walter, SteveCoogan Julian Barratt,SimonFarnaby, EssieDavis, Jack Arbuthnott,LauraHastings-Smith, Julian Barratt,SimonFarnaby Sean Foley 89 min Balladay iRomanse Jaroslaw Kaminski Jakub Kijowski Mazurek Kinga Preis,MichalinaOlszanska,Marta Wlodzimierz Niderhaus Bolesto Robert Studio Canal Smoczy ń ska ń ska, Director 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 63 FANORAMA Soda Pictures Ma vie de Courgette France, Switzerland 70 min Claude Barras Céline Sciamma, Gilles Paris (novel) Armelle Glorennec, Pauline Marc Bonney, Gygax, Max Karli, Kate Merkt, Michel Merkt Sixtine Murat, Paulin Gaspard Schlatter, Jaccoud David Toutevoix Rotelli Valentin Sophie Hunger Spain, USA 108 min J.A. Bayona Siobhan Dowd Patrick Ness, GhislainBelen Atienza, Alvaro Augustin, Barrois Lewis MacDougall, Sigourney Weaver, Felicity Jones Oscar Faura Jaume Marti, Bernat Vilaplana Fernando Velazquez UK Distributor UK Distributor EOne Original Title Country 2016 Year Running Time Format DCP Language French Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Country 2016 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music (presented in partnership LUX Prize) with the Another late addition to the LIFF programme is a treat for animation fans, the delightful new French feature, My Life as a Courgette. A bigAnother late addition to the LIFF programme is a treat for animation fans, the delightful new film has appeal for both adults and children and is wittily written by Girlhood director Céline Cannes Film Festival, Claude Barras’s hit at this year’s filled with other sudden death, he is taken to a new foster home his mother’s After boy. Sciamma. Courgette is the intriguing nickname for a 9-year-old orphans his age. At first Courgette struggles to find his place but eventually learns to trust, finds true love and at last a new family of his own. The story and its tone brought me back of age story. ‘I fell in love with Gilles Paris’ book, Autobiography of a Courgette, a tender and poetic coming Boy: Remi, Belle and such as The 400 Blows, Nobody’s to my childhood and reminded me of my first emotional flutters as a moviegoer watching films public a bit of these wondrous and formative this animated film adaptation, I wanted to share with today’s Sebastian, Heidi, and even Bambi. With emotions that have nurtured But this film is also, and above all, an homage to neglected and mistreated children who do and shaped my experience. the best they can to survivehis mother, and live with their wounds. Courgette, our hero, has been through many difficult times and, after having lost in his new life in the foster care centre: having a grouphe believes he is alone in the world. That was without counting on the people he would meet has many things to learnof friends you can rely on, falling in love, and why not even being happy one day? He still in life. It is this message, at once this message was what guided me during the course ofsimple and profound, that seemed essential to convey to our children. And the wish to share directing the film.’ Claude Barras, Director Based on the acclaimed novel by Patrick Ness, this darkly alluring film from director J.A. Bayona (The Orphanage) tells the story from director J.A. Bayona (The Orphanage) novel by Patrick Ness, this darkly alluring film Based on the acclaimed of a young boy blows; his mother (Felicity Life has dealt Conor O’Malley some devastating dreams and fraught reallife circumstances. doubly assailed by frightening offers no consolation, and he is bullied Kebbell) is not part grandmother (Sigourney of his life, his Weaver) his father (Toby Jones) has terminal cancer, at school. Conor has nowhere to turn, until he receives a nighttime visit from an enormous, tree-shaped . figure out why they worked so well: what was it about them that clicked with the audience? I started‘After the success of my first films, I wanted to work, and about the psychoanalysis of fairyreading about the meaning of stories, how they Monster tales, and I really got sucked in. Then the book A could be an official way for me to startCalls appeared on the scene, and I thought it on that, since I liked the analogy between the main working author who always wrote from a need to seek it out and reveal it. Siobhan Dowd was a children’s to tell the truth and the director’s need character’s very of loss. was ill, she decided to write a book so that the little ones could get to grips with the feeling respectful angle, and when she found out she his tale, looking for the light at the end of the tunnel: I added in the idea and I did the same with the story, What Patrick Ness did was take possession of and nor did I want the want the creature to grab more attention than the story, down from parents to their children. I didn’t which is passed of the legacy, human characters. So we tried to build a monster that was as simple as possible, startingspecial effects to overpower the scenes with the with the idea Antonio Bayona, Director the kid in the film, would become.’ Juan would also be the man that Conor, of the purity of a male figure: the idea that this My Life as a Courgette A Monster Calls A Monster 64 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON Raw The NoondayWitch FANORAMA what’s insideofthe body, whatcomesout ofthebody. Director Myparents aredoctors,soIamvery, obsessed withbodies.’JuliaDucournau, very In mypreviousmovies, I’vealwaysworkedwiththe body, I’mobsessed withthebody. Myvisuallanguageisthrough the body, showing thebody, not atopicIwant towriteabout.It’s waytoodarkforme.Andthencannibalism. that? Ithoughtaboutthethreetaboos ofhumanity. It’s murder, movie.Secondthingisincestand,honestly, butweseemurderinprettymuchevery it’s worst thingmycharactercando?’ That wouldcreatearejection,aninstantrejectionfromtheaudience? AndhowamIgoingtokeeptheminspiteof interesting. Toaudience intheroom?Ithoughtthat wasvery makethischallengeevenmoreinterestingandtogo tothefullest,Ithought,‘What’s the moral standards.It’s alwayshardtokeeptheempathyonanycharacter, butespeciallywhenthecharacter actsinhumanly. How doyoukeepthe totheir audience throughoutthemovie.Iwanted themtofeelempathyforsomeonewhowasgoingcommit an actthatwascompletelycontrary themoodof tothink aboutthemovieisscript.Iwantedtosetmyselfawritingchallenge, thatwastosubvert ‘The firststepintostarting consequences ariseasJustine’s trueselfbeginstoemergeandshedevelopsaninsatiablelustforflesh. college.Almoststraightaway, older sisteratveterinary firsttime.Unexpected sheisledintoaninitiationritualandforcedtoeatrawmeatforthevery InJustine’s of-age dramathattakesagruesomecannibalisticturn. isavetandvegetarian.Now16,sheleaveshometojoinher familyeveryone offaintingaudiencemembers, JuliaDucournau’sCausing astiratfilmfestivalsafterreports remarkabledebutfeatureisanunforgettable coming- heatwave, there’s nowheretohide.’Jiř just asunavoidablenightis.Thelightenticescuriosity, notterror. Butthat’s you.Andduringascorchingsummer themonster luringyoutotorture I foundtheprincipleofdaylighthorrorquitelogical.Monstersthatarenotafraidtocomeoutindayworsethanoneshide.Dayis wekeptasmallnumberoflocationsandactors,ashadoriginallyexpected. Nevertheless, around 185,000EUR.AfterAň outasasmall‘hauntedhouse’debut.Atthebeginning,projectwasonlymeanttohavebudgetof has itontheirshelf.Thefilmstarted way, Potter–everybody whichmaynotsuiteverybody, Harry butforme,Kytice,thecollectionofpoemsfeaturingballad,isa19th-century ‘One hundredTheNoondayWitches couldbeconceived,andnotasingleonewouldsimilar. We approacheditinabitofanunconventional menace andforeboding. Reminiscent ofTheSpirittheBeehiveandReflectingSkin,Noonday of Witch mixesfantasywithrealitywhichimbuesthefilmasense she liesabouthisdeathtoheryoungdaughter. Whenthelieisexposedtheirrelationshipbreaksdownandamysteriousfigurebeginstostalkthem. toherlatehusband’s WhenEliskareturns most ofthedramaandsuspensetakingplaceinbeautiful,sundrenchedcornfields. anewlife villagetostart Based ontheSlavicmythofNoonwraithaboutamonsterthatstealsawaynaughtychildren,JiríSádek’s debuteschewshorrorconventions,with a Geislerovácameonboardandwedecidedtoshoot35mm,realisedthatitwasn’t asmallfilmanymore. í Sádek,Director Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Czech Format DCP Running Time Year 2016 Country Original Title Polednice Premiere Status Yorkshire Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language French Format DCP Running Time Year 2016 Country UK Distributor Universal Contact [email protected] Sales Company Barletta Ben Corrigan Michal Lansky Alexander Surkala Zdenek Mucha A Matej Chlupacek Michal Samir Jiř 90 min Jim Williams Jean-Christopher Bouzy Ruben Impes Oufella Garance Marillier, EllaRumpf,RabahNait Jean deForets,AntounSehnaoui Julia Ducournau Julia Ducournau 95 min France, Belgium ň í Sádek a Gaislerova, Karolina Lipowska, Gaislerova,KarolinaLipowska, 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 65 FANORAMA Rai Com Graniet Films Lo chiamavano Jeeg Robot 112 min Gabriele Mainetti Nicola Guaglianone Giuseppe Giglietti, Gabriele Mainetti, Jacopo Saraceni Claudio Santamaria, Luca Marinelli, Stefano Ambrogi Michelle D’Attanasio Federico Conforti, Andrea Maguolo Michele Braga, Gabriele Mainetti 96 min Alex van Warmerdam Alex van Warmerdam Eurydice Gysel, Marc van Warmerdam, Koen Mortier Dewispelaere, Alex van Warmerdam, Tom Maria Kraakman Erisman Tom Job ter Burg Alex van Warmerdam Sales Company Contact [email protected] Sales Company Contact [email protected] Original Title Country Italy 2015 Year Running Time Format DCP Language Italian Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music CountryNetherlands 2015 Year Running Time DCP Format Dutch Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music vers a dark, gritty, Jeeg Robot breaks the mould and delivers a dark, gritty, In a world where nearly all superhero movies follow the same bland structure, They Call Me violent story gains superpowers after falling into toxic set in the seedy underbelly of Rome. Petty and low level gang member Enzo accidentally As he starts a psychopathic gangster called ‘The to use his new abilities to commit bigger crimes he unwittingly angers waste in the river Tiber. further complicate matters, Enzo is befriended by Alessia, a traumatised girl who mistakes him for the personification of the hero in her Gypsy’. To favourite cartoon. ‘The production side of the film was very was the idea of using genre: in 2010, Romanzo daunting, as there were lots of action scenes. Then there was only room for comedies or arthouseCriminale was just getting going and they said to me ‘look, nobody wants genre in Italy’. There films made on a shoestring. So I said to myself: I have to do something otherwise scepticism of something I’ll go mad. It was tiring trying down [the producer’s] to wear stopped us, least of all the budget, and genre filmsnew and different, which nonetheless had all-Italian roots: in the 60s and 70s we did it all; nothing the way it worked out. It was importantcould be made with very for us to create a little. I ended up producing the film myself and I’m happy that that’s relevant to them, when it addresses a modern-day issue, otherwise risk just attracting genre fans. That’s you real world. People go to see a film when it’s Bella Monaca because we needed an area full of conflict where people we chose the microcosm of where the theme of terrorism came from. Yes happen in the centre of Rome. But this film has wider appeal, everyoneuse weapons, which doesn’t can relate to it.’ Gabriele Mainetti, Director A hilarious black comedy of violent errors from Dutch filmmaker Alex van Warmerdam. Schneider, a , gets a call from Mertens on the morning Warmerdam. Schneider, van of violent errors from Dutch filmmaker Alex A hilarious black comedy an easy ‘It’s Bax, a writer who lives alone in a secluded place. The target is Ramon Schneider. He has a last-minute assignment for of his birthday. to be a simple hit turns back home before noon.’ What was promised a little luck you’re ‘A darkly absurd out to be more than expected. job. With Reporter)and richly cinematic showdown’ (The Hollywood capable of an incredibly technical director, is headed. On one hand, he’s where van Warmerdam ‘It would be unwise for audiences to second-guess juggling complex and seemingly contradictory But he while also orchestrating tension in such an unusual environment as this lakeside setting. tones, the one to tell this storyalso makes counterintuitive choices, including in full sun. The sun beams down on them, desaturating incidents that another Moves, the greatest evil unfolds in plain view — only great, ironically titled Night As in Arthur Penn’s director might choose to hide in murky shadow. Variety boast existential implications, but is content to settle for a laugh.’ here, such wickedness doesn’t started He believes that it all when we read found me tough to handle. My little brother has a theory. ‘I was always a difficult child and my parents first books of shorta canal. It was at that moment that something stories as children. One of them is about a girl who drowns in one of Ian McEwan’s Warmerdam, Director in my work.’ Alex van was triggered in my mind, and now it is reflected They Call Me Jeeg Robot Schneider vs. Bax vs. Schneider 66 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON The Wailing Under theShadow FANORAMA of communication.’ NaHong-jin,Director nature andwewouldrealisethathe isdifferentandthatevencommunicationimpossible.Iwantedto expressthefearcomingfromthisimpossibility threat throughsomeonewithsimilar physicalcharacteristicstoKoreans.ThisiswhyIcastaJapaneseactor. Astimewentby, hewouldrevealhistrue threat deepinside.Ifeltthatthiswould bemoreterrifyingthanadynamicthreat-somethingdwellinginside andnotvisible.Iwantedtoshowthis his castle.Strangersinvadeyethe doesn’t knowiftheyarealliesorenemies.Thiswasthekindofthreat thatIwantedtoexpress.It’s likea hidden is defendinghimselfwithashieldfrom somethinglikeknivescomingbeforehim.He’s morelikesomeonewhoishidinginacastleandmustdefend ‘Here, thefigureoffatherwants todefendandprotecthisfamilyfromagreatthreat.Butwhatisthis kindofthreat?Thefatherisn’t someonewho unknowingly escalatingthesituationintosomethingfarmoredangerous. ‘Abullettrainoflaughs,gore,frightsandfolklore.’(ThePlaylist) seemingly noreason.Astheinvestigatingofficerwatcheshisdaughter fallunderthesamesavagespell,heagreestoconsultashamanforanswers– tohysteria astheybeginkillingeachotherinbrutaloutburstsfor rural villagecausessuspicionamongthelocals–whichquickly turns thrillerfromHong-jinNa,directorofTheYellowAn unbelievablytensesupernatural Sea(LIFF25).Astranger’s mysteriousappearanceinaquiet, from the‘80s,bothourownandfamilyfriends’,justcollectedimages.’BabakAnvari,Director I leftIranwhenwas18/19,sowentbacktomymemories,andhadfoldersofreferenceimages.througholdfamilyalbums audience willalwaysfindsomething’s abit phony ifyoudon’t getitright,ifyoudon’t havethatsenseofauthenticity. Sothatwasreallykeyforme. specificandIdidn’t wanttoannoythem.AndIthoughtevenaninternational this doesnotlookanythinglikeIran!’Iranianaudiencesarevery I wassoworried–therearemanyfilms,especiallyHollywoodfilmsbeingmadeaboutIran,thatasanIranianwhenwatchthemthink,‘whoa, ofinspiredbypeopleI’vemetinmylifewhenIwasgrowingupIran. them. Eventhecharactersinfilmaresort arechatsIhadwithmyparentsandstoriesheardfromrelativesfamilyfriends,obviouslytookinspiration things thatinspiredthestory inIran duringtheIran-Iraqwar,‘I wasborn andbythetimewarended,Iwasmoreorlesssameageaschild inthefilm,soalotof might besometruthinherdaughter’s wildstories. wills betweenmotheranddaughter. thataDjinnhasstolenhertreasureddoll.Asshegetsincreasinglyupset,motherrealisesthere Dorsaiscertain thefilmintoaterrifyingghoststory. elementsthatslowlyturn combined withsupernatural of MuchlikeTheNoonday abattle Witch, thefilmportrays for2017.SetinTehranentry inthe1980sagainstabackdropofpost-revolution war, thefilmisafascinatingwindowonIranianhistory, skilfully Under theShadowhasbeengainingcriticalacclaimsinceitscreenedatSundanceandnowchosenasUK’s foreignlanguageOscar Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Persian Format DCP Running Time Year 2016 Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Koren Format DCP Running Time Year 2016 Country Original Title Goksung UK Distributor Kaleidoscope UK Distributor Vertigo Gavin Cullen,Will McGillivray Chris Barwell Kit Fraser Naderi Narges Rashidi,Avin Manshadi,Bobby Emily Leo,OliverRoskill,LucanToh Babak Anvari Babak Anvari 84 min UK, ,Jordan Jang Young-gyu Kim Sun-min Kyung-pyo Hong Hwang, Do Won Kwak,Woo-hee Chun,Jung-min John Penotti Hong-jin Na Na Hong-jin 156 min South Korea 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 67 Park Circus UK, USA 137 min Hill Walter James Cameron, David Giler, Gale Anne Hurd, , David Giler Carrie Henn, Michael Sigourney Weaver, Biehn Adrian Biddle Ray Lovejoy James Horner India, USA 90 min Elizabeth Chai Vasarhelyi Jimmy Chin, Shannon Ethridge, ElizabethJimmy Chin, Chai Vasarhelyi Grace Chin, Jimmy Chin Conrad Anker, Jimmy Chin, Renan Ozturk Bob Eisenhardt UK Distributor Country 1986 Year Running Time Format DCP Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Country 2015 Year Running Time Blu-Ray Format English Language Director Producer Leading Cast Cinematographer Film Editor Original Music J.Ralph UK Distributor MOUNTAIN FILM / RETROS / FILM MOUNTAIN (presented in partnership Armouries and Leeds Dock) with Royal James Cameron’s thrilling follow-up to is one of the greatest action films of all time as well as a sci-fi classic. For its 30th anniversary, Aliens thrilling follow-up to Alien is one of the greatest action films of all time as well as a sci-fi classic. For its 30th anniversary, James Cameron’s Hall with a unique opportunityof the M41A Pulse Rifle, the iconic weapon of the filmis presented in Victoria to see an actual screen-used example of Firearmsintroduced to Ripley by Corporal Hicks as his ‘personal friend’. Jonathan Ferguson, Curator at the Royal Armouries, will introduce the This event is presented in partnership with Leeds Dock. screening with a short and its place in film history. talk about the Pulse Rifle Later on it turned out that everybody‘I was asked to write a story but us thought that the film could be made without Sigourney based on Ripley. we were concerned, which completely blew my mind, and was absolutely out of the question for us. So, as far as we started with Ripley from Weaver, We people involved. were able to overcome these obstacles in the minds of the other We, fortunately, the end of the last film, and it was her story. had to fight very hard for Sigourney to be in the picture, which to me was crazy... screenwriter], but I read an interview with him that said that he was typing away one night at 4 o’clock in the know Dan O’Bannon [Alien’s I don’t morning, alien did that,’ and he realized that the word ‘alien’ stood out on the page. It was very and he was writing, ‘the alien did this, the much it was just right. It was succint. It had all the power of thelike that for me on this film. I was writing away and it was ‘aliens this and aliens that,’ and a sequel, without having to say Alien II... ‘ James Cameron, first title, and it also implied the plurality of the threat. It also implied, of course, that it’s Director Aliens Meru Films about mountaineering and extreme sportsFilms about mountaineering them on the big screen. The most with fans around the world eager to see are a growing phenomenon, greatest ever best professional climbers and their of the decade, Meru is a captivating documentaryacclaimed mountain film about three of the world’s harshest elements in an and nature’s as they battle their complicated pasts, inner demons Jimmy Chin and Renan Ozturk Anker, challenge. Follow Conrad stunning mountain cinematography. Fin peak of Mount Meru in the Himalayas. Featuring attempt to confront the formidable, unconquered Shark’s this incredibly difficult expedition was special. Then you look for the story:‘The fact that they shot this themselves while on they had these built-in challenges, obstacles, and a journey and actually come to life on screen, so it was to go on. In this case, the characters all could express themselves throughline that could allow people who are not climbers, access to this elite world. It was a greatjust about finding the right pieces and an emotional were so lucky for what we had. I’d never because there is no such thing as re-shoot on Meru. We puzzle. It was a wonderful constraint, honestly, Co-director Chai Vasarhelyi, worked with that type of constraint before.’ Elizabeth were always apparent to me, but almost so obvious that I overlooked them. I knew I wanted to make‘Chai brought out a lot of ideas and themes that mentorship – these aspects of that I found really importanta film that really showed the friendship and But when to me from my experiences. to it.’ Jimmy Chin, Co-director hard to describe it. Chai, coming in from the outside, really gave an objective viewpoint you’re that close to it, it’s 68 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON In aGlassCage Heat: NewDigitalCinemaRestoration RETROS children in the camps left a mark on me. Little by little, the story started takingshape.’AgustíVillaronga, started Director children inthecamps leftamarkonme.Littlebylittle, thestory reading alotaboutNazism;concretecases liketheexperimentsledon of themind,how can itblurtheboundariesbetween goodandbad?Istarted for Nazism.Itwasatimethatallowed impunity. Intimeofwar, youhavemorepower. –howcan war leadtodegeneration Icouldtransposethestory interestedin.ButtheHundredYears’ thatIwasvery on thisstory War tookplace inadistantpast,almost700yearsago.SoIdecidedtochange it Joan ofArcintheHundredYears’ War. working Thismanhadassasinatedmorethan400children. GeorgeBataillewroteabouthim.Ithusstarted ofGillesdeRais, aMarshalwhohadfoughtalongside of vampirism–peoplewhotakeadvantage ofothersalwaysinterestedme.Iknewthestory experience lifethroughapersonwho feedshimandtellswhat’s points.Theotherwastheidea happening outside.Thatwasoneofthestarting ‘It wasmyfirstfilm.Iwantedto work ontheideaofsomeonewhocan’t livelifebyhimself.Ithought about someonelockedinaroom,whocanonly the UKforfirsttimein30years. victims,drivenbyrevenge. AppropriatelyLIFF30bringsthefilmtobigscreenin comes tonursehimbutissoonrevealedbeoneofhisformer to Pasolini’s Salo.Followingafailedsuicideattempt,ex-NaziwarcriminalKlausisdependentonanironlungto live.AyoungmannamedAngelo studyontheextremesofhumancorruption,oftencompared and awe.Atthetimemisjudgedmisunderstood,itisnowconsidered amasterful Agustí Villaronga’s astoundingfeaturedebutaboutabuse,revenge,andmadnesspremieredattheCannesFilmFestival in1986toamixtureofshock that arenotdissimilartothewayyouthink.’MichaelMann,Director personal—thekindofintimacyyoucanonlyhavewithstrangerswhothinkinways dialogue scenethatIwroteandputinthemovie,butitwasvery you acupofcoffee.’Theywentin,satdownandhadcoffeeattheBeldenDeli,whichisnolongerthere.kindversionthatsame him. Thetwoofthemseeeachother;agunfightmighthavebrokenoutintheparkinglotrightthenandthere.ButAdamsonsays,‘Comeon,I’llbuy gettingoutofhiscartogoinforacupcoffee.Neilknewhewasbeingwatched—andwhohadbeenwatching already beensurveilling, atalittleshoppingcenterinChicagoonLincolnAvenue,admire. Charliewasdroppingoffhisdry-cleaning andhesawMcCauley, whohehad It’s difficultrockfacehe’s smart. kindoflikearockclimberhavingadmirationforvery very goingtoscale:thechallenge ofthecourseiswhatyou disciplined,andvery, professional,very about howinterestingthisguywas.CharliehadgreatadmirationforNeilasathief,becausehewasvery ‘Heat beganreallywithafriendofminenamedCharlieAdamson,whokilledtherealNeilMcCauleyinChicago1963;he’dbeentellingme and destructive,astheybothrealise,they’lldowhatever’s tobringtheotherdown. necessary De NiroplaysamasterthiefwhomeetshismatchwhenlatestheistdrawstheattentionofPacino’s hardenedLAdetective.Thesearemenobsessed DeNiroandAlPacino’sLIFF30. FromitsspectaculardowntownshootouttoRobert first-eversharedscene,Heatisepicandgrippingentertainment. Michael Mann’s tocinemas,newlyrestoredinadigitalprintwhichisreceivingoneofitsfirstscreeningsat breathtakingactionthrilleris settoreturn Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1995 USA Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Spanish Format Blu-Ray Running Time Year 1986 Spain Country Original Title Premiere Status UK Contact [email protected] Sales Company Filmax UK Distributor Elliot Goldenthal Hoenig, Pasquale Buba,,Dov deNiro,ValAl Pacino,Robert Kilmer Brugge Linson,MichaelMann,PieterJan Art Michael Mann Michael Mann 170 min Javier Navarrete Raul Roman Jaume Peracaula Paredes Gunter Meisner, DavidSust, Marisa Teresa Enrich Agustí Villaronga Agustí Villaronga 110 min Tras elcristal 20th Century Fox 20th Century 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 69 RETROS Manga Entertainment Park Circus 102 min Koike Takeshi Yoshiki Enokido, , Yoji Sakurai Koike, Masahiro Fukushima Yukiko Asano Aoi, Tadanobu Kimura, Yu Takuya Takizawa Ryu Kawanishi Naoki Satoshi Terauchi, James Shimoji 136 min Lilly Wachowski Lana Wachowski, Lilly Wachowski Lana Wachowski, Berman, Bruce Andrew Mason, Joel Silver, Erwin Stoff Fishnurne,, Laurence Carrie- Anne Moss Don Davis UK Distributor UK Distributor Country Japan 2009 Year Running Time Format DCP Language Japanese Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music CountryUSA 1999 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Buckle up for the exhilarating adrenaline-filled music-pumping sci-fi anime ride of Redline! The most dangerous and exciting car race in the universeBuckle up for the exhilarating adrenaline-filled music-pumping sci-fi anime ride of Redline! is held only once every five years. While organised crime and militaristic governments aim to leverage the race to their own ends, elite drivers try driver As JP falls for rival a reckless daredevil driver oblivious to speed limits with his ultracustomised car. to stake their claim to fame, including JP, Sonoshee, will she prove his undoing, or can a high speed romance surviverace? a mass destruction the directorial than originally planned. Given that it’s ‘Redline was in development for over half a decade, finally being released several years later – Fist Trava Koike (key animator on , Dead Leaves and Samurai Champloo, and director of the short OVA debut feature of Takeshi and presumably swallow up a hefty budget. All ofPlanet) it seems slightly unusual that allowed the production to drag on for so long, which begs one obvious question – was it all worth it? The simple answer is a resounding yes. [...] For a start, Redline looks like nothing you’ve easy to see that Koike is a huge fan of western graphic art, by French comic artist and has been influenced as much Jean ‘Moebius’seen before. It’s Wars movies as much as he has by the likes of Katsuhiro Giraud, the US animated film Heavy Metal, cult UK sci-fi comic 2000 AD, and even the Star different styles – somewhere in the visual chaos itOtomo, Hiroyuki Imaishi or Leiji Matsumoto. Not that Redline feels or looks like a mash-up of of parts,unrelentingly throws at its audience it becomes something that is far more than the mere sum a unique piece of animation that at times doesn’t Maughan, Anime News Network even feel like anime in the traditional sense.’ Tim The second half of the ‘90s was ending up shortThe second half of the ‘90s fantasy blockbuster that everyone of the kind of must-see then finally out of nowhere talks about and plot, jaw-dropping action sequences, sci-fi hit wowed audiences with its reality-shattering dystopian ’ in 1999 came The Matrix. The Matrix in a digital cinema print in just striking poses in their coats. Revisit and Morpheus effects, and even Neo, Trinity stunning sound and visual Hall. the spectacular setting of Victoria extremely high in detail and brothers wanted to be able to create is a world of machines and creatures that were ‘The other thing that the Wachowski the alternativeextremely abstract in nature. They came out of artist, comic crowd, and their main conceptual Geoffrey Darrow did amazing front- plus absolutely fluid motion could be done in CG or even animatronics. had not seen evidence that this level of detail end work. The Wachowskis They looked at various films such as ‘Aliens’, but nothing in CGI that had been done in this category. That was in 1996, when there was no material two years from first conceptual to finding people who could reach what they wanted to do. Thewas at their expectations. So they waited for almost were taking their conceptuals and assembling creatures, before we even got the job. This made a bigwhole time we were getting to know them, we effects supervisordifference.’ John Gaeta, Visual Redline The Matrix The 70 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON Roadside Assistance Pearlies The MidnightShift The ManWhoCaughtAMermaid The Frozen Eye The Call DARK OWLSINTERNATIONAL FANTASY SHORTS COMP decidedly nastyplans forher–butshe’s not atallwhatsheseems. A mysteriouswomanstrandedby the sideofroadhitchesaridewithpassingstranger. He has Contact [email protected] Perschbacher Baird EditorPeterOsteboMusicCory CinematographerAndrewScott Director BearsFonteScreenwriter Producer AmyMartinez English Premiere StatusYorkshire USYear FormNarrativeCountry 2015RunningTime7minLanguage up forsale.Theyjustdidn’t reckononapsychoticmousewith apenchantforhumanteeth. Following hisgrandmother’s passing,youngTheohelpshisfathertoemptytheoldhousebefore it’s put Contact [email protected] Laurent Witz CinematographerSergeBenassuttiMusic MathieuAlvado Running Time13minLanguageFrenchDirectorPascalThiebauxScreenwriter PascalThiebauxProducer Premiere StatusYorkshire 2015 France,LuxembourgYear OriginalTitle QuenottesFormNarrativeCountry a deadman. fortheunexpectedwhenhisfirstclientis re-tellingoftheboatmanmyth,thingstakeaturn this modern While ontherunfrompoliceabankrobbertakescoverastaxidriverduringnightshift.In Contact [email protected] Andreas KyriacouCinematographerKoprivaEditorDinosGregoriouMusicConstantinosEvangelides Running Time14minLanguageGreekDirectorAndreasKyriacouScreenwriterProducer Premiere StatusYorkshire OriginalTitle marriage. Butashisgrasponrealitybeginstofray, onedayhecapturesthecreatureofhisdreams. puttingconsiderablestrainonhis becomesobsessedwithcapturingamermaid An elderlyfisherman Contact [email protected] Bajrovic CinematographerJordanDowdingEditorKaitlinTinker, JackWilson MusicPhillipKlimek English DirectorKaitlinTinker ScreenwriterKaitlinTinker, Jean-PhilippeLopezProducer GeorgeRubanov, Clare AustraliaYearPremiere StatusUKFormNarrativeCountry 2015RunningTime16minLanguage into obsessionandmadness. life ofthebeautifulyoungwomanbelow. Atfirstheresiststemptation,butthesituationdegenerates moves intohisnewflathefindsaholeinthefloor,When Bernard enablinghimtospyontheprivate Contact [email protected] Ouelhaj, MaximeMuccinCinematographerBrunoDeGraveEditorMusicNox Time 28minLanguageFrenchDirectorKarimOuelhajScreenwriterProducer Karim Premiere StatusUKOriginalTitleL’Œil BelgiumYear SilencieuxFormNarrativeCountry 2016Running Benoît beginstoundergoastrangetransformation. yearslater.grief, heseeshisphysicalandmentalhealthdeclinewhenshemysteriouslyresurfaces Then Benoît isapolicelieutenantwoundedbythedisappearanceofhiswife.Unabletomovebeyond Contact [email protected] EditorJulienChardonMusicFrançoisLiétout ChanalCinematographerRaulFernandez Bertrand Time 17minLanguageFrench,SpanishDirectorAlbanRavassardScreenwriterProducer Premiere StatusYorkshire OriginalTitleL’Appel FranceYear FormNarrativeCountry 2015Running Η ΜεσονυχτιαΓραμμη CyprusYearForm NarrativeCountry 2016

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 71

Tim Atkins Music Tim Lee Hardcastle DEAD SHORTS COMPETITION SHORTS DEAD French Director Emeline Castaneda Screenwriter Emeline Castaneda Cinematographer Clémentine Péron Editor Thomas Fernandez Contact [email protected] When a man stops at a motorway service station toilets, little does he imagine that talking to the a neo- person in the next urinal will trigger a bloodbath. Culminating in a musical number featuring Nazi and empowered Jewish zombies this short film has to be seen to be believed! 2015 Running Time 12 min Language English Premiere Status UK Form Narrative Country USA Year O’Neill, Jared Parsons, Bryan Andrew Corkin, Tim Producer Screenwriter Kevan Tucker Director Kevan Tucker O’Neill Editor Tim Segal Cinematographer Tan Reisberg, Kevan Tucker Contact [email protected] a young model must decide whether to obsession with beauty, In a deeply black of today’s to further increasingly horrific demands her own career. acquiesce to a photographer’s 2015 Running Time 6 min Language Form Narrative Country France Year Premiere Status Yorkshire 10 min Language 2016 Running Time Country Form Narrative UK Year Premiere Status Yorkshire or not. Unexpectedly reunited with his daughter amongst the ruins of the is special, apocalypse Today Day the best ever – even if they are world as they knew it, a man is determined to make this Father’s already dead. A gardener accidentally discovers that he’s able to grow pliable people from severed limbs. Infatuated able to grow pliable people from discovers that he’s A gardener accidentally his thoughts turnwith a work colleague, the perfect murderous when he contemplates girlfriend. Love places. can grow in the strangest 2016 Running Time 5 min Language English Director Chris McInroy Form Narrative Country US Year Leon Cinematographer EJ Veronica Ben Steinbauer, Berndt Mader, Screenwriter Chris McInroy Producer Music Andrew Hoke Enriquez Editor Gavid Tatro Contact [email protected] guaranteed to make him the meanest shredder on the When metalhead Lars receives a satanic listening. Shame he wasn’t planet, he only has to follow three simple rules. Lee Hardcastle English Director Lee Hardcastle 3 min Language 2016 Running Time CountryForm Narrative UK Year Lee HardcastleAnimator Screenwriter Contact [email protected] and Leeds Fanomenon favourite The Thing with Pingu, John Carpenter’s Having previously crossed returnsanimator Lee Hardcastle a multitude of Martian with a commando Claycat taking on monsters videogames. Blood, guts and ‘meows’ abound! in homage to the Doom Running Time 20 min Language 2016 English Form Narrative Country UK Year Premiere Status World Jamie Hughes, Ashwin DesaiCinematographer Jamie Hughes Producer Director Jamie Hughes Screenwriter Music Jim Williams Scott Sandford Editor Barry Taylor Contact [email protected] Sam Twyman Chris Lane Cinematographer Sam Twyman Producer English Director Mat Johns Screenwriter Mat Johns Morris Editor Mat Johns Music William Contact [email protected] Kaddish! Ideal A Father’s Day A Father’s Death Metal Compost Claycat’s Doom Claycat’s 72 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 FANOMENON Adam Peiper FUTURE SHOCK:SCI-FISHORTS PANORAMA When SusurrusStirs Stalkers The Procedure Nasty DEAD SHORTSCOMPETITION literal disappearance fromexistence. ofthemachine. Stunningvisualsrecordone man’sliving beginstolose hismindandbecomespart In abureaucraticfuturewheretasks aremonotonousandrepetitive,amanwholicksenvelopesfor Contact [email protected] Cinematographer Willy Jáuregui Editor CristinaLagunaMusicRolyWitherow Spanish DirectorMónicaMateoScreenwriter MónicaMateoProducer Lasdelcine,HugoSerra,Dosdecatorce Premiere StatusYorkshire SpainYear FormNarrativeCountry 2015RunningTime 17minLanguage that couldresultintheendofallus. Susurrus. Abodyhorrortalelikenoother, ofoneman’s thisisthestory bondwithaparasiticcreature A manfindspurposeinhismeaninglesslifewhenhebecomeshosttoanancientcreaturenamed Contact [email protected] Schaddelee, PeterWest CinematographerAnthonyCousinsEditorJoshMruzMusicTim Holly Director AnthonyCousinsScreenwriterCousins,KevinSemlakProducer AnthonyCousins,Ryan USYear Premiere StatusEuropeFormNarrativeCountry English 2016RunningTime10minLanguage escape anunseenhunter. followsanakedmanthroughdarkanddeepforestdesperateto a killertwist,thisnarrativeshort If yougodowntothewoodstoday, you’resureofabigsurprise…Just aminuteinlengthbutwith Contact [email protected] Editor JaredWatmuff MusicSaulBragman Director FredTilby-Jones ScreenwriterFredTilby-Jones Producer FredTilby-Jones CinematographerJimJolliffe English Premiere StatusYorkshire UKYear FormNarrativeCountry 2016RunningTime1minLanguage lowered towardshim. ofabizarreexperimentaspanelintheceilingopensandsomethinghorrificisslowly he ispart inanemptyroom.Hediscovers A maniskidnappedandwakestofindhimselfstrappedagurney Contact [email protected] Buzz Pierce Director CalvinLeeReederProducer ChristianPalmer, CarlosLopezCinematographerJacobRosenEditor USAYearPremiere StatusUKFormNarrativeCountry English 2016RunningTime4minLanguage desperate attempttoreunitehisfamily. collection ofvideonastiesholdsthekey, Dougimmerseshimselfinanillicitworldofhorrora It’s 1982and12-year-old Doug’s thatdad’s fatherhasmysteriouslydisappeared.Determined secret Contact [email protected] Summerson EditorFlauraAtkinsonMusicSevenLocksStudio Bond ScreenwriterAnthonyFletcherProducer MeghnaGupta,HelenMullaneCinematographerAnnika UKYearForm NarrativeCountry 2015RunningTime15minLanguageEnglishDirectorPranoBailey-

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com FANOMENON BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 73

As the starship Tantalus drifts through space, a technician is woken from cryosleep to mend the ship As the starship Tantalus its hat and send a distress signal. But all bar two of the crew have mysteriously disappeared. Tipping to Alien¸ this claustrophobic thriller shot in beautiful leads to a very disturbing climax. 2016 Running Time 15 min Language English Director TomForm Narrative Country Germany Year Cinematographer Alex Beier Editor Tom Chris Krüger Bewilogua Producer Bewilogua Screenwriter Tom Bewilogua Music Johannes Koeniger Contact [email protected] In the near future surveillance is omnipresent. X-33 lives in a rundown apartment where a peculiar and pulsing object in the wall follows him at every turn. As X-33 grows increasingly paranoid, his thoughts turn let him? to destroying it. But is it real? And if so, will it 2015 Running Time 15 min Language Form Narrative Country Spain Year Premiere Status Yorkshire 2015 Running Time 20 min Language Korean Director Form Narrative Country Republic of Korea Year implanted artificial heart to her own, the two form an inseparable When Margo connects Yeonhee’s killers. Margo is a robot – and in this post-apocalyptic bond as they’re relentlessly hunted by merciless future, all robots must be destroyed. Cinematographer Luis English Director Javier Chillon Screenwriter Javier Chillon Producer Fuentes Editor Javier Chillon, Luis Fuentes Music Cirilo Fernandez Contact [email protected] Stuart enjoying their third date until Stuart and Kaylie are reveals a secret that threatens to derail their a neat cameo With Is he telling the truth or just mentally unstable? from the future. relationship – he’s from French Stewart (3rd Rock From The Sun), this is a short film about falling in love in the wrong space time continuum. 2015 Running Time 5 min Language French Premiere Status UK Form Narrative Country France Year GilbertProducer Maxime Marline Damien Kessler, Director Romain Brachet, Sébastien Fraud, Alexandre Guerre, Kiner Contact [email protected] who go to meet it preparing for inhabited by Vikings, A spaceship lands in an inhospitable landscape inside. Freyja, a young warrior, the ship invites battle. However, Language 2015 Running Time 11 min Year Country UK Form Narrative Premiere Status USA, Taiwan Gary GaryEnglish Director H. Lee, Gary H. Lee Screenwriter Matthew Brady, Matt Ardine, H. Lee Producer Cinematographer Justin Gurnari, Music Jack Wall Editor Julian Smirke Monica Sun Remii Huang, Luke Watson Contact [email protected] a child who may hold the key ahead of nefarious forces in a race to find A man must stay one step toy penguins, success of Hector Corp. (LIFF 2009) with murderous future. Following the to mankind’s Garyto classic SF films like The nods H. Lee returns impressive follow up. With with an equally this narrative short some spectacular special effects. boasts Terminator, Director Ben Rock 2016 Running Time 12 min Language English Form Narrative Country USA Year Editor Cinematographer George Feucht Ron Morehouse, Emily Bell Producer Ularich Screenwriter A. Vincent Ben Kays Alatrakchi Contact [email protected] Il-seung Editor Geon Kim Cinematographer Yu Lee Won-jeong Geon Kim Screenwriter Geon Kim Producer Contact [email protected] FUTURE SHOCK: SCI-FI SHORTS PANORAMA SHORTS SCI-FI SHOCK: FUTURE They Will All Die in Space The Swelling Keep Going Iron Mountain Iron Future Boyfriend Aden

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 75 RETROSPECTIVES The main LIFF30 retrospective is a celebration of the film soundtrack with a musical feast of all- is a celebration of the film soundtrack with a musical feast The main LIFF30 retrospective in the stunning concerttime favourites and rarely-screened classics, mostly screening setting by Andrzej Zulawski and Hall. More highlights include restorations of classics of Leeds Town perennial LIFF hits, classics by female filmmakers, and a season of New Wave Jirí Trnka, Norwegian black comedies. A programme of silent film classics includes a rare screening of the 1927 epic, Napoleon by Abel unprecedented 50 year restoration of the five and a half hour starring Beatrice Lillie and Harold Gance, along with a double-bill of the funniest silent comedies The film programme is complemented by the Lloyd at the wonderfully baroque City Varieties. the movie this year celebrating annual LIFF Film Poster Exhibition in partnership with North Bar, soundtrack, as well as a live performance by DJ NormayMBE at Belgrave to Jay Black Star season. celebrate the launch of the BFI’s 76 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES On theSilverGlobe The Devil ANDRZEJ ZULAWSKI after 15years?You aredifferent,everything’s different…sowenevertried, wetriedtoglueittogether.’ AndrzejŻ stopped, thecostumes destroyed.Andafter12or13 years…theycalledmeandsaid ‘wethinkyoushouldfinishthisfilm’. Howcanyoufinishafilm ofthemoment…Sowewere punishedafterayearandhalf, thefilmwas how tostayfreeand howtosaythings,whicharenot inthevocabulary painfultime.Butwelovedthisfilm becauseitwasafilm–Ihatetousethisbigword film aboutfreedom, longandvery it wentforavery wouldn’t provideuswiththeclothes andmaterials…wewereshootingfor10daysstopping re-shootingandstoppingetcso Polish industry 5-6weeksbecausethe in’76… wehadtostopevery me andtheywentheadonintothe wall,liketheBerlinwallofsystem.Thisfilmwasstarted talent togothroughthedifficulties thesystemprovideduswithinabrilliantfashionandthey’vemade films afterfilms.Andsomeweremoronslike ofliteratureorfilmspaintingsmusic whichwasrichandrewarding,againstthesystem.Somepeople hadtheintelligenceand it intheform ‘This filmwasmadeinbizarrecircumstances, thecommunistsysteminEuropewasabizarrewhich neverworkedandwhatevercameoutof especially inthisstunningdigitalrestoration. arrives, heishailedasthenewMessiah.Thefilmvisuallyextraordinary of astronautscrashlandonthemoonandmakeasettlementthere.A generationlaterandanewcivilisationdevelops.Whenpoliticianfromearth ofCultureduetoitssubversivecontent,thefilmwascompleted overadecadelaterafterthecollapseofcommunism.Agroup down bytheMinistry anduniquesci-fiepicfromthelatePolishmasterAndrzejŻ A visionary Andrzej Russia’s Stalinistpastand,inHardtoBeaGod, Putin’s Russia.’DanielBird highly prophetic,theyencapsulatethePolishpredicamentinamannerthatcanonlybecomparedtowayAlekseiGerman’s filmsdealtwithboth I cannotthinkoftwofilmswhichsaymoreabouttheproblemsfacingPolandtodaythanTheDevilandOnSilverGlobe.Deeplydisturbing theCatholicChurch. would havethoughttobetheenemyofPolishCommunistParty: was promptlybannedbytheauthorities.However, theofficialreasonforsuppressingfilmwas,perversely, becauseTheDevilupsetwhatone the MinisterofInteriorinWarsaw ledtotheexpulsionofJewsfromPolishCommunistParty—and studentriotsofMarch‘68—whichinturn freedom. WhereasWajda’s politicalcinemaisdirect,Ż a40-yearstrugglefor duringtheeighteenthcentury. recentlyPolandrewroteitsownconstitution,effectively undermining its partitioning Onlyvery ‘ Jakub, whohasbeensentencedtodeath.Hegiveshimarazor, commandinghimtoeradicatetheworldofevilanddebauchery. andrescues invades.Astrangerwandersintoamonastery-come-prison ofPolandin1793asthePrussianarmy It takesplaceduringthepartition withanoddball,psychedelicsoundtrack. politicalallegory bloodthirstyhorrorfilm,part is anenigmatic,phantasmagoricaldreamscapeofafilm,part Ż uławski’s TheDevil…underlinesPoland’s innatecapacityforself-destruction.CommunistPolanddestroyeditself,justasPolishactionsresultedin Ż uławski’s secondfeaturewascontroversialeven byhisstandardsandnotshowninPolandforalmost20yearsafteritwasmade.TheDevil uławski’s isoblique.OstensiblyaGothichorror, alludedtotheroleof TheDevilnevertheless uławski, On the Silver Globe was the largest Polish production of its time. Shut uławski, OntheSilverGlobewaslargestPolishproductionofits time. Shut Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Andrzej Director Andrzej Language Polish Format DCP Running Time Year 1972 Poland Country Original Title Diabel Original Music Film Editor Cinematographer Leading Cast Screenwriter Andrzej Director Andrzej Language Polish Format DCP Running Time Year 1988 Poland Country Original Title Contact [email protected] Sales Company Contact [email protected] Sales Company Andrzej Korzynski Krzysztof Osiecki Andrzej Jaroszewicz,MaciejKijowski Wojciech Pszoniak Malgorzata Braunek,MichalGrudzinski, Barbara Pec-Ś 119 min Andrzej Korzynski Krzysztof Osiecki Andrzej Jaroszewicz Dylag JerzyTrela, Andrzej Seweryn, Grazyna 166 min globie Na srebrnym Studio FilmoweKadr Studio FilmoweKadr uławski, Director Ż Ż Ż Ż uławski uławski uławski, uławski lesicka 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 77 uławski is uławski uławski uławski, Miroslaw Ż Ż Ż uławski, who sadly died earlier thisuławski, who sadly died Studio Filmowe Kadr Park Circus Malgorzata Braunek, Leszek Teleszynski, Teleszynski, Malgorzata Braunek, Leszek Jan Nowicki Sobocinski Witold Halina Prugar-Ketling Andrzej Korzynski 130 min English, Russian, Italian Hal Ashby Jerzy Kosinski Andrew Braunsberg Peter Sellers, Shirley MacLaine, Melvyn Douglas Don Zimmerman Johnny Mandel Trzecia czesc nocy Trzecia 105 min Sales Company Contact [email protected] UK Distributor Leading Cast Cinematographer Film Editor Original Music Country USA 1979 Year Running Time Format Blu-Ray Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Original Title CountryPoland 1971 Year Running Time DCP Format Polish Language Andrzej Director Screenwriter Andrzej ANDRZEJ ZULAWSKI / HAL ASHBY / HAL ZULAWSKI ANDRZEJ uławski favours dynamic mid-shots capturing both speakers, profile shots that turnuławski favours dynamic mid-shots capturing both into portraits, or The Third Part Night was the extraordinary of the enfant terrible of Polish cinema, Andrzej Ż debut feature by the the macabre and dreamlike the Nazi occupation in the city of Lwow, digital restorations of his best films. Set during are screening three new We year. he meets and nightmarish hallucinations converge as Reality kills his family. man who enters the resistance after the Gestapo narrative follows a young working as a guinea pig in a bizarre lice-infested typhus laboratory. doppelgangers of his dead family and begins ‘The Third Part from The Book of Revelations over a succession of landscape shots of earth, of the Night opens with a reading grass… The trees and Apocalypse. This sequence, along with with details from Durer’s nocy interspersed solarised stills from the film część original Polish press book for Trzecia the four angels (distorted final shot of the film) explicitly correlates the Polish experience with biblical imagery through glass in the only with a confidence część nocy: long tracking shots; predominant wide-angle Childhood... A strong sense of style can be discerned in Trzecia Ivan’s paralleled by Tarkovsky’s and the heavens are always in frame); two people locked in dialogue are rarely covered by the usualcompositions, usually from below looking up (ceilings tete-a-tete back and forth between facial close-ups, as Ż Ż one of two speakers adjacent to the camera. Unlike Miklos Jansco, there is never a sense that the simple twisting of the focus ring, making sharp Trzecia later films. Rather, has this ‘style’ become an affectation (yet), as it could be argued to be the case in Tarkovsky’s nor adhering to a formal strategy, część nocy is both simple and slick, possessing the formal of a Hollywood flick.’ Daniel Bird qualities of an film as well as the glossiness As the 2016 US Election finally happens on 8th November, the great Peter Sellers puts the commotion of politics into calm perspective with one of As the 2016 US Election finally happens on 8th November, Washington, D.C. who finds himself out of Being There. Sellers is Chance, a serene and sheltered gardener in his last and finest roles in Hal Ashby’s and even the White the streets to being the talk of Washington How Chance then goes from wandering work after the death of his rich benefactor. House with his ‘simple brand of wisdom’ is spin-free pleasure to the end. of excellent rhythm, consistent style and an air‘Jerzy Kosinski adapted the screenplay from his own 1971 novel and created a true little masterpiece When a film with a premise of intelligent humor that never descends into , never tries to benefit from shortcuts and easy jabs at the society. as absurd as this one manages to entertain and not allow you to question its logic all the way through, it becomes obvious you’re dealing with you even though extraordinary talent. Being There displays plenty of wit and can be easily seen as a fully functioning critique of the American high society, & Beyond it would perhaps be more accurate to label the human race as the real target of its satire.’ Cinephilia that you never for a moment doubt it. As it pushes‘Here you have a film with the most outlandish premise that is presented with such wit and confidence it. All comedy directors should be forced to watch this filmthe envelope, step by step, it keeps its reality level and you never for a moment call bullshit on meaningful, well acted, and visually gorgeous all at the same time.’ so they will learn funny, that comedies can be subtle, riotously Being There The Third Part Third The Night of the 78 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES The LastDetail Harold andMaude HAL ASHBY Washington DC…itmadethemovie look… likethe11o’clocknews, which isjustrightfortheemotional content.’MichaelChapman,Cinematographer emotionally charged andevocativethananythingIcould do…themen’s roomintherailroadstation, thebar…littlelunchcounter somewherein ‘I sawthatsincethey wereallreallocations,with,Ithink, oneexception,ahotelroomthat webuilt,…thelightinthoseactuallocationswas farmore people.’ HalAshby, Director glowthinking:‘Gee theworldisfullofnice So Ithoughtitwouldbecompletely dishonestofustosendtheaudienceouttheatrewithawarm maybe ahundredoutofhundred—would havedonewhatNicholsondidinthemovieandtaken kid toprison,ratherthanrisktheirownskin. really belettingtheaudienceoff hook.Theaudiencemustbeleftwiththeproblem,becauseninety nine outofahundredpeopleintheaudience— ‘Inevitably, whileweweremakingthefilm, we consideredchangingtheendingsothatNicholsonwouldlet kid escape.ButIthoughtthatwould stealing fromthepoliocharitybox.Movedbyhisplight,twohardened sailorsshowhimagoodtimebeforehislongstayinthebrig. Buddusky who,alongsideMulhall(OtisYoung) Meadows(RandyQuaid)fromWest recruit,Larry escorts Virginia toaprisoninMassachusettsfor a saltyscriptpepperedwithimaginativeprofanitiesbyChinatown’s Towne. Robert assailor JackNicholsongivesoneofhisgreatestperformances One ofthehighlightsfrompurplepatchAmericancinemain earlyseventies,HalAshby’s TheLastDetail isarip-roaringroadmoviewith comestogether.’the highstyleandfreedomwayeverything JonathanDemme direction.Forafilmmakermakinghissecond filmit’s‘The thingthatstruckmewhenIwatcheditrecentlywastheextraordinarilymasterful – ridiculous canbestripped-downandreallyeffective.’CameronCrowe is good.Storytelling except it’s withthisancienthilariouswoman and anoddyoungboy. inspiringtorevisitthatmovielately. Anditwasvery ofsaid:stripped-down Itsort and shotsthatscratchatyoursoul.It’s ‘rock’n’roll’.You notprecious –it’s donevery apotentiallypreciousstory havetheclassicromanticmontage, teaches thekidhowtolive.It’s likethegreatest capsulizedstory, andit’s donewithmusicthatscratchesatyoursoul,thesegreatCatStevenssongs, ‘Look athowsimpleHaroldandMaudeis.Ayoungmanobsessedwithdeathfallsinloveanoldwomanlife.Shedies, talethatbridgesthegenerationgap. byCatStevens,HaroldandMaudeisaheartwarming composed andperformed and thepairbecomeinseparable.MaudeisaneccentricdaredevilwhoteachesHaroldtolivelifefull.Featuringaremarkablesoundtrack a hearseandstageselaboratefakesuicidesmuchtothedismayofhismother. Whilstattendingastranger’s funeralHaroldmeets79-year-old Maude Hal Ashby’s cultclassicisadarkandtwisted comedyaboutlife,loveanddeath.Haroldisa20-year-old obsessedwiththeideaofdeath,hedrives Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1971 USA Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1973 USA Country UK Distributor UK Distributor William A.Sawyer, EdwardWarschilka John A.Alonzo CyrilCusack Ruth Gordon,BudCort, Mulvehill Colin Higgins,MildredLewis,Charles Colin Higgins Hal Ashby 91 min Johnny Mandel C.Jones Robert Michael Chapman Jack Nicholson,OtisYoung, RandyQuaid Gerald Ayres, CharlesMulvehill, Towne,Robert Ponicsan Darryl Hal Ashby 104 min Park Circus Park Circus 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 79 Trnka Studio Trnka í JIRI TRNKA JIRI Trnka, Helena Lebdušková Trnka, Trnka Trnka Trnka í í í í Národní filmový archiv Národní filmový archiv Vladimír Novotný, Emanuel Franek Vladimír Novotný, Emanuel Jiř Václav Trojan Alois Jirasek, Jiri Brdecka Zdenek Stepanek, Eduard Kohout Emanuel Franek, Ludvik Hajek Helena Lebduskova Václav Trojan Trojan Vaclav Stare povesti ceske 91 min Jiř 75 min Jiř Jiř Krátký Film Praha, Jiř í Trnka Studio Director í Trnka Sales Company Contact [email protected] Sales Company Contact [email protected] Cinematographer Film Editor Original Music Screenwriter Leading Cast Cinematographer Film Editor Original Music Original Title Country Czechoslovakia 1953 Year Running Time Format DCP Language Czech Director Spalicek Original Title CountryCzechoslovakia 1947 Year Running Time DCP Format Czech Language Director Screenwriter Producer í Trnka, who shared not only in the production of puppets and sceneryí Trnka, but also in the í Trnka poetically reveals folk customs and traditions of the Czech countryside poetically reveals í Trnka that have been preserved for í Trnka was one of the great artists of stop-motion puppet animation and Old Czech Legends is his most acclaimed feature film, shown here in its í Trnka The first feature length of Jiř The first feature length it is made up of six related parts, Collection of National Folk Songs, set in a different season. each suite based on Aleš’s centuries. A kind of cinematic songs sung by the children of Kühn’s with motifs from folk of Václav Trojan out by simple puppets is underlain by the music A lyrical narrative acted choir. came about by joining six originally independent short films (Carnival, Spring, The at the IFF in Venice, The motion-picture, awarded the Gold Medal The Feast and Bethlehem). Jiř Legend of St. Prokop, The Fair, well as his talent for set design, thus giving the genre of puppet film, otherwise could fully engage his sense for plasticity as creation of the screenplay, considered undemanding, new form. Along with Hermína Týrlová or Karel Zeman, he started era of Czech puppet and, consequently, off the golden at internationalanimated film which has been met with appreciation film festivals. artistic‘[…]while film critics justly extolled the boundless The and musical value of the work, the public balked at its avant-garde qualities, dooming Venice and elsewhere and was audiences in with its apathy and sometimes outright disgust, to ‘failure’. The film that stunned foreign Czech Year, Film Registry 10, no. 17, pg. [4].] Prague before a half-empty hall.’ [Bk (1958): The Czech Year, showered in enthusiastic praise, premiered in Jiř the storyfull digital restoration. An adaptation of the book Ancient Bohemian Legends by Alois Jirásek, interweaves six heroic folk tales of Forefather and uses was a great filmmaker as well as a puppeteer, Çech (who founded the Czech nation), Princess Libuše and Premysl the Ploughman. Trnka bring a mythical world to life. to innovative effects of movement and lighting, and a rousing score by Václav Trojan, ‘The first film which we did as an animation was a fairya dzban [The tale Jak dedek zasadil repu. [Grandpa Planted a Beet] The next one was Liska Those films were based on Czech fairyFox and the Jug] and the third one was Zviratka a Petrovsti [The Animals and the Brigands]. And the tales. the studio. In those days nobody knew that there was athird one won the prize, it was in 1947 or 1948, in Cannes. This was a big celebration for film de facto put us on the map of animation… studio in Prague with over a hundred people. And I think this was a great thing for us and this I was very often going to Bartolomejska and I admired him because he was painting with both hands. He was working with left hand to the studio and right hand and it was absolutely fantastic to watch his skill.’ Zdena Deitchova, Jiř Old Czech Legends The Czech Year Czech The 80 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Daisies +ABagfulofFleas Cleo from 5to7 NEW WAVE WOMEN V journey...’’ AgnèsVarda, Director, 1964 in abadway, ofsensitivitybeingshrewdmeansputtingpeopleintherightframemind.Thenyoucantellthem‘Comewithmeonmy butinterms mechanism ofshocktriggersamoreaccutesensitivity. You frameofmind.Ithinkafilmmakerhastobeshrewd.Not havetoputpeopleinacertain the sameworldthrougheyesofahealthymarriedwomanwiththreekidsmightbeinteresting,butitdoesn’t catchpeople’s attention.Ithinkthe afraid andanxious.It’s justonespecificcase.Itcouldhavebeensomeonehealthy, butIdon’t thinkyoucatchpeople’s attentionwithnormalcy. Seeing aspectofParisanditsstreetspeople,butthroughthecompletelysubjectiveviewayoungladywhofeelssick,lost, Cleo capturesacertain it inL’Opéra well. Mouffe,butnotvery style,reallife,thingscaughtinthemoment.Cleo’saspect, andthedocumentary thefirstfilmwhereImanagedtobringthosetwothingstogether. Idid premeditatedandreconstructed ‘With Cleo,Isucceeded,atleastthinkdid–inreconcilingthetwoaspectsofrealitythatinterestme:very Cleo wandersthevibrantstreets,cafesandgardens,encounteringastringoffriendsacquaintancesalong cancer.results ofsomemedicaltests,becomingincreasinglyworriedthatshemighthaveterminal Thefilm’s othermaincharacteristhecityofParisas The filmisarealtimenarrativesetovertwohoursinthelifeofpopstarCleo,aniconicroleforCorinneMarchand.Shekillingtime,waiting Even amidsttheexplosionofcreativityinearlydaysNouvelleVague, AgnèsVarda’s secondfeaturestandsoutforitsinnovationandvitality. nfa.cz) Screening withthe director’s ABagfulofFleas (Vě classic earlyshort incorporates allthisandmoreinawildly experimentalnarrativethatisconsideredthemovement’s singularfeministstatement.’MichaelKoresky she discoveredaloveforimprovisation, nonprofessionalactors,andcinemaverité—anythingthatrejected theideaoffilmasanexactscience.Daisies an unconventionalfilmmaker. philosophyandarchitecturestudent,Chytilová enrolledat Aformer FAMU in 1957,theonlyfemaleinherclass.There of amoviethatrepresentstheCzech NewWave radical andkookilycaptivating.TheunconventionalDaisieswastheproduct of atitsmost formally ‘It isChytilová’s 1966Daisies,madedirectlyafterPearlsoftheDeep,thatisher mostfrequentlydiscussedworktothisday, amadcap,Dadaistexplosion worker.rebellious femalefactory absurdist humour. ofa Daisiesfollowsthe misadventuresoftwogirlswhoseprankswreakhavocaroundPragueandABagfulFleastellsthestory asacritiqueofpatriarchalsocietythere’sBoth filmsincludethemesviewedfromaprogressivefemaleperspective butaswellserving lashingsof with controversy. Chytilová’s surrealistandanarchic masterpieceDaisieswillbescreenedalongsideherearlypioneeringworkABagfulofFleas. ě ra ChytilováwasCzechNewWaves’ mostprominentfemaledirector, butathomeherinnovativestyleanduncompromisingvisionwasoften met ra Chytilová,Czechoslovakia, 1962,43min, alzbeta.diringerova@ Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language French Format DCP Running Time Year 1962 Country Original Title Original Music Film Editor Cinematographer Leading Cast Screenwriter Director Language Czech Format DCP Running Time Year 1966 Czechoslovakia Country Contact [email protected] Sales Company Ciné-Tamaris Contact [email protected] Sales Company Michel Legrand Pascale Laverriere,JanineVerneau Paul Bonis,AlainLevent,JeanRabier Dominque Davray Corinne Marchand,AntoineBourseiller, Georges deBeauregard,CarloPonti Agnès Varda Agnès Varda 90 min France, Italy Cleo de5a7 Jirí Slitr, JiríSust Miroslav Hájek Jaroslav Kucera Ivana Karbanová,JitkaCerhová Jurácek V V 76 +43min Národní filmovýarchiv ě ě Chytilová, Ester Krumbachová, Pavel ra Chytilová,EsterKrumbachová,Pavel ra Chytilová 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 81 Norwegian Film Institute Norwegian Film Institute og far 86 min Bent Hamer Finn Gjerdum Sverre Hansen, Kjell Stormoen, Leif Andree Skafti Gudmundsson The Flesh Quarter Kunsten a tenke negativt Kunsten a tenke 79 min Bard Breien Bard Breien Dag Alveberg Torhaug, Fridtojv Saheim, Kirsti Eline Henrik Mestad Gaute Gunnari Zaklina Stojcevska Stein Berge Svendsen Sales Company Contact [email protected] Sales Company Contact [email protected] Original Title Country Norway 1995 Year Running Time Format 35mm Language Norwegian Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Original Title CountryNorway 2006 Year Running Time 35mm Format NorwegianLanguage Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music NORWEGIAN COMEDIES NORWEGIAN Director Bent Hamer’s warm style has led to a series of gems, three of them screening at LIFF30. In Hamer’s debut Eggs, two brothers in warm deadpan style has led to a series of gems, three of them screening at LIFF30. In Hamer’s Director Bent Hamer’s the only interruption being when Pa made a weekend trip to their seventies, Pa and Moe, have lived together all their lives remotely in the country, II. The past returns when his adult son dating from his Swedish visit, Konrad, comes to live with them after War Småland on his moped during World his mother has fallen ill. Soon Moe is about to discover that three is indeed a crowd… a way of understanding sound too pretentious. For me it’s I hope it doesn’t I call it poetic humour. ‘I develop a kind of expression for my humour, serious but you can also impossible for me not to see the humour in a lot of conventions and situations in life. It’s myself and the world around me. It’s my not much dialogue in a wonderful dealing with serious subjects. There’s way of communicating when you’re It’s look at it in a humouristic way. You have to learn also very difficult to write good dialogues! films. I like to work from specific situations which tell more than words sometimes. And it’s they react to things. And little by little, hopefully youto know the characters in my films little by little – by seeing how they organize their lives, how same stage of your life. come from the same background, or are not at the recognize yourself in them, even if you don’t time, need to be sure you have the possibility to do it, in terms of money, very important‘The script is just a potential. It’s to be open minded. You Bent Hamer, matter if they come from the coffee guy.’ organisation. If people come with better ideas, you have to make room for them, and it doesn’t Director Hilarious black comedy The Art of Negative Thinking is one of LIFF’s most requested repeats. Geirr is severely disabled and impotent after a car repeats. Geirr is severely disabled and impotent most requested The ArtHilarious black comedy of Negative Thinking is one of LIFF’s limitless bitterness, weapons fixation, self-medication and accident. Given his isolation, As a last resort his girlfriend Ingvild has had enough. she joined by the rest of the group refuses to see anything as positive and is soon positivity group to spend a day with him. Geirr invites over a municipal desperation. as they enter a downward spiral of anguish and everybody has to be this very positive person. And a tendancy, It’s very‘This method that is being used in the film is a popular method in Norway. everybody accepts that as something terrible. And there you have a starting point [for a like that! When you have someone in a wheelchair, I don’t on the handicap. I was more interested in the so much focused to make about. But I wasn’t scenario]. This is something you’re not supposed a film about people. not a film about handicapped people, it’s psychology of the characters. It’s happening to them. A movie is about an idea, only about the characters, you’re watching seven people and what’s This is really an actors’ movie. It’s These conflicts can come from your life, so in that sense you need to have problems to tell a story!and this idea has to have a lot of conflict in it. Here I wanted to tell a story the set I was very about personal freedom. On nice- I was very inexperienced, but I was very positive!’ Bård Breien, Director 21 min, [email protected]) 2015, Hansen, Norway, Lisa Brooke (Even Hafnor, Screening with the hilarious Norwegian short Small Talk Eggs The ArtThe Talk + Small Thinking Negative of 82 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Here isHarold NORWEGIAN COMEDIES bedfellows.’ Gunnar Vineke, Director the wrongdirection butwithallthebestintentions.They makemesmile,laugheven,but Idon’t makegood makefun ofthem.Humourandtenderness emphasis onsubtextandtheunderlying meaning.Ilikepeople–mustadmithaveaweaknessforthose whomakemistakes,gocompletelyin ‘My filmdoesn’t genre.Iliketosurprisetheaudience,doawaywith conventionsandbarriers,butIalsoplacealotof fallintoanyparticular fighting windmills,andinhisdesire tofindareasonforliving,justificationhisexistence. use hissources,andgavemecomplete freedom.IwasreallytakenwithHaroldLunde,acharactersosimilar toDonQuixoteinhiswayofvaliantly novelentitledImorgonerdetmåndag (Tomorrow short a very isMonday),whichthebasisofmyfilm.Frodeletme takealookathisdocuments, IchosetheSaganatttrilogy, writerFrodeGrytten. ofwhichis ‘I’ve longdreamtofmakingafilm inspiredbyaworkNorwegian thesecondpart kidnap hisnemesis–thefounderofIKEA,billionnaireIngvarKamprad. Butunfortunately, Kampradseemsquitehappytobekidnapped. himselfwith apistolandsetsoffforÄlmhult,Sweden,inorderto to thebank.Inmountingangeranddesperation,Haroldwantsrevenge. Hearms when IKEAdecidestoopenanewsuperstorerightnextdoor, areunabletocompeteandloseboththeirshophome HaroldandMarny shoptogetherwithhiswife,Marny. Forover40years,Haroldhasrun asuccessfulfurniture David takesonGoliath,Norwegian-comedy-style. But language andenvironmentwhichseemexotictopeople,iftheycomefrom,say, Indiaor Spain.’PetterNæss,Director I’ve found,whenintroducedthefilmatfestivals,thatneuroses,anxieties,andtraumasofcharactersareuniversal.It’s alsotheNorwegian to foresee!Ithinkthere’s andhavecharactersstoriesthatyouempathyfor. alessonhere,thatyou havetobepersonalinyourstorytelling a balancebetweenhumourandseriousness,makingtheaudiencelaughwithcharactersnotatthem.ThesuccessofEllingwashard andsimplefilm,notacinematicextravaganza.Ithinkthedifficultyisfinding straightforward make themmeettherealworld.Iwantedittobeavery withthesecharacters.Iwantedtomakethemgoplacestheywouldn’t the worldoutside.Myideaforfilmwastogofurther daretogoonstage, whoareafraidof oftwomen,EllingandKjellBjarne, ‘The play[Ellingwasoriginallycreatedforthetheatre]takesplaceentirelyinsideapartment Suddenlytheyarefacedwithovercomingtheircompulsionsandphobiasforreal,together.are dischargedandplacedinanOsloapartment. sent toastatehomewheregraduallyhebuildsclosefriendshipwithhispolaropposite,theloudandsex-obsessedhulkKjell.Aftertwoyearsthey shy andneuroticmiddle-agedmanwhofindshimselfalonewhenhisprotectivemotherpassesaway. Discoveredattheirhomeinacupboard,heis blackcomedyabouttwosocietymisfitsstrugglingwithdaytolife.Ellingisapainfully LIFFaudience favourite,Ellingisaheartwarming A former Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Norwegian Format 35mm Running Time Year 2001 Norway Country Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language Format DCP Running Time Year 2014 Norway Country Original Title Contact [email protected] Sales Company Contact [email protected] Sales Company Lars Lilo-Stenberg Inge-Lise Langfeldt Svein Krovel Pia Jacobsen Per ChristianEllefsen,SvenNordin,Marit Dag Alveberg Stuckey,Larry AxelHellstenius Petter Næss 89 min Frida EggumMichaelsen Simon Pramsten Granath Sundquist,FannyKetter,Bjorn Bjorn Maria Ekerhovd Gunnar Vikene Gunnar Vikene Swedish, Norwegian 87 min Her erHarold Norwegian FilmInstitute Norwegian FilmInstitute Norwegian 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 83 Norwegian Film Institute Norwegian Film Institute Norway, Germany, France, Denmark Germany, Norway, 90 min Bent Hamer Hamer Gulbrandsen, Bent Tom Mads Peter Ole Jim Frazee, Bent Hamer, Olsen Baard Owe, Espen Skjonberg, Ghita Norby John Christian Rosenlund Pal Gangenbach Salmer fra kjokkenet Sweden Norway, 95 min Norwegian, Swedish Bent Hamer Hamer Jorgen Bergmark, Bent Jorgen Bergmark, Bent Arve Figenschow, Hamer Bjorn Norstrom, Tomas Joachim Calmeyer, Floberg Philip Ogaard Pal Gangenbach Hans Mathisen Sales Company Contact [email protected] Sales Company Contact [email protected] Country 2007 Year Running Time Format 35mm Language Norwegian Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Original Title Country 2003 Year Running Time 35mm Format Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music NORWEGIAN COMEDIES NORWEGIAN Odd Horten has spent his whole working life as a railroad engineer, driving the trains on the Bergen railway line. He will make one last journey Odd Horten a railroad engineer, has spent his whole working life as he realizes that the path ahead is a journeyover the mountains before he retires. But when the train leaves the station without him on board, without printed timetables. The situations in this wonderfully written and exquisitely performed comedy that Horten finds himself in become more and more absurd until the time comes when you’re not surprised to suddenly find him in red high heels. ‘Most of my stories have begun with verythem I have purged myself. But I’m still travelling with clear and focused ideas, and when I’m finished with because his story is so universal; everybodyOdd. I think that’s finds themselves in situations where they have to make choices to give their life a More a little bit odd, but not really. have an expression in Norway: ‘sær’ - it’s direction, but we tend not to associate change with old people. We like a shy distance. In Norway think Horten seen is really that odd when I don’t you have a lot of people like this; people that are a little - different. through Norwegian eyes. Socially he is not very too much either about his background, say well developed, and lives within his solitude. I don’t and that, along with his work, meant everything to him. I veryexcept we have the feeling that he has been close to his mother, much liked his first Norwegianname - Odd - especially because of its English meaning, and at the same time it is a common name. I think odd is a very good way to finding himself in weird, quirky situations.’ Bent Hamer, taking chances, jumping off and saying ‘yes’ to life in a way, consider him because he’s Director Inspired by a very odd true story, is one of the most charming Kitchen Stories is one of the Inspired by a very at LIFF and is a firm and original comedies that has screened audience story, odd true sends out a fleet of scientific observers the Swedish Home Research Institute favourite. In 1950s Scandinavia, households in rural Norway to male to his observer on as a research subject, loner Isak shuts men in their kitchens. Regretful of having signed record the movements of Fault out in the snow. But the single-minded Swedish observer eventually gains the trust of his irascible subject. persists and compass uninflected, deadpan social comedy Kitchen Stories points as straight and true as a wry, ‘The Norwegian writer and director Bent Hamer’s is so minimal about conformity, The material, a comic melodrama dry shock of a snootful of sub-zero air. fixed on magnetic north. It has the tingly, Hamer takes what sounds like cartoon the frenetic SpongeBob Squarepants. [...] Mr. play like that it makes the understatement of a New Yorker the most out of its modest contradictions. He maximizes the concept through an entrancing visuala constricted and unpromising premise and gets and it makes his gift for staging entrances neatness is a rare commodity in comedy, Hamer’s of feeling. [...] Mr. a tiny depth flair and, eventually, looks like an aerial grand hedonist boss floats into the picture in a huge plane that When Folke’s (also in short supply) stand out even more sharply. ability to soar so quite a jump. The film’s for the pages of an old Popular Mechanics magazine, it’s predecessor of the Playboy Mansion as conceived Times York not be overlooked; comedy is often much too bumpy a flight.’ The New high so quickly and keep its wings steady should O’Horten Kitchen Stories Kitchen 84 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Lonesome Exit Smiling+MyWife’s Relations SILENT FILMCLASSICS Director (referring toproducerCarlLaemmleJunior and hisfather, headofUniversalStudios) it’s atravelogue.Well, Isaid,travelogueornot, that’s what Iwanttomakeandmycontract says Iselectthestory. Junior said,Allright.’PaulFejos, Finally, whenheputdownthereceiver, hesaid‘they’reallagainstit.Theysayit’s thattheyboughtfor$25andit’s aproperty sillyandit’s nothing, and toldthemthatIhadselectedthis. department tiny littlegem.IranwithittoJunior andsaid‘thisiswhatIwanttomake!’Juniorcalledupthestory smallscript,threepages…butitwaspoignantly-written, abeautiful,lovely,talk aboutthismore…’Icameacross atitlecalledLonesome.Itwasvery don’t understandanythingaboutthis. You’re old-andIdon’t tomeandsaid,‘Pleasehavelunch withus.We knowwhat-‘cruel.’Heturned must or acleansexypicture,andIdidn’t think Icoulddoit’SoJuniorwalkedovertothedeskofoldman -hejustsaid,‘Papa,youpromisedme!You my Dad?’Isaid,‘No,didn’t. Why not?Isaid,Well, Mr. Laemmleofferedtohavememakeoneofhisjewels,andhewants anaviationadventure ‘…So Juniorwalkedin,over andsaidtome,‘I’veseenTheLastMoment;itwasfantastic!And thisandthat.‘Didyousignacontractwith here withsubtitlesandliveaccompanimentbySimonLindleyonthebeautiful pipeorgan. colour tintingandsuperimpositioneffects.Largelysilent,thefilmwas madeintheearlydaysoftalkieandhasthreetokendialoguescenes,shown York ofJulyweekend,withdynamiccamerawork,experimentalediting andaninnovativeuseof CitysymphonysetinConeyIslandduringtheFourth Lonesome isalosttreasurefromHollywood’s goldenage,directedbypioneeringexplorer-anthropologist-doctor-filmmaker, PaulFejos.It’s aNew Jonathan Best. which includesanewlyrediscoveredshotofoneKeaton’s famousdaredevilstunts.Bothfilmsaresilentwithliveaccompanimentonpianofrom Showing withBusterKeaton’s MyWife’s short, Relations(EddieClineandBusterKeaton,USA,1922,25min,[email protected]) , love tocomeintoherlifeandwatchesitleaveunprotestingly’.Sothat’s whatitwasabout.Ithoughtmostlyapieceofcheese.’BeatriceLillie soabsorbedinherprofessionthatsheallowsagreat ofasmall-town‘SarahBernhardt’ sensation’. Theyclaimeditwas‘thehumorousandtragicstory somuchthenexttimearound.Ofcourse,picturewashurrahedandheraldedbypublicityboysasa‘comedy provided wewouldn’t havetohurry feeling tositwatchingyourself,knowingthere’s nothingyoucandoaboutit.Yet, headstrongchitthatIwas,stillfanciedI’dliketodoanothercomedy, a picture.Theyassuredmethatitwas‘inthecan’,butIwasn’t surewherethatwas.Forthelongesttime,IrefusedtoseeExitSmiling.It’s anawful ‘When SamTaylor announcedthattheshootingwasover, Icouldn’t believethatwe’dcompletedapicture.Theyassuredme asViolet,evenwhileyou’relaughing. thewardrobemistresswhodreamsofstardom,willtwangyourheartstrings performance She hatedmakingfilmsandmadeonlyonesilent–thiswinning,memorablecomedyaboutadisastroustouringtheatrecompany. Lillie’s wonderful Beatrice Lilliewas‘thefunniestwomanofourcivilisation’accordingtoNoelCoward,andChaplinhimselfsaidshehis‘femalecounterpart’. Director Language Format Digi-beta Running Time Year 1926 USA Country Director Language Format Blu-Ray Running Time Year 1928 USA Country UK DIstributor Filmbankmedia UK Distributor Sam Taylor No Dialogue 77 min Pál Fejös No Dialogue 69 min British FilmInstitute 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 85 Park Circus British Film Institute 85 min No Dialogue Wilde Ted 330 min 2 x DCP No Dialogue Abel Gance SILENT FILM CLASSICS FILM SILENT UK Distributor UK Distributor Country USA 1928 Year Running Time Format Blu-Ray Language Director CountryFrance 1927 Year Running Time Format Language Director Harold Lloyd saves the last horse-drawn trolley car from extinction in Speedy, his last – and one of his best. An engaging caper shot on Harold Lloyd saves the last horse-drawn trolley car from extinction in Speedy, Luna Park and a breathtaking finale it shows off the city as it was in 1928, including a beautiful sequence at Coney Island’s location in New York, chase through Manhattan. comic approach, which is to keep up a pace so rapid that no lingering sentimentality or sadness can attach. ‘The title alone tips off Lloyd’s refining for years (and that verySpeedy is an urban variant of the ‘boy with the glasses’ character that Lloyd had been painstakingly nickname had protagonist). Lloyd has stumbled on the idea of giving his character a pair of horn-rimmed spectacles (lensless, been used earlier for The Freshman’s milquetoast type, from whom one would not expect muchsince a lens would becloud the eyes’ expression). The glasses were meant to signify a nerdy challenges. But in general, we are asked to accept thatderring-do, and who would therefore pleasantly surprise the audience when he rose to heroic energetic, and accident-prone form.’ Phillip Lopate in its most healthy, Speedy is simply Youth short, Battle of the Century (Clyde Bruckman, USA, 1927, 19’, [email protected]), Speedy is showing with Laurel and Hardy’s biggest ever pie fight. This final reel was discovered in 2015 having been lost for decades. Both films are silent which concludes with silent comedy’s Bartlett on percussion. with live accompaniment by Jonathan Best on and Trevor In the culmination of an unprecedented 50 year restoration project led by filmmaker and historian Kevin Brownlow, the BFI are re-releasing one of the by filmmaker and historian Kevin Brownlow, unprecedented 50 year restoration project led In the culmination of an to host a screening in the suitably grand surroundings are proud to be able We Napoleon. Abel Gance’s of cinema history, undisputed masterpieces film runs for five by Carl Davis. A true epic in scale, the sound for the brand new recorded soundtrack Hall with full 7.1 Dolby surround of Leeds Town and a half hours and screens with three intervals, afternoon. surely an unforgettable way to spend a Sunday I was stunned by the cinematic flair – I had I saw two reels on my 9.5mm home . ‘I first encountered the film when I was a schoolboy. to find more of it, and more about it. I was puzzled by the antipathy the film aroused among criticsnever seen anything comparable – and I set out I expected with each recovered sequence that they would be proved right, and the qualityand historians who remembered the original release. the film, the better it became. And eventually I discovered that most of those had seen one of thewould take a plunge. But the more I added to butchered versions. I began to earn I was given facilities by the National Film Archive (now BFI enough to do a proper restoration. When I became a feature-film editor, Theatre, the place was Whenever the work-in-progress was screened at the National Film over. National Archive) who eventually took the project Colorado, in 1979, even though it Film Festival, always packed, the reaction always very stayed up all night to watch it at the Telluride strong. People Kevin Brownlow window was Abel Gance himself, then in his 90th year.’ from his hotel Watching was projected outdoors in freezing . Speedy + Battle of the CenturySpeedy + Battle of Napoleon 86 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Amadeus -DirectorsCut 2001: ASpaceOdyssey SOUNDTRACKS making a movie, I would be very interested.’ Milos Forman, Director interested.’MilosForman, making amovie, I wouldbevery end.Andright there aftertheshow,the very Imetforthefirst time[Amadeusplaywright]Peter Shaffer, andItoldhimthatifhe would everconsider I toldMr. movie.’Anditdid:Iwas gluedtotheseat Lantz,‘Ifthisplaywillcontinuewithkindofforceinthesecond half,itwillbeawonderful andSalieri.Attheintermission, evenif it wasnotMozart drama,whichwouldbewonderful waiting tofallasleep,andsuddenly Iseethiswonderful firstpublicpreview[ofAmadeus]inLondon.Nobodysaw itbefore.AndIamsittinginthetheater and don’t talksubversivethings.But itwasthevery films aboutcomposers,andthey were themostboringfilms.Communistslovetomakefilmsaboutcomposers, becausecomposerscomposemusic composers. AndIthought,‘Iamgoing tofaint.’Iwaspreparedforthemostboringevening,because was usedtoseeingtheRussianandCzech thatit’scalled me,whenIhadaroomfull of people,andaskedifIwanttoseeaplaywithhimthatnight.Only inthetaxi,Ilearned anewplayabout ‘I wasinLondonjustforthreedays, castingRagtime.Bysheercoincidence,myrepresentative,Mr. Lantz,wasalsoinLondon. Onedayhe Robert Vienna. MilosForman’s director’s cutfeatures 20minutesofrestoredfootagethatwasremovedbeforethefilm’s originalreleasein1984. unfoldsinthestreets,homesandpalacesofaremarkable recreationof18thCentury print, AmadeusisfilledwithMozart’s timelessmusicasitsstory venueVictoria awards.Presentedintheorchestral concert Hallfromadigitalcinema won8Oscarsandscoresofotherinternational that deservedly Amadeus isthemagnificentandexhilaratingepicaboutgenius of anditsimpactonrival composerAntonioSalieri Wolfgang AmadeusMozart oflife.’StanleyKubrick,Director,his relationshoptohigherforms 1968 if 2001succeedsatall,itisinreachingawidespectrumofpeoplewhowouldnotoftengivethoughttoman’s destiny, hisroleinthecosmosand viewerwillfeelobligatedtopursueorfearhe’slevel—but Idon’t wanttospelloutaverbalroadmapfor2001thatevery missedthepoint.Ithinkthat deep philosophical andallegoricalmeaningofthefilm—andsuchspeculationisindicationthatithassucceededingrippingaudienceatavery barrierbetweenconceptionandappreciation. would betoemasculateitbycreatinganartificial You’re freetospeculateasyouwishaboutthe an intenselysubjectiveexperiencethatreachesthevieweratinnerlevelofconsciousness,justasmusicdoes;to“explain”aBeethovensymphony the subconsciouswithanemotionalandphilosophiccontent.To convoluteMcLuhan,in2001themessageismedium.Iintendedfilmtobe minutesofdialog.Itriedtocreateavisualexperience,onethatbypassesverbalizedpigeonholinganddirectlypenetrates only alittlelessthanforty ‘It’s notamessagethatIeverintendtoconveyinwords.2001isnonverbalexperience;outoftwohoursandnineteenminutesfilm,thereare futurist design,suspensefulaction,trippypsychedelia,andamagnificentsoundtrack.Thescreeningin Victoria Hallwillfeaturea20minuteinterval. CClarke’simaginative adaptationofArthur mind-bendingnovel,anepisodicspectaclefeaturingballeticsequencesofcine-choreography, awesome venueVictoria Hall.StanleyKubrick’sorchestral concert sci-ficlassicisrepeatedlyvotedintolistsoftop10moviesalltime:it’s visionary abrilliantly You haven’t reallyseen2001:ASpaceOdysseyuntilyou’veitonthebigscreen,andexperienceisuniqueinstunningsettingofour Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1968 Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1984 Country UK Distributor UK Distributor Strauss II,AramKhachaturian Richard Strauss,GyörgyLigeti,Johann Ray Lovejoy Sylvester Lockwood,William Keir Dullea,Gary C.Clarke Stanley Kubrick,Arthur Stanley Kubrick 149 min UK, USA T.M. Christopher Miroslav Ondríce Berridge F. MurrayAbraham,Tom Hulce, Elizabeth Saul Zaentz Peter Shaffer Milos Forman 188 min France, USA Park Circus Park Circus 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 87 SOUNDTRACKS Park Circus Park Circus 115 min Blake Edwards George Axelrod Richard Shepherd Martin Jurow, Audrey Hepburn, George Peppard, Patricia Neal Franz Planer Howard A. Smith Henry Mancini 120 min David Lynch Fred C. Caruso MacLachlan,Isabella Rossellini, Kyle Frederick Elme Duwayne Dunham Angelo Badalamenti UK Distributor UK Distributor Country USA 1961 Year Running Time Format DCP Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music CountryUSA 1986 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Come to the ‘cosiest cinema in Leeds’ for a special Saturday morning breakfast screening of the favourite starring Audrey Hepburn once again be under the alluring spell of madcap, carefree New you’ll Moon River, in her most iconic role. From the opening strains of Oscar-winning dizzying, delightfully unstructured swept into Holly’s George Peppard is the, struggling young writer who finds himself playgirl Holly Golightly. York from the Coffee, teas, cakes and pastries will all be available lifestyle as she determinedly scours Manhattan for a suitable millionaire to marry. cinema. phenomenal visual talent and his ability to film was magical. It was one of his early films, it catapulted talent with Blake’s ‘The merging of Audrey’s You should see some of the him into some kind of really important every status, and sign of his style and masterful work to come is evident in this film. cut, goes on and catches everything. idea - he cast all of his friends phenomenal long scenes where the camera doesn’t The party sequence is Blake’s and relations for it.’ Julie Andrews delineate that much in terms of party‘The script itself didn’t was going to have to invent it. I ordered champagne, shenanigans, and that meant that I I told them ‘you’ve got to help me out, see if you come up with stuff’, knowing actors and everybody was going to come up withand we had a party. fun and creative.’ Blake Edwards something at that point. And they did and out of that I selected a lot of things that I found was David Lynch’s extraordinary, nightmarish neo-noir has now outgrown its cult reputation to become a universally acknowledged classic. From the iconic its cult reputation to become a universally nightmarish neo-noir has now outgrown extraordinary, David Lynch’s deranged to the career-defining fences into the bug-infested undergrowth, the camera descends from the shining white picket opening scenes where an innovative It also boasts experiences ever. is one of the most intense cinematic psycho performance Hopper as Frank Booth, Blue Velvet by Dennis alongside a dark score by Angelo Badalamenti. An exclusive preview of the re-release on Fri 2 Dec. soundtrack, reinventing vintage pop standards ‘I started to get ideas for it in 1973 but it was all verymet Richard vague. I only had a feeling and a title. Then, when I finished The Elephant Man, I his he said, it wasn’t my script for Ronnie Rocket. He had liked it but, truly, had coffee and he told me he had read Roth, the producer of Julia. We her into room to watch I said I had only ideas. I told him I had always wanted to sneak into a girl’s cup of tea. He asked me if I had any other scripts. Roth loved the idea and asked be the clue to a murder mystery. I would see something that would the night and that, maybe, at one point or another, opening. An ear is wide and you can go an of the ear in the field. It had to be an ear because it’s me to write a treatment. I went home and thought scripts but none of them had a good middle, so they were rejected. Then I got involved with Dunedown into it. It goes somewhere vast. I wrote two as if they had been all the right ideas came to me right away, Strangely, I went back to Blue Velvet. and it was only after the movie was released that got involved and the project took another turn.on my mind all that time. Then Dino De Laurentis could have total artistic I freedom if I kept the budget Director Of course, I took the deal.’ David Lynch, down and took a cut in my salary. Breakfast at Tiffany’s Blue Velvet: New Digital Cinema Restoration Cinema Digital New Velvet: Blue 88 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Drive Dougal andtheBlueCat SOUNDTRACKS nodded andwas like, gotit.I’min.Andthenwedid it.’NicolasWinding Refn,Director that drivesaround inacaratnightandlistenstopop musicbecausethat’s quicklyjustcaughtuponthat andjust hisemotionalrelease.’ Ryan very toRyan,turned forthefirsttime,andIlookedathim inthecar, andIjustscreamedin his face,‘IknowwhatDriveis.It’s goingto be aboutaman break thesilence,andREOSpeedwagon’s ‘ICan’t toplay. FightthisFeelingAnymore’starts tocry. ThereIam,singingthissong,andthenstart I uniqueinhisauraaroundhim.Sowe’resittingtheresilenceand Ryan on theradioto turns though Iwasoutofitknewthatthe manwasvery that wasabouttogoterriblywrong. We gotintohiscarandweweredrivingalongthehighway injustawkwardsilence.Ilikedhimsomuch;even me home,becauseIcan’t driveacar andIjustneededaridehome,whichofcoursewasstrangething todobecauseitwaslikeablinddate Ryan respectful,nice,professional,andIwascompletelyzonedout. AfterwewerethroughwithdinnerIaskedhimtotake wasterrific,socourteous, ‘I gotacallaskingifIwouldhave time tohavedinnerwithRyan Gosling.I’dnevermethim,we’d crossedpaths.Iwas,yeah,sure,whynot. remarkable soundtrackwhichblendssynth-popwithdarkelectronicdrones tocreateanimpeccably-craftedcombinationoffilmicflairandsonicmenace. after hestepsintoprotecthisvulnerablenext-doorneighbourandher young son.Refn’s visionofneonoirdoomisfully realisedthroughCliffMartinez’s noir. Ryan Goslingexudesstarquality as theenigmaticprotagonistwhofindshimselfinmidstofaviciousconflictbetweenlocalthugsandMafia A hyper-stylish, ultra-violentcruisethroughtheneonlitbackstreetsofLA, NicolasWinding Refn’s craftedHollywoodneo- Driveisamasterclass inartfully fromEasyRider.’ replicateabadtripthananyfilmapart said thenightmarishscenesfromBlueCatmoreperfectly PatrickBarkham,TheGuardian rabbit, whojustwantstowatchhismushroomsgrow, andthefactthatDougalbuzzeswithexcitement whenheswallowsasugarlump.Onecritic amidst thesillinessthereishighseriousnessinThompson’s narrationandthesatireontotalitarianism.MuchhasalsobeenmadeofDylan,dozy isfromanotherera,and feelofDougalandtheBlueCatisevenmoreextremenearly40yearson.Itsramblingrhythmcharm The otherworldly andMagicRoundaboutmaniadieddown,itslippedfromhermind.[...] de Gaulle.Butaftersherecordedherpart characters. SheremembersthefussatfirstwhenThompsonnameddogDougalbecauseFrenchmistakenlythoughthewasmockingGeneral in aplayalongsideEricThompson,whoadaptedtheoriginalFrenchanimatedseriesforBritishaudiencesandnarratedvoicedallmajor ‘The filmisdelightfullyweirdbutweirderstillthefactthatFieldinghasneverseenit.ShewasaskedtovoiceBlueQueenaftershestarred trouble forthegang… presented atLIFF30inararecinemascreening.There’s ofabluecatcalledBuxton,whichmeans anewarrivalintheMagicGarden,form Thompson whoalsonarratednearlyallofthecharacters,lendingeachhisowninimitablestyleandhumour. TheEnglishversionofthefeatureis TV shows,TheMagicRoundabout.originalFrenchseriesandfeaturefilmwerepresentedintheUKwithdialoguere-writtenEnglishbyEric Dougal andtheBlueCatismagical,musicalfrequentlysurrealfeaturefilmversionfrom1970ofoneall-timefavouritechildren’s Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1970 France Country Original Title Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2011 USA Country UK Distributor UK DIstributor Joss Baselli S. Gerstemberg C. Giresse Legrand Christian Riehl,PaulBisciglia,Nadine L. Auclin,Danot J. Josselin Serge Danot 88 min Pollux etleChatBleu Cliff Martinez Matthew Newman Newton ThomasSigel Cranston ,CareyMulligan,Bryan Marc Platt,AdamSiegel Hossein Amini Nicolas Winding Refn 100 min Park Circus LCJ inParis 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 89 SOUNDTRACKS 133 min Masaki Kobayashi Shinobu Hashimoto Hosoya Tatsuo Ishihama, Shima Nakadai, Akira Tatsuya Iwashita Miyajima Yoshio Hisashi Sagara Takemitsu Toru 87 min Anderson Wes , Anderson Wes , Scott Rudin, Meryl Streep, George Clooney, Oliver Tristan Stephen Ralph Foster, Andrew Weisblum, Perkins Alexandre Desplat UK Distributor Shochiku UK Distributor Filmbankmedia Original Title Seppuku Country Japan 1962 Year Running Time Format Blu-Ray Language Japanese Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music CountryUSA 2009 Year Running Time Blu-Ray Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Masaki Kobayashi’s devastating Samurai masterpiece made a big impact at its first LIFF screening in 2013. Harakiri returns as part of this year’s devastating Samurai masterpiece made a big impact at its first LIFF screening in 2013. Harakiri returns as part of this year’s Masaki Kobayashi’s of the Dunes). (Woman Takemitsu composer Toru Soundtracks retrospective for its unique score with the Japanese biwa instrument by avant-garde Suspected of to commit ritual suicide on his property. Hanshiro is a masterless down-and-out samurai who enters the manor of Lord Iyi, requesting Hanshiro is told the gruesome tale of the last samurai who made the same request, but he will not be moved… simply seeking charity, political dissidence via the jidai-geki, or period film, in‘Like other directors of this period—notably —Kobayashi often expressed his historical roots of contemporary hands, the jidai-geki exposed the which the historical past becomes a surrogate for modern Japan. In Kobayashi’s condemnation of the Iyi clan, Kobayashi rejects the apex of this practice. In the film’s career, injustice. Harakiri, made in 1962, was, in Kobayashi’s the hierarchical structures that pervaded Japanese political and social the notion of individual submission to the group. He condemns, simultaneously, feudalism. [...] Harakiri won the Special Jurylife in the 1950s and 1960s, especially the zaibatsus, the giant corporations that recapitulated Prize the five greatest Japanese films of all time. Kobayashi Kinoshita, pronounced the film a masterpiece, among mentor, at Cannes in 1963. Kobayashi’s in the late 1960s and formingwould continue working for another two decades, ultimately breaking out of the studio system Yonki-no- though, would remain the most vibrant expression of hisKai, or the Club of the Four Knights, with Kinoshita, Kurosawa, and . Harakiri, belief that life is not worth is confronted with unrelenting and single-minded purpose.’ Joan Mellen, The Criterion Collection living unless injustice Join us on board the barge at Leeds Dock for family friendly screenings of Wes Anderson’s wonderfully animated adaption of Roald Dahl’s Fantastic wonderfully adaption of Roald Dahl’s animated Anderson’s of Wes at Leeds Dock for family friendly screenings Join us on board the barge Fox breaks a promise After 12 years of idyllic bliss, Mr. Meryl Streep and Bill Murray. cast including George Clooney, Mr Fox, voiced by an all-star neighbours’ farms.to his wife and raids their their animal friends. Trapped endangers both the lives of his family and Giving in to his animal instincts around, the animals band together to fight against the disgruntled farmersunderground and with not enough food to go who are determined to cost. capture the crafty and fantastic Mr Fox at any was a book that introduced It was a book I loved as a child and it owned, as officially my property. ‘This was the first book that I ever personally and asked for Felicity, widow, Dahl’s work in general, so it made a big impression on me. About 10 years ago I approached me to Roald Dahl’s for it to be stop motion… I wanted to do a stop motion movie with animals with fur, been a long process. I always intended permission to do it, so it’s animators become pain-staking process and the that odd, magical style. Animating is a verybecause I’ve just always loved the way that looks… slow, movie we had 30 units going on at once. I was not in London during the whole shoot. Sometimes I wasthe actors at that point. At the most during this had a computer veryhere and sometimes I was elsewhere, but it was consuming and you have to work on it all the time while you’re shooting. We cameras at once to see what was happening on each set and work with all the different people. Theresystem where I could look through 30 different Anderson, Director and executing the shot.’ Wes were hundreds of people designing, preparing Harakiri Fantastic Mr. Fox Mr. Fantastic 90 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Interstella 5555 In theHeatofNight SOUNDTRACKS antiquated and another part cold,baroquefuturism,all settowitty, taleandanother part antiquated fairy Frenchhouse.’ CityPaper life-affirming Rogers actionsequences, soft-featureddreamyspace boys,thin-waistedFarrahFawcett-haired intergalacticprincesses,and aworldthat’s onepart Sailor Moonand the originalDragonBall,soyou’re fullycaughtupinlate’80s,early ‘90sJapanimation’s melodramaticmilieuhere:glam-popBuck animatorLeijiMatsumoto,bestknown forSpaceBattleshipYamatolegendary andStarBlazers,directorKazuhisa Takenouchi whoworkedon arereallyonemultimedia experienceconceptualizedtogether).Fortheproject,DaftPunk collaboratedcloselywith that InterstellaandDiscovery to full-stopsell-outthemassesas TheCrescendolls(alsothenameofoneDaftPunk’s evidence mostunabashedlybouncytracksandfurther ofapopbandfromanotherplanetthat getskidnappedbyanevilrecord-labeltypenamedEarldeDarkwood andbroughttoearth tell thestory poem: Nodialogue,minimalsound effects,andmostlymusic(specifically, songontheFrenchHouseduo’s every 2001album,Discovery, in order) ‘There’s asilent filmqualitytoInterstella,operatingasbothasuper-compelling soapoperaandanambitious,ambientmusicvideo tone cartoon ofacorporatemusiccompanytothetuneOneMoreTime. slavery the cosmosandrescuethem.Featuringnodialogue,soundtrackcomprises theentirealbumaswewitnessband’s struggletoescapethe itislefttotheirnumberonefanflyacross Battle ofthePlanets.Whenanalienrockbandiskidnappedbyevil musicmogulandtakentoEarth, The visualrealisationofDaftPunk’s secondstudioalbumDiscovery, Interstella5555 isauniquefantasymusicaladventurewiththeanimatedstyleof Illinois. Itwasn’t easy.’ Jewison,Director Norman didn’t wanttogosouthoftheMason-Dixonlinewithpoliticalclimatebeingwayitwasthen.We shotmostofitinalittletowncalledSparta, ButIdon’twhispered ‘See,Itoldyouthetimingwasright,Norman.’ thinkanyonereallyknowswhatthereactiontoafilmisgoingbe…Sidney award, andwhenIacceptedtheawardatSardi’s Kennedy, whowaspresentingit,butSenatorRobert fromNewYork. Ashegaveittome, surprised whenpeoplereactedtoitinsuchastrongway. Thenthenicethingthathappened wasTheNewYork FilmCriticsgaveittheirBestPicture a socialcomment,Ithinkit’s thatitbeatatimepeoplewanttodiscussit,andyouneverreallyknow. important It’s instinct.Iwaskindof think anyonewasgoingtocomeseeit.Therewerenewspapersthatwouldn’tcities.Whenyou’remakingafilm thathas taketheadincertain film.’Ididn’t important filmforitstime.Ithinkthetimingwasright,asBobbyKennedysaid.Hetoldme,‘Thisisavery ‘I thinkitwasanimportant oftheBFIBlackStarseason. Jayaspart the unlikelypairareforcedtoworktogetherunravelmystery. DJNorman Introducedbylegendary thatheisDetectiveVirgilman butisembarrassedtolearn Tibbs fromPhiladelphia.When thevictim’s widowdemandsthatheleadtheinvestigation, by QuincyJones.WhenawealthyindustrialistisfoundmurderedinsmallMississippitown,thelocalPoliceChiefarrestsvisitingAfrican-American bySidneyPoitierandRodSteigerakillersoundtrack Classic, civilrightseracrimedramaIntheHeatofNightfeaturesbrilliantperformances Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1969 USA Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format Blu-Ray Running Time Year 2003 Country UK Distributor UK Distributor Quincy Jones Hal Ashby , ASC Sidney Poitier, RodSteiger, Warren Oates Walter Mirisch Stirling Silliphant Jewison Norman 109 min Shigeru Nishiyama,OlivierGajan Fumio Hirokawa Romanthony, Homem-Christo Thomas Bangalter, Guy-Manuelde Homem-Christo, CédricHervet Thomas Bangalter, Guy-Manuelde Kazuhisa Takenouchi 68 min France, Japan Warner Bros Park Circus 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 91 SOUNDTRACKS 127 min Michael Crichton, David Koepp Gerald R. Molen Kathleen Kennedy, Sam Neill, Laura Dern, Jeff Goldblum Dean Cundey Michael Kahn John Williams 124 min Steven Spielberg , Brown Richard D. Zanuck, David Richard Dreyfuss, Robert Roy Scheider, Shaw Bill Butler Fields Verna John Williams UK Distributor Universal UK Distributor Universal Country USA 1993 Year Running Time Format DCP Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music CountryUSA 1975 Year Running Time DCP Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Screening as part of LIFF30’s soundtracks season with , another John Williams-scored blockbuster by Steven Spielberg, Jurassic Park was a soundtracks season with Jaws, another John Williams-scored Screening as part of LIFF30’s breathtaking to see on a cinema screen. For the famous,phenomenal feat of fantasy filmmaking, bringing dinosaurs to life on an epic scale that is still from had wanted to write music ‘that would convey a sense of awe and fascination’ that would come stirring main theme of Jurassic Park, Williams ‘overwhelming park… happiness and excitement’ on seeing live dinosaurs, at least while they were at a safe distance in a supposedly secure theme ‘They were a lot of risks involved in an artform had never been perfected. that A digital dinosaur as main character had never been done before – the could have played it safe and risk all of us took. We entire success or failure of the movie was dependent on these digital characters. That was the had already done months and prepared to do his magic with his go motion animation. We [visual effects supervisor] was standing by, But when got together with some other people at ILM, we all done with claymation. months of tests, with Raptors, Gallimimus and T-Rex all decided to give this new technology a chance. Ray Harryhausen was scheduled to meet me for the first time and [famous stop-motion animator] we have this great conversation, and I say over, come over to Universal to say hi to me – I had never met him but I’m a huge fan of his. He comes ‘would you like to see a digital dinosaur?’ I brought him over and showed him the very which was Gallimimus running across the field. first test, No the future.’ Steven Spielberg, Director That’s flesh yet, just skeletons Gallimimus. And he looked at that and said ‘well, there is your future. Two blockbuster monster movies by Stephen Spielberg, Jaws and Jurassic Park, are screening as part of LIFF30’s soundtracks season, both scored, soundtracks and Jurassic Park, are screening as part monster movies by Stephen Spielberg, Jaws blockbuster of LIFF30’s Two chief of white shark, the town’s itself under attack by a dangerous great In Jaws, the seaside community of Amity finds of course, by John Williams. a grizzled shark hunter (Robert young marine biologist (Richard Dreyfuss) and police (Roy Scheider), a on a desperate quest to destroy Shaw) embark away at you, just as a shark would do, instinctual, as ‘grinding Jaws theme is described by Williams the beast before it strikes again. The classic main relentless, unstoppable.’ to Sugarland, we became friends, and obviously I All my life. And when he said yes Williams. ‘I had always wanted to be in business with John wanted him to do every the main came second. When he finally played the music for me on , he previewed picture I ever made, and Jaws of weird and melodic, kind of tonal but eerie. And what he played for me instead with two fingers onJaws theme. I expected to hear something kind I thought he was putting me on. And and at first I began to laugh. He has a great sense of humour, the lower keys was ‘Duh dun, duh dun, duh dun,’ seemed right. John found the signature for the theme to Jaws!’ And I said, ‘Play it again.’ And he played it again, and it suddenly he said, ‘No, that’s to celebrate is how he spots music and how he places music in a movie. John did not want music the entire movie. Part of the genius of John Williams the actual arrival of the shark. I think the score was clearly responsible for half of the success of thata red herring; he only wanted music to signal movie Jaws.’ Steven Spielberg, Director Jurassic Park Jaws 92 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Labyrinth SOUNDTRACKS than twogurgles together, soIendedupdoingthebaby gurglechorusesmyself!’,1986 baby, sungbythemandthe goblins inthecastlethroneroom, Ihadproblems.Thebabyused in therecordingstudioscouldn’t, or wouldn’t, putmore popular.they’re abitcruel, butinfectiouslyhilarious,andIthin they’regoingtoprovebevery With ‘DanceMagic,’thesongforJarethand film was‘ChillyDown’,alittleswamp-type numberfortheChilliesor Wild Things,strangewoodlandcreatures whowaylaySarahonhertravels: without beingviciousorspiteful bloody, thanmanyotherspecialeffectsmovies.Oneofthe songsIcomposedforthe anditalsohad moreheart else,and ImustsaythatJimgavemeacompletelyfreehandwithit.Thescript itselfwasterriblyamusing children ofallages,aswelleveryone the potentialofaddinghumansto his strangeworld.I’dalwayswantedtobeinvolvedinthemusic-writing aspectofamoviethatwouldappealto whichreallyexcitedme.Icouldsee some ofBrianFroud’s Thatimpressedmeforopeners,buthealsogave meatapeofTheDarkCrystal, artwork. ‘Jim Hensonsetupameetingwith me whileIwasdoingmy1983tourintheStates,andheoutlined basicconceptforLabyrinthandshowedme a wealthofsongsbyhimincludingMagicDance.Acultclassicforboth adultsandchildrenalike. Along thewayshemeetsfantasticpuppetcreaturesproducedinHenson’s creatureworkshop.Thisisone ofBowie’s mosticonicfilmrolesandfeatures quest toreachthecentreofgiantmaze,assheattemptsrescue herbabybrotherwhohasbeenkidnappedbytheGoblinKing(DavidBowie). It’s celebrationforLIFFandJimHenson’s ajoint30thbirthday fantasyadventureclassicLabyrinth.Join15year-old Sarah(JenniferConnelly)onher the magicofcollaboration,ismany-one.’GodfreyReggio,Director inthisforum,astrongegoisrequired.However,participate Ourgoal, vanityofego,nomatterhowtalented,isnotproductiveincollaborativeart... isconcerned. andclearlythemostdifficultwhereart always selectcollaboratorsthataremoretalentedthanI.Collaborativecreativityistheform To a blindmanthatseesthroughother’s eyes,like adeafpersonthathearsthroughother’sI ears.Thesefilmsarefarbeyondmycapacitytoachieve. mother toanassassin.Thefilmmustsatisfymysensibilities,muse.Theyarenotmadebycommittee.Idomakefilms,livethem.amlikeunto Asafilmdirector,understand, threeasthematrix.AtthatmomentPhilipandIagreedQatsitrilogyshouldbeborn… a from Iameverything Idoembraces,forreasonsnot Glass earlyonintheprocess,heremarkedthatthingsgobestthrees.Thiswasmusictomyears.Everything I wascommittedtothefilm,notwithgraceorgratuity, butlikeuntoaninsaneasylum.As thefilmdeveloped,sodidI.InaconversationwithPhilip ‘When IbeganKoyaanisqatsiin1975,mythoughtwas,shouldcompletethisendeavour?Lifewouldhaveofferedmeafullnessbeyondsatisfaction. soundinLeedsTownof peopleintheRadioCityMusicHall,don’ttoexperienceitonasimilarscalewithfullconcert misstheopportunity Hall. environment. KoyaanisqatsiisaHopiIndianwordmeaningunbalancedlife.Itwasoriginallyscreenedasanexcitingevent-filmexperiencetothousands Reggio. Heusedaninnovativesynthesisofslowmotionandtimelapsecameratechniquestoexploretheeffectsurbanlifedtechnologyon byPhilipGlass,KoyaanisqatsiisanaudiovisualextravaganzafilmmakerGodfrey Featuring oneofthemosticonicsoundtracksinfilmhistory Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1982 USA Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1986 Country UK Distributor UK Distributor Philip Glass Ron Fricke,AltonWalpole Ron Fricke Lou Dobbs,Ted Koppel Godfrey Reggio Walpole Ron Fricke,MichaelHoenig,Alton Godfrey Reggio 86 min Trevor Jones John Grover Alex Thomson Goelz David Bowie,JenniferConnelly, Dave Eric Rattray 101 min UK, USA Park Circus Park Circus 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 93 SOUNDTRACKS UK USA, Japan 101 min Sofia Coppola Sofia Coppola, Ross Katz Scarlett Johansson, Giovanni Bill Murray, Ribisi Lance Acord Brian Reitzell, , Roger Joseph Air Manning Jr. 119 min Anderson Wes Noah Baumbach Anderson, Wes Anderson, Barry Mendel, Scott Rudin Wes Cate Blanchett Owen Wilson, Bill Murray, David Moritz Mark Mothersbaugh UK Distributor UK Distributor Filmbankmedia Country 2003 Year Running Time Format 35mm Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music CountryUSA 2004 Year Running Time Blu-Ray Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Sofia Coppola’s second feature is a subtle comedy about loneliness and melancholy. An ageing actor (Bill Murray) and a lonely newlywed second feature is a subtle comedy about loneliness and melancholy. Sofia Coppola’s hotel and form an unlikely but heartfelt friendship. Both strangers in a foreign land, they share a similar (Scarlett Johansson) cross paths in a Tokyo explore the city by night, equally compelled and alienateddissatisfaction with their lives and the same need for human connection. The jet-lagged pair by the ambient soundtrack reflecting the deep sense ofby their strange surroundings. The starkness of the hotel and loneliness they feel is amplified nostalgia throughout the film. wanted [to shoot] the neon at night, I knew the setting. I wanted to shoot at the Park Hyatt hotel, and I ‘For a while, I’ve wanted to do a movie in Tokyo. Suicides I stayed at the Park Hyatt hotel during a Virgin and I wanted to make something romantic. I wanted to make a love story without being nerdy. very silent. And the design of it is is so hectic, but inside the hotel it’s just one of my favorite places in the world. Tokyo It’s promotional/press tour. of different cultures. I this weird combination It’s bar…the jazz singer…the French restaurant, all in Tokyo. weird to have this New York interesting. It’s started music supervisor working with Brian Reitzellwho was the Suicides. I started him about the script when I was writing, and he made telling on Virgin and Brian thought to approach Kevin Bloody Valentine, me all these compilation CDs, just kind of the music we were talking about. I always loved My a score and more like these mixtapes he used to make me.Shields, which was really exciting. I work pretty closely with Brian. I wanted it to be less like that melancholic, romantic sound that Kevin Shields is so great at.’ Sofia Coppola, Director they sounded like dream pop. It’s They reminded me of Tokyo, What better way to watch Wes Anderson’s whimsical classic than on board a barge. Renowned oceanographer Steve Zissou (Bill Murray) sets sail than on board a barge. Renowned oceanographer whimsical classic Anderson’s Wes What better way to watch including Cate Blanchett, Owen his friend. He is joined by an all star crew revenge on the rare jaguar shark that devoured on an expedition to exact (Anjelica Huston). estranged wife, Eleanor dangers including pirates and Zissou’s On their adventures they run into various Dafoe. and Willem Wilson Mark Mothersbaugh of Devo, as well as Seu Jorge performingThe lively soundtrack features compositions by in renditions of David Bowie songs Portuguese on an acoustic guitar. ‘I wrote a little short of this one character it was like one paragraph that was just a description story even a short story, when I was in college. It wasn’t mean for it to be a movie. I was just trying and the ship, The Belafonte, and just the setting. So, I had that but I didn’t character to write and Anjelica’s kept reminding who kept bringing it up from time-to-time over the years and It was actually Owen Wilson a story and it never really got any further. Anjelica and Bill Murray on the set seeing more. I remember one day on me about it and got me into thinking about it some rapport All they had together was about 30 seconds but I felt there was a great between the two of them that would be worth exploring. together. Bill Murray is a powerful feel it, whatever his mood is. There is something sort force and you will of heroic about him too. He can sweep everyone up Anderson, Director Wes part of what makes him a star.’ and that’s Lost in Translation The Life Aquatic with Steve Zissou Steve with Aquatic Life The 94 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Purple Rain SOUNDTRACKS you [Magnoli]drive withme.’’Magnoli,Director Albert a musicianwriting musicandhidingitinabox.Prince lookedatmeandsaid,‘Okay.’ AndhelookedatSteve andChicksaid,‘You takeoffand session:Suddenly Isawtheviolence,dysfunctional relationshipwithhismother,‘What theheck?’ I launchedintoanotherstorytelling hisfatheras surprised.HelookedatSteveandChickhemusthave beenthinking, ItoldBobyesterdayinLosAngeles.’ Princewasvery to talkaboutastory side ofPrinceandthemanagers. lookedatmeandsaid,‘Whatdoyouthinkaboutthescript?’I said,‘I’mnotheretotalkaboutthat.I’m Prince lookedoverhisshoulderat me, noddedandwalkedoutthedoorwedrovetoarestaurant. At therestaurant,Iwassittingonother moment, Ifeltamassiveamountof vulnerabilityandshyness,areticence,comingfromhim.Hewasjust walking. the doorsopenedandPrincestepped out,allalone.Iwasabletowatchhimwalkfromtheelevator Chick inalongleft-to-rightpan.Andthat ‘I wasbroughttoahotelwherePrince wasstaying.Steve[oneofPrince’s manager] wasjoinedbyChick,Prince’s bodyguard. Atexactly12midnight, upset,TheKidrespondsintheonlywayheknowshow:focuson music,crushhisrivalandgetthegirl. almost terminally zoot-suited loverival,adifficultrelationshipwithhisalcoholicfather, andhisownincreasingarrogance.Asdreamsofsuperstardombecome PrincestarsasTheKid,amusicianonthecuspoffamebesetbyhisjealousyover most thrillingandprovocativeperformer. Thelate,legendary yearsonfromitsoriginalrelease,PurpleRainremains a dazzlingcelebrationofonethe1980s’sOver thirty premierpopalbumsandthatdecade’s right, thentheeffectisyoucanneverreallyhearthissongagainwithoutthinkingaboutthatimagefrommovie.’QuentinTarantino, Director itreallyworksinthisvisceral,emotional,cinematicwaythat’s form; do betterthananyotherart justreallyspecial.Andwhenyoudoitrightandhit the factthatifyoudoitright,userightsong,inscene,it’s aboutascinematicathingyoucando.You arereallydoingwhatmovies you, agauntletisthrowndownthatthemoviehastoliveupto;itslikesaying‘We’re big!’Oneofthethingsaboutusingmusicinmoviesthat’s socoolis opening creditsisjustsointense,itsays‘youarewatchinganepic,youthisbigoldmoviesitback.’It’s soloudandblaringat your that’s that,insomeways,it’s toprojectinthisfilm.HavingMisirlouas important, liketherhythmandmoreorless thepersonalitythatyou’retrying really kindoftriggersmeintowhatthepersonalitypieceshouldbe.You don’t evenhavetousemusic,itcouldjustbesilence,allright!But tofindwhattherightopeningorclosingcreditshould be earlyon,whenI’mjusteventhinkingaboutthestory.‘I’m alwaystrying OnceIfindit,that sumptuous seventiessoul. rockstandards,NeilDiamonddancesequencesand through theprismofthreestories,twelveprincipalcharactersandaniconicsoundtracksurf table. Anindisputablybrilliantmovie,Tarantino pilfersvintage Godard andScorsesetocraftthisscintillatingmosaicoftheLosAngelescrimeworld dynamite actingfromTravolta, Willis Thurman, andJackson,hisremarkableabilitytofashionsuchincredibledramafromscenesatabreakfast ’s mesmerisingtwistonthepulpgenreismemorableformyriadreasons:irresistible–andendlesslyquotabledialogue, Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1994 USA Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1984 USA Country UK Distributor UK Distributor Andrzej SekuÅâa Thurman , SamuelL.Jackson,Uma Lawrence Bender Quentin Tarantino Quentin Tarantino 154 min Michel Colombier Magnoli Albert Donald E.Thorin Prince, ApolloniaKotero,MorrisDay Fargnoli Cavallo,JosephRuffalo,Steven Robert Magnoli,WilliamAlbert Blinn Magnoli Albert 111 min Park Circus Park Circus 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 95 SOUNDTRACKS British Film Institute British Film Institute UK, USA 146 min Stanley Kubrick Stanley Kubrick, Diane Johnson Stanley Kubrick Jack Nicholson, Shelley Duvall, Scatman Crothers Ray Lovejoy Carlos, Rachel Elkind Wendy 87 min John Cassavetes John Cassavetes Maurice McEndree Hugh Hurd Ben Carruthers, Leli Goldoni, Erich Kollmar McEndree John Cassavetes, Maurice Charles Mingus UK Distributor UK Distributor Country 1980 Year Running Time Format DCP Language English Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music CountryUSA 1959 Year Running Time Blu-Ray Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Seeing and hearing Stanley Kubrick’s horror masterpiece in the opulent Gothic-style setting of orchestral concert venue Victoria Hall is a unique horror masterpiece in the opulent Gothic-style setting of orchestral concert venue Victoria Seeing and hearing Stanley Kubrick’s bestselling novel, The Shining is the story of family man and would-be writer Jack and even more unsettling experience. Based on Stephen King’s (Jack Nicholson) going mad as winter caretaker of the cursed Overlook Hotel. Presented at LIFF30 as part of the season of films with classic Torrance longer than the European version). soundtracks, The Shining is screening from a digital cinema print of the US version (24 minutes chosen until very‘The location, in Glacier National Park, Montana, wasn’t near the end of principal shooting. It was important to establish an ominous winding roads which would first drive up to the hotel -- the vast isolation and eerie splendour of high mountains, and the narrow, mood during Jack’s become impassable after heavy snow. since the Middle Ages. It was re-orchestrated forThe title music was based on the Dies Irae theme which has been used by many composers Music for Orange. Bartok’s Carlos and Rachel Elkind, who did most of the music for A Clockwork synthesizer and voices by Wendy was used. But most of the music in the film came fromStrings, Percussion and Celesta was used for several other scenes. One composition by Ligeti Dream was used in the scene when Jack wakes up from his nightmare, a strange the Polish composer Krystof Penderecki. One work titled Jakob’s coincidence. Actually there were a number of other coincidences, particularly with names. The character that Jack Nicholson plays is called Jack in the novel. His son is called Danny in the novel and is played by Danny Lloyd. The ghost bartender in the book is called Lloyd.’ Stanley Kubrick, Director John Cassavetes’ debut feature Shadows is a landmark film, generally considered to be the first genuinely independent American feature. It also considered to be the first genuinely independent feature Shadows is a landmark film, generally John Cassavetes’ debut has one of the greatest jazz scores in film history film language based on improvisation and pioneered a radical new by Charles Mingus and Shafi between a Shadows follows the doomed relationship lively milieu of artistsHadi. Set amongst the 1950s New York, and jazz musicians in bohemian a struggling jazz singer. brother, man who betrays his prejudice when he meets Lelia’s a white young mixed-race woman Lelia and Tony, loft on 13 January to the people in the class, and 1957. I dreamed up some characters that were close ‘Shadows began as a dream in a New York the characters until we all began to function as those characters at any given moment. One particularthen I kept changing the situations and ages of a black girl who passes for white. It was a basic melodramatic situation in which she was seduced byimprovisation exploded with life. It was about colored. I chose a situation like this so that the actors would have something definite and emotional toa young man, who then realized that she was me matter to could be captured on film. Until dawn that morning,react to. The wild dream grew that this improvisation the dreamers talked. It didn’t it just became a way of life where you got close to people and where you could hear ideas that weren’t whether or not Shadows would be any good; and our main objective was just to learn. It was an experiment all the way, had no intention of offering it for commercial distribution. full of shit. We were working for the fun Not one actor was paid for his services, us going was enthusiasm. We nor were the technicians given anything. What kept John Cassavetes, Director importantof doing something we wanted to do. It is more to work creatively than to make money.’ The Shining Shadows 96 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES Under theSkin Stop MakingSense SOUNDTRACKS couldn’t comeupwith aplan.Iwishcould’ve.But that’s whatweendedupwith.’Mica Levi,Composer I of difference ofexpressionthereiscreated bytheclashingofmicrophones. Ifindthatlovethat.Those arethethingsthatendeduphappening. sort you getanairiness, andcreepiness,there’s astruggleinthat.Thevibratodoesn’t ringout.It’s dead.Alotofthescoreuses microphones,andany because theycontainalotofair. Aviolaisnotsolid,thesound itproducesislikeaphotocopyof something,because and not-fineplaying. depends onwhatitneeded.Alotof thesoundisamixtureofbadrecordingtechnique,onmypart, Violas aresoharmonic It’s I’mreallyinterested in,anyway–andthenjustdoingimpressionsofthat.Butit ofspeed–whichisadistortion and distortions alotof harmonics, tofollowhertrajectory, basically trying andhewantedthemusictobedoing thesamething.Ijusttriedtostickwithherandnotstrayfromthat. immediately,could change.Heaskedmetowatch it,andthenwegotstarted really. [thecharacter]throughthesescenarios, Thewholefilmobserves ‘The wholethingwassurprising.It was outoftheblue.JonathanGlazertalkedaboutfilmandsaid thatitwasn’t finished,andthatanything soundtrackbyMicaLevi. worldseemalien,notleast fortheunforgettable,otherworldly stylistic tourdeforce,whichmakesthehumdrum,everyday usingnonprofessionals,unawareofthecamera,it’sstreets ofScotlandinatransitvan,pickinguplonelymentoprocess their bodies.Filmedpartly a masterpiece.LooselyadaptedfromMichelFaber’smodern castScarlettJohanssonasan alienseductress,roamingthe novel,thefilmstarsaperfectly Jonathan Glazer’sa bysurpriseonitsreleasein2013andhasrapidly gainedareputationas captivatinglystrangesci-fidramatookeveryone ‘Jonathan sawthingsintheshowthatIdidn’t Talking realizewerethereordidn’ttheywere.’DavidByrne, realizehowimportant Heads speaks toalackofeditorialconfidenceintheplayersandmusic.’JonathanDemme,Director athand,insteadofconstantlyinterruptingtheflowwithun-neededcuts. become moredeeplyinvolvedintheperformance Too muchcuttingusually shots insteadofquickcutsisaresultmybeliefthattheregreatpoweravailablebyholdingonanyextendedterrificmomentandlettingtheviewer we pulledbackfromshowingtheliveaudience,itmadeourfilmfeelthatmuchmorespeciallycreatedformovieaudience!..Theuseofextended that therewasalwayssomethingfarmoreinterestinggoingonstagethaninthe‘best’ofouraudiencefootage.Thisledtorealizationif choreography, wasthereintheshowbeforefilmmakersshowedup…Incuttingroomwequicklydiscovered thesongline-up—everything ‘David reallysawthismovieinhisownheadlongbeforewecameandpitchedhimonlettingusshootit…Thebigsuit,thelighting,staging, Once inaLifetimeandGirlfriendisBetter, completewithgiganticbusinesssuit. and ghettoblaster, totherapturousversionofAlGreen’s Take MetotheRiverwithfullbandandbackingchoir, takinginclassicsalongthewaylike film experienceofalltime. Talking Headsdesignedanunforgettable stageshow, buildingfamouslyfromtheopeningPsychoKiller, withDavidByrne oftheSoundtracksselection.StopMakingSenseinitsfulldigitalrestorationisstillbestconcert Back bypopulardemandandasanessentialpart Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 1984 USA Country Original Music Film Editor Cinematographer Leading Cast Producer Screenwriter Director Language English Format DCP Running Time Year 2013 Country UK Distributor UK Distributor Talking Heads Lisa Day Talking Heads Goetzman Gary Talking Heads,JonathanDemme Jonathan Demme 88 min Mica Levi Paul Watts Daniel Landin Scarlett Johansson James Wilson, NickWechsle Walter Campbell,JonathanGlazer Jonathan Glazer 108 min UK, USA,Switzerland Park Circus Palm Pictures 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com RETROSPECTIVES BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 97 ko Kishida Abe ō b SOUNDTRACKS ō British Film Institute Suna no onna 123 min Hiroshi Teshigahara 97 min Sofia Coppola Sofia Coppola Julie Costanzo,, Chris Hanley Kirsten Kathleen Turner, James Woods, Dunst Kent Melissa James Lyons, Ono Kiichi Ichikawa, Tadashi Eiji Okada, Kyō Hiroshi Segawa Fusako Shuzui Takemitsu Toru UK Distributor Original Title Country Japan 1964 Year Running Time Format 35mm Language Japanese Director Screenwriter K CountryUSA 1999 Year Running Time Blu-Ray Format English Language Director Screenwriter Producer Leading Cast Cinematographer Film Editor Original Music Air UK Distributor Filmbankmedia Producer Leading Cast Cinematographer Film Editor Original Music Hiroshi Teshigahara’s Oscar-nominated Woman of the Dunes remains a timeless and innovative masterpiece, steeped in profundity and simplicity. This steeped in profundity and simplicity. of the Dunes remains a timeless and innovative masterpiece, Woman Oscar-nominated Hiroshi Teshigahara’s story landscape of a hapless entomologist faced with the prospect of living out the rest of his life with an enigmatic widow in remote and challenging modernist hypnotic, score is a masterclass in Takemitsu’s is teeming with existential allure, wondrous cinematography and graceful eroticism. Toru masterful direction as the entire production effortlessly glides between philosophy, electronic minimalism and sublimely compliments Teshigahara’s poetry and cinematic artistry. Teshigahara] 1964 collaboration with novelist-playwright-scenarist Kobo Abe, stands at the high point of Woman in the Dunes, [Hiroshi ‘The feature film the textures of his potteryhis filmmaking career and constitutes the most eloquent of his several works with Abe. Using and the grand scale of his floral text the full force of his nonverbal artistry From brings to Abe’s of chiaroscuro, of shapes and surfaces, and languor. of speed constructions, Teshigahara to the gently curved which harks back shapes, rough surfaces, and muted glazes of vessels associated with the refinements of his work as a potter, a in the Dunes, bringing them to life as a key player in he lends a sculptural beauty to the sands of Woman late sixteenth-century Japanese tea ceremony, foremost schools of ikebana As the heir to Sogetsu, one of the world’s the drama of a man and a woman pitted against the elements and each other. Teshigahara moves between the extreme delicacy of an art-alcove scroll painting and the imposing vase for setting off a hanging flower , and music.’ Audie Bock, The Criterion Collection drama of gigantic blooming forests constructed on a stage and animated with moving lights Woman of the Dunes of the Woman The VirginThe Suicides Sofia Coppola’s directorial debut is a haunting and poignant portrayal directorial debut is suburban America in the adolescence and loss of innocence. Set in of troubled Sofia Coppola’s impression on the Their doomed fates have left a lasting Lisbon sisters live a sheltered and isolated upbringing. the beautiful and mysterious mid-70’s, score composed by aesthetic is emphasised by an original dreamlike film’s to this day continue to obsess over them. The neighbourhood boys, who they live. a balance between sinister and blissful, much like the suburban neighbourhood in which striking French electronic duo Air, and there was a director with another script; he wanted to make it very‘There had been a couple of versions of scripts violent and added all this had this innocence and sweetness that I felt verydarkness and added sex. And the book, to me, saying protective of. I was talking to my friends and at the book and started‘this is how they should do it.’ So I looked back an exercise, writing how I thought it should be done. But I was just doing it as it. And then when I got half way through, I thought even planning on finishing I to a script. I wasn’t because I was curious about adapting a novel I felt so strongly about it that I went to the producers, but they said, we have someone else. Then theyshould see if I could finish something. And then, up, do you want to try it?’ called me months later and said, ‘his contract’s I wanted the whole storypoint of view and the neighbors, always looking from across the street at a distance. In my to be told from the boys’ happening, as opposed to seeing everything.’ Sofia Coppola, Director always more intriguing to imagine what’s experience, it’s 98 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 RETROSPECTIVES A JourneyThrough FrenchCinema Norman JayMBE:BlackStarTour LiveatBelgraveMusicHall Bar Film PostersExhibitionatNorth SOUNDTRACKS problem isthatIkeep discoveringnewthings.It’s Tavernier, abitofnightmare. Ithasnoend.Butit’s exciting.’Bertrand very Director and alsomanywomen directorswhoarelesswell-known. TheTVserieswillincludealmost 40minutesonJulienDuvivier, one ofmypetdirectors.The MauriceTurner,cinema etc.Andalso thepeoplewhohavebeenforgotten –suchasRaymondBernard, AnatoleLitvak,manyunderrated directors, to putinthefilm,includingsections about Tati, Bresson,Pagnol,Ditri,Clouzeau,Frenchcinema during theoccupation,foreignersworkinginFrench Panique, andVoici eighthours,filledwithmanythingsIwasn’t letempsdesassassins.In addition tothefilm,IwillmakeaTVseries,withfurther able from greatclassicssuchasJacques Becker’s Casqued’OrandRendezvousinJuly whichhavenowbeenrestored.OthertitlesincludeJulienDuvivier’s beautiful, includingexcerpts are very oftheproject.Theclipsinmydocumentary useful inthisprocess.Somefilms were notavailablebeforethestart ‘Pathé andGaumonthavealready restoredmanyclassicfilmsandasaresultofthisprojecthavedecided torestoremanymore.Myfilmhasbeenvery Tavernierwinter night.’Bertrand a thisfilmisapieceofglowingcharcoalfor keepsuswarm: withthe FrenchFilmFestival.‘Memory anecdotes.Showinginpartnership entertaining and Becker andJeanRenoirthroughtohiscolleaguescollaborators: Jean PierreMelville,andLucGodardisfullofincisiveobservations raconteur, Tavernier. Bertrand Acinemaaddictsincehisearlychildhoodin the1940s,Tavernier influences:Jacques takesusthroughhisformative ofthemanywondersFrenchCinemafeaturing thebestpossibleguide:veteranfilmmaker,A passionateandfascinatinghistory cineasteand #bfiblackstar ofBFIBlackStar,Presented byLiveCinemaUKaspart bytheBFIFilmAudienceNetwork supported Street, SlaughtersBigRip-Offplusmanymore! ‘Blacksploitation’ SoundtracksincludingShaft,ShaftinAfrica,InTheHeatoftheNight,Across110th ofmoviesoundtracks:danceto bestinblackcinemaviaahistory DJ settocelebratethevery JayMBEatBelgraveMusicHallforanexclusive introducing IntheHeatofNight,joinNorman LIFF30 isextremelyproudtowelcomeoneofthemostrespectedDJsinworldtoday. After October to 29th November during North Baropeninghours. October to29thNovemberduringNorth forthesefilmsisoftenequallyasiconicandyoucanseeourselectionfrom19th The posterartwork Quentin Tarantino’s music,popandsoulinPulpFiction. ingenioususeofAmericanrockandroll,surf with them,fromtheclassicalandavant-gardemusicofStanleyKubrick’s 2001:ASpaceOdysseyto Soundtracks retrospective.Someofthemostacclaimedfilmsfeaturesoundtracksthataresynonymous Barthisyearwewillpresentpostersoffilmsfromour For ourannualexhibitionattheNorth Original Music Film Editor Cinematographer Screenwriter Director Language French Format DCP Running Time Year 2016 France Country Original Title Contact [email protected] Sales Company Gaumont Bruno Coulais Marie Deroudille,GuyLecorne Pamart Almeras, SimonBeaufils,Julien Jermone TavernierBertrand TavernierBertrand 190 min Voyage àtraverslecinémafrançais 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 9999 SHORT FILM CITY FILM SHORT The home of big stories in little packages, ShortThe home of big stories in little City showcases the latest and greatest short Film and Awards for both the Academy films from around the world and LIFF is a qualifying festival The verywere captured in Leeds in 1888 by Louis Le Prince first moving images the BAFTAs. Our seven jam prestigious International is named after the film pioneer. Competition and LIFF’s Screendance and Music Video, packed competitions also include Animation, British, Yorkshire, include captivating documentaries, rude X-rated shorts, Panorama highlights the Audience Award. programmes Moving Image. This year we welcome guest Reality and Artist’s mesmerising Virtual from International Animation Forum and Recon Festival. Short Film Festival, Visegrad Free short Market, Leeds City Museum and on films can also be seen around the city at Kirkgate sessions include panel discussions and the Big Screen in Millennium Square. The Meet the Makers networking events that are perfect for aspiring filmmakers. 100 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY 1969). films since year-1000short produced every films research andexperimentation/20short filmsatGrec(Groupforcinematic of theshort in chargeofthedistributionandcommunication submissions from35countries. Branded Video Content)andreceivedover500 LocalFilmmakerand categories (StudentShorts, festival, whichsawthedebutof3brandnewfilm film putting togetherthe11theditionoftheirshort joined TheSmallsin2016andwasresponsiblefor Triangle, LSFF, MTV, SydneyFilmFestival).Aleks Coca-Cola) toeventmanagement(Bacardi websites. for severalSlovakfilmandculturemagazines and writes reviews,critiques,commentaries andpapers and archivalfilms.Healsoregularly documentary experimental dedicated mainlytoanimated,short, he managesthesmallestcinemainBratislava collecting Slovakdigitalgames.Asa programmer, the SlovakMuseumofDesignresearchingand Maroš Brojo Marie-Anne Campos Aleks Dimitrijevic LOUIS LEPRINCEINTERNATIONAL SHORTFILMCOMPETITIONJURY SHORT FILMCITYJURIES WORLD ANIMATION AWARD JURY BRITISH ANDYORKSHIRESHORTFILMCOMPETITIONSJURY Since 2008, she has been Since 2008,shehasbeen FilmAgency.French Short Festivals, sheworkedatthe Ferrand, andLeedsFilm Unifrance Films,Clermont- with After internships films. interested inshort Campos hasalwaysbeen France, Marie-Anne inClermont-Ferrand, Born (L’Oreal, Mercedes-Benz, for leadingglobalbrands TVCs andvideocontent ranges fromproductionof London. Herexperience Belgrade, Sydneyand working inNYC,Boston, with 12yearsofexperience & FilmFestivalProducer Aleks isanAccountDirector curator he works for curator heworksfor a films promotion.As focused onCEEanimated the NewTalents initiative Forum, hecoordinates At Visegrad Animation Festival inŽilina,. Animation International director ofFestAnča Maroš Brojoistheartistic Leeds Young FilmFestival. specifically atchildrenandyoungpeople, with Central, abrandnewanimationfestival aimed 4 Television. In2016heco-curatedAnimation TheAstronomers SunforChannel Digital short, and producedthemulti-awardwinning 4mations the Builder, ShauntheSheepandChuggington FilmFestival. Leeds International programming oftheUKandYorkshire for Shorts supplemented herfilmwatchingbyleadingon the nextcentury. Between2008and2015Wendy refurbishment schemetoseethevenuethrough David Bunting Wendy Cook freelance writer, lecturerandcurator. has beentheDirectoroffestival.Heisalsoa FilmFestivalandsince2004he Short International Niclas Gillberg hit TV shows including Bob hit TVshowsincludingBob for has alsostory-boarded on TheTigger Movie.David Animation whereheworked Walt DisneyFeature animation studiosincluding films mostwell-known has workedformanyof filmmaker DavidBunting animatorand artist, Story focused onacapital in 2006andiscurrently become GeneralManager world. Shewentonto more sweetsthantheart because cinemasincluded Picture Housein2003 working attheHydePark studentWendyart began outasan After starting has worked with Uppsala has workedwithUppsala University. Since2001he Curation atGöteborg He hasadegreeinFilm and StockholmUniversity. at UppsalaUniversity History Aesthetics andArt He hasstudiedFilmStudies, 1980 inUppsala,Sweden. in Niclas Gillbergwasborn voting memberofBAFTA. FilmFestivalinBristoland a the EncountersShort Cultural Olympiad.Sheisalsoonthe boardof ofthe2012 Movie ProjectwithAardmanaspart and wasakeycreativeoftheBAFTA winning Tate organized byAlGore Concerts the LiveEarth film‘Don’t successful short LetItAll Unravel’ for as adirector. Sarahdirectedtheinternationally Creative Europe. Wives bytheDanishFilmInstituteand supported TheSpark,andthehybridfeatureGhost supported LightsEraseYourLet theNorthern Name,theBFI- feature projectsincludingtheSundance-supported Eva iscurrentlyindevelopmentonanumberof Institute MahindraGlobalFilmmakingAward. Labs in2013,andistherecipientofSundance Sundance Institute’s Screenwriters’andDirectors’ Eva Weber Terry Wragg leedsanimation.org.uk. Buyone! Sarah Cox Aardman Animations Aardman Animations and isrepresentedby company ArthurCox winning production up theBAFTA Award and events.Sheset and juroratfilmfestivals frequent panelparticipant winning animatorand Sarah Coxisanaward London. Sheattendedthe Telluride, Edinburgh,and including Sundance, at numerousfestivals, filmshavescreened short fiction. Heraward-winning and both documentary filmmaker workingin based, German Eva Weber isaLondon- films, availablefromwww. company andhasmade40 not-for-profit production remains anindependent, 1970s. TheWorkshop helped establishinthelate women’s co-operativeshe Animation Workshop, the and adirectorofLeeds Terry Wragg isafilm-maker, 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 101 Simon Rumley has shot films in Europe, USA and South America and worked as both a director for hire as well as on his own scripts. His films have been distributed worldwide and played at festivals including Rotterdam, SXSW, Toronto, Sarajevo, Transylvania, Sarah Statham is a musician active in and promoter, various Leeds-based bands including Esper Scout, Living Body and Molars as well as a member of the arts co-op ‘Chunk’, teaching at the Leeds Music Hub and helping run DIY label Bomb the Twist. Anna Macdonald usesAnna Macdonald exploremovement to ideasphilosophical within participatory and practice.screen-based Her moving image work has been exhibited widely including Somerset House, London, Art Currents, Bluecoat Arts New York, Buenos Aires, London and Leeds. During this period, he has won over 50 prizes and Best Film awards at such esteemed festivals as Sitges, Fantasia and Fantasticfest. Empire Magazine called him ‘one of the most important and intelligent British directors working today’ whilst Screen International described him as ‘one of the great British cinematic outsiders, a gifted director with the know-how to puncture conventions.’ Simon Rumley Sarah Statham Anna Macdonald Lightmoves Kent Gallery, Centre, Liverpool, Sidney Belgium,Screendance Festival, Dascamdans, was nominated for theMiden Festival, Greece and in Barcelona. Dance awards International Video as a flagshipHer work was recently selected practice in a projectexample of socially-engaged London. Alongside curated by Creative Works, is a Senior lecturer inher free-lance practice Anna dance at MMU. SHORT FILM CITY JURIES CITY FILM SHORT Tony Morley has run The Tony Leaf Label since 1995. Initially based in South London, the label moved to in 2006, adding Yorkshire an artist management arm, Root & Branch in 2012. Robert Nevitt is an award- winning filmmaker and He festival programmer. has organised Celluloid Screams Festival since 2009, and has worked as a consultant with a wide range of film festivals including Sheffield DocFest and Bradford Marisa C. Hayes is anMarisa C. Hayes artist, scholar curator and crossroadsworking at the andof choreography She is themoving images. founding co-director of the International Screendance Centre at the University of Burgundy and recently co-edited the book Art Rob Nevitt Tony Morley Tony Marisa C. Hayes Marisa C. International Film Festival. His own films have screened at film festivals all over the world and have sold to television networks across Europe. His most recent film, Metamorphosis, starring Nicholas Nightbreed) appeared as a (Hellraiser, Vince has He currently The Fear. finalist on BBC Three’s several film projects in development. in Motion: Current Research in Screendancein Motion: Current Research Her own works of(Cambridge Scholars, 2015). selected for festivals andscreendance have been countries and haveexhibitions in over twenty Dance Films New York reviewed awards from the Movement Media in NewAssociation and Pentacle dance of France’s Marisa is editor-in-chief York. research journal Repères: Cahier de danse. Dominic Brunt is best known for his role as Paddy Kirk in Emmerdale but is also an acclaimed producer and horror film as well as starring director, as the chainsaw-weilding Podge in Alex Chandon’s Inbred (2011). His previous feature films Before Dawn Yvonne Carmichael is a Yvonne Curator based in Bradford. She is currently Artistic Programme Manager of South Square Centre, a contemporary arts and Community Space in Thornton, Bradford. She is also Creative Producer of a partnership Vespertine, Martine worked Dekker manager as a business for several since 1994 art dance institutes and The companies in Netherlands, including the Hans Hof Ensemble, Beppie Blankert Dansconcerten and Stamina, choreographic computer FANOMENON DARK OWLS INTERNATIONAL FANTASY SHORT FILM COMPETITION (PAGE 70) SHORT FILM COMPETITION (PAGE FANTASY DARK OWLS INTERNATIONAL FANOMENON Dominic Brunt Yvonne Carmichael Yvonne LEEDS INTERNATIONAL MUSIC VIDEO AWARDS JURY MUSIC VIDEO AWARDS LEEDS INTERNATIONAL Martine Dekker SCREENDANCE JURY SCREENDANCE (2013) and Bait (2015) were both distributed by Metrodome and premiered at Leeds International Film Festival. His new film, Attack Of The Adult is Babies, a very British satirical slapstick horror, currently in post-production. Dominic is also the organiser and programmer of the Leeds Horror Film Festival with Emmerdale colleague Mark Charnock. project and series of free early evening interdisciplinary arts event sited in unusual spaces and places of heritage in York. studio by Bianca van Dillen. Since 2011 she has studio by Bianca van Dillen. on Screen Festival worked at Cinedanse Dance since 2013 as the as a business manager and director. 102 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Umpire The Silence The Signalman Delusion IsRedemptionTo ThoseInDistress Clan Mondo Paranoia FilmCompetition1 Louis lePrinceInternationalShort Contact [email protected] MarchioriEditorMauroRossiMusicMattiPaalen Samadi, AliAsgariCinematographerAlberto Samadi,AliAsgariScreenwriterFarnoosh Time 15minLanguageKurdish,Italian,EnglishDirectorFarnoosh Premiere StatusYorkshire France,ItalyYear OriginalTitleIlSilenzioFormNarrativeCountry 2016Running Contact [email protected] Jacob SolitrenickEditorDanielAugustoMusicInstituto DirectorDanielAugustoScreenwriterProducer JoséCarlosLageCinematographer Portuguese BrazilYearPremiere StatusEuropeanFormNarrativeCountry 2015RunningTime15minLanguage Premiere StatusUK Premiere StatusUK Contact [email protected] Vanswijgenhoven Director LeonardovanDijlScreenwriterProducer MaïtéSpaenjersCinematographerWim BelgiumYearPremiere StatusUKFormNarrativeCountry English 2015RunningTime 15minLanguage Contact [email protected] Pessoa Producer Screenwriter FellipeFernandes Director FellipeFernandes DoraAmorimCinematographerGustavo her attentivecoach,isquestionedunderdubiouscircumstances. thatJeremy,Axelle, apromisingyoungtennisplayerisleftinincreasingdesperation whenshelearns translator forhermotherbutshekeepssilent. Fatma andhermotherareKurdishrefugeesinItaly. Ontheirvisittothedoctor, Fatmahastoactas story.short A railroadsignalmanishauntedbyaseriesofstrangeeventsinthisadaptationCharlesDickens A womanstrugglestoprovideforherfamilyamidtheimminentthreatoftheirhomebeingdemolished. raincoat whohasbeenwanderingaroundtheirlandallday. yetnooneknowsthewomaninablack A tight-knitgroupofpeopleliveandworkataderelictfarm Dutch Contact [email protected] Cinematographer RoyvanEgmond

Director StefanieKolk Editor QuentinDelarocheMusicNicolauDomingues Editor Tom DenoyetteMusicSenjanJansen

Form Narrative Form Narrative

Screenwriter StefanieKolk

Maarten Ernest Editor Maarten

Portuguese Portuguese BrazilYearCountry 2016RunningTime21minLanguage Netherlands Country

Producer LuukHoekx,MielvanWelzen

Music JelleVerstraten

Year 2016

Running Time23min

Language

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 103 Music Rudolf Pototschnig

Ghosts of My Life of Ghosts 11 min Language Spanish Running Time 11 Joel Danell Lirhus Music Editor Trude A single woman lives with a lifelike newborn doll. Her feelings of motherhood appear to be as real as the baby is lifeless while the anonymous public sets the stage for this act of deception. 2016 Running Time 30 min Language Greek Premiere Status UK Form Narrative Country Greece Year Ron Dyens, Maria Drandaki Director Konstantina Kotzamani Screenwriter Konstantina Kotzamani Producer Chalkiadakis Music Lawrence English Karvelas Editor Yannis Cinematographer Yorgos Contact [email protected] albino boy washes up on a shore alongside the carcass of a whale. A mysterious twelve year-old 2016 Running Time 11 min Premiere Status European Form Narrative Country Austria Year Christina Jauernik Language GermanDirector Ludwig Löckinger Screenwriter Florian Brüggler Producer Cinematographer Oliver Schneider Contact [email protected] Ana M. Casas, Marbella De La Cruz,Producer Director Christopher Sánchez Screenwriter Christopher Sánchez Editor Roberto Music Osvaldo Maldonado, Daniel Ulloa Villarreal Cinematographer Miguel Tafich Alejandra Tafich Contact [email protected] 2016 Running Time 15 min Premiere Status UK OForm Narrative Country France, Georgia Year Ilan Amouyal Screenwriter Dea Kulumbegashvili Producer Language Georgian Director Dea Kulumbegashvili Music MartinCinematographer Arseni Khachaturan Editor Richard Marizy Boissau, Peirre Choukroun, Thierry Delor Contact [email protected] through a village where children play with hidden By the river of oblivion, a lonely horsemen passes and violence and love are instinctive partsdesires, adults are indulged in a celebration of life. Three brothers dive back into their childhood through the prism of an old family picture of them in the into their childhood through the prism of an Three brothers dive back bathtub. 2016Premiere Status European Form Narrative Country Mexico Year A lonely man starts a journey priest to baptise the body of his deceased newborn in search of a child. Language NorwegianRunning Time 15 min 2016 CountryForm Narrative Sebastian Director Norway Year Karl Erik Moa LiljedahlCinematographer Producer Wartin Screenwriter Sebastian Torngren Wartin Torngren Brøndbo Contact [email protected] NorwegianRomanian with a group of get caught up in a conflict paramedics female ambulance Two called out to an address where it turnsimmigrants, after being nobody lives. out 2015 Running Time 13 min Form Narrative Country Austria, Germany Year Premiere Status Yorkshire Ellrich, Dominik Huber, Screenwriter Ellrich & Dominik Huber Producer Ellrich Language German Director Tim Lukas Gnaiger Editor Maximilian Merth,Leopold Pape Cinematographer Ribarits Andreas Contact [email protected] Louis le Prince International ShortInternational Prince le Louis 2 Competition Film Oxytocin Limbo Lethe Campo Santo The Bathtub Ambulance 104 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Semele Import Home Ferris Wheel Fantasy Cilaos DreamHomeaHeartache In Every FilmCompetition3 Louis lePrinceInternationalShort Contact [email protected] O’Donnel, Tim Nash,ChrisWalting, AfolabiKutiCinematographerVictor Seguin,PaulMackayEditorPhilipCurrie 20 minLanguageEnglishDirectorDanielMulloyScreenwriterProducer ShpatDeda,Scott Premiere StatusYorkshire UK,Serbia,,AlbaniaYear FormNarrativeCountry 2016RunningTime Contact [email protected] Wuttipong Leetrakul Jakrawal NilthamrongCinematographerNawarophaatRungphiboonsophitEditorPhuttiphongAroonphengMusic Thai DirectorPhuttiphongAroonphengScreenwriterProducer ChatchaiChaiyon, ThailandYearOriginal TitleChingcha-sawanFormNarrativeCountry 2015RunningTime25minLanguage Contact [email protected] Teemu NikkiMusicJanneHuttunen Director Teemu NikkiScreenwriterTeemu NikkiProducer JaniPösöCinematographerSariAaltonenEditor FinlandYearPremiere StatusUKFormNarrativeCountry Finnish 2016RunningTime9minLanguage Contact @grec-info.com Restrepo French DirectorCamiloRestrepoScreenwriterCinematographerGuillaumeMazloum, Premiere StatusYorkshire FranceYear FormNarrativeCountry 2016RunningTime12minLanguage Contact [email protected] Reinaldo MarcusGreenCinematographer PepeAvila delPinoMusicJacobPavek Running Time13minLanguageGreek Director MyrsiniAristidouScreenwriterProducer Premiere StatusUKOriginalTitle Contact [email protected] Pieter KuijpersCinematographerEmoWeemhoff Editor LotRossmarkMusicEllavanderWoude, JuhoNurmela Dutch, BosnianDirectorEnaSendijarevićScreenwriterProducer IrisOtten,SandervanMeurs, Premiere StatusYorkshire FormNarrative quite aslittleSemele plans... A signatureonaschoolnoteismerely anexcusetovisitherabsentfatheratwork,butthingsdon’t go tomakethisnew worldtheirhome. in1994.Absurdsituationsariseastheyaretrying permit A youngBosnianrefugeefamilyendsupinasmallvillagetheNetherlands aftergettingaresidence leave, onwhatappearstobeaholiday. Englishfamily Thousands ofmen,womenandchildrenstruggletogetintoEuropeasacomfortable gone theirwaybefore. are biglessonsondiscriminationinseeminglysmallinjustices,andthestoriesofmanywhohave A motherandsonleaveMyanmarinhopesforabetterlifeThailand.Butwhatliesacrosstheborder source ofnourishment... Tero, toshowhisparents anewandexciting boywhoistiredofeatingpotatoes,determined afarm goal. Maloya, aReunionIslandritualsingingandmusicaltradition,shedefiantlyrefusestoabandonher she neverknew. Ontheway, shediscovers heisdead,but,drivenbythebeguilingrhythmsof To keepthepromiseshemadetoherdyingmother, ayoungwomansetsofftofindherfather, aman Editor BénédicteCazauran,CamiloRestrepo Cyprus,Greece,USAYearƩEMEɅH FormNarrativeCountry 2015 NetherlandsYearCountry 2016 Running Time 17 min

Christine Salem, David Abrousse, Harry Perigone Music ChristineSalem,DavidAbrousse,Harry Language

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 105

The Divided Self Divided The Editor Rasmus Ohlander

IdaProducer Screenwriter Martin Turk 2016 Running Time 8 min Language Slovenian Director Martin Turk Al DeLoner & Chris Eckman Pavlic Music Cinematographer Radislav Jovanov–Gonzo Editor Tomislav Weiss Contact [email protected] dances in Saman is a ‘batcha’, a young male prostitute who lives under the protection of a master and clothes for a male audience. Saman begins to worry for the new recruit, a young boy chosen women’s to replace him. Dobro Unovceno Popoldne Form Narrative Country Original Title Year Premiere Status Yorkshire son. a father is spending the afternoon with his seven-year-old After failing yet another job interview, they must decide if they should return it. A short film When they happen to find a wallet full of money, lessons. big about life’s 2015 Running Time 26 min Language Year Premiere Status UK Form Narrative Country France, Tunisia Contact [email protected] 2016 Running Time 15 min Language French Premiere Status UK Form Narrative Country France Year Priscilla Bertin,Producer Director Constance Meyer Screenwriter Constance Meyer Elisa Larriere, Judith Nora Cinematographer Christophe Offenstein Editor Anita Roth Contact [email protected] a young old man living in a small apartment.Gerard Depardieu stars as a lonely sixty year Every day, unusual bond unites these two beings, one solid and woman entrusts her baby to him. A natural and the other small and delicate. sturdy, Judith Lou Lévy Thomas Schober, Farsi Director Chabname Zariab Screenwriter Chabname Zariab Producer Cinematographer Eric Devin Editor Guillaume Saignol Music Maftoon, Faiz Karezi Contact [email protected] A young girl does her homework backstage as her father prepares for his show. One nightclub, two One nightclub, for his show. homework backstage as her father prepares A young girl does her solve everything.secrets and a lie that will 2015 Running Time 22 Premiere Status England Form Narrative CountryYear Denmark, Argentina Filip Gsella Screenwriter Leonardo Brezicki Producer min Language Spanish Director Leonardo Brezicki Cinematographer Fernando Nahuel Palenque Lockett Editor Filip Gsella Music Contact [email protected] but can experienced by indoor house cats once a day, The mad half hour refers to a condition usually like cats, through into the night together and stray, humans experience it too? Juan and Pedro venture the streets of Buenos Aires. 19 2015 Running Time UK Original Title PojkarnaPremiere Status Narrative Country Form Sweden Year Babak Najafi Producer Isabella Carbonell, Screenwriter Swedish Director Isabella Carbonell min Language Iga Mikler Kjell Ahlund Cinematographer Jörgen Andersson, only friend inside is the wayward, an institution for young sex offenders, whose Markus is a shy boy in will find out about the crime he he fears that Tobias As Markus´s trial approaches violent Tobias. commited. Language 2016 Running Time 7 min German Narrative CountryPremiere Status UK Form Germany Year Annika Pinske Cinematographer Ben Bernhard Annika Pinske Producer Director Annika Pinske Screenwriter Music Maria Kamutzki Contact [email protected] Louis le Prince International ShortInternational Prince le Louis 4 Competition Film When you Hear the Bells A Well Spent Afternoon A Well Rhapsody The Mad Half Hour Homework Boys 106 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Slope Letting Go It’s Alright The GenevaConvention Fox The Beast Under Pressure FilmCompetition5 Louis lePrinceInternationalShort Contact [email protected] Cinematographer KarlErikBrøndboEditorJensChristianFodstadMusicOlavRøyrhusØyehaug DirectorNinaKnagScreenwriterProducer ZahraWaldeckmin LanguageNorwegian YearOriginal TitleVi Norway kanikkehjelpealleFormNarrativeCountry 2016RunningTime10 Contact [email protected] Guillaume Dreyfus,ManonEyrieyCinematographerNoéBachEditorClémenceDiardMusicAronOttignon Producer ScreenwriterBenoitMartin Running Time15minLanguageFrenchDirectorBenoitMartin FranceYearPremiere StatusUKOriginalTitleLaConventiondeGenèveFormNarrativeCountry 2016 Contact [email protected] Konstantinos KoukouliosEditorSmaroPapaevangelouMusicAlexandrosVoulgaris Director JacquelineLentzouScreenwriterProducer FeniaCossovitsaCinematographer GreeceYearPremiere StatusUKFormNarrativeCountry Greek 2016RunningTime29minLanguage Contact [email protected] Producer BorisT. Mati,LanaUjdurCinematographerDankoVučinović EditorMarkoFerkovi min LanguageCroatianDirectorMiroslavSikavicaScreenwriterMarijaŠimokoviSikavica, CroatiaYearPremiere StatusUKOriginalTitleZvirFormNarrativeCountry 2016RunningTime15 Contact [email protected] Lobo Cinematographer JoaoGambinoEditor MargaridaLucasMusicNoberto DirectorMargaridaLucasScreenwriter Producer MargaridaLucas Portuguese Year Portugal Original TitleRampaFormNarrative Country 2015RunningTime17minLanguage Contact [email protected] Cinematographer NiklasBeckmanLarssonEditorNathalieÁlvarezMesén Music AndersKwarnmark Time 4minLanguageSwedishDirectorNathalieÁlvarezMesénScreenwriter NathalieÁlvarezMesén Premiere StatusUKOriginalTitleSläppaTaget suddenly divorce andshe’s forcedtoamovelow-income neighborhoodacrosstown. Matilde, amiddle-classprep-school girlinLisbon,findsherselfatasocialcrossroadswhenherparents it goaccordingtoplan? Sanna isforcedtotakecareofherlittlebrotherwhentheirmother emotionallyunavailable,butwill attempt tosaveadifficultsituation,Alexamakesdecisionshewillneverforget. Five-year-old Alexarealisesthathermotherhasnomoneyandisonthevergeofcollapse.Inan exactly keentogetintoafight,buthowcanhepossiblyavoidanunwantedconfrontation? As Hakimiswaitingforthebusafterclass,hecaughtinavendettabetweenteenagers.Henot aman’s hewillbecarrying making outwithhisgirlfriend,butinthatonesingleafternoon burdens. Stephanos isateenagerwhospendsthedayworkingout,playingwithhisyoungersiblingsand demolition job. duringadirty A builderfacesamoraldilemmawhenhisyoungsonstowsawayinmachinery

SwedenYearForm NarrativeCountry 2016Running

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30

107

Editor Gustavo Vasco

iu Răducanu Editor Vlad Genescu Dangerous Liaisons Dangerous ǎ u Cinematographer Lauren ǎ nescu, Natalia Gur ǎ Editor Jack Hutchings Jonatan Etzler, Joachim Nakagawa Stråning Editor Jonatan Etzler, Contact [email protected] A dark and cinematic journey the into the realm of the creatures of the night as cosmic chaos haunts evening of a truckstop prostitute. Contact [email protected] 2016 Form Narrative Country Romania Year O noapte in Tokoriki Original Title Premiere Status Yorkshire Running Time 18 min Language Romania Director Roxana Stroe Screenwriter Ana-Maria Gheorghe, Roxana Raluca M Stroe Producer Her 18th birthday. the whole village celebrates Geanina’s In an improvised night club called ‘Tokoriki’ boyfriend and Alin will give her a most surprising gift, one that nobody will ever forget. 2016 Running Time 15 min Language Form Narrative Country Canada Year Premiere Status Yorkshire Ran Bagno Noy Barak Music Contact [email protected] Jonatan Etzler Cinematographer ErikProducer Swedish Director Jonatan Etzler Screenwriter Jonatan Etzler Hassel 2016 Madre Form Narrative Country Original Title Sweden, Colombia Year Premiere Status Yorkshire Simón Mesa Soto Screenwriter Simón Mesa Soto Producer Running Time 14 min Language Spanish Director Juan SarmientoDavid Herdies, Franco Lolli, Capucine Mahé Cinematographer G. a Andrea comes down from her poor neighborhood in the hills of Medellin to attend 16 year-old downtown casting call for a porno film. Fanny-Laure Malo, François Jaros English Director François Jaros Screenwriter François Jaros Producer Cinematographer Olivier Gossot Editor François Jaros Music Olivier Alary Contact [email protected] Shannon cooks dinner whilst speaking to a pervertedShannon cooks dinner online. Andrew takes a bath wrapped stranger from their malaise? What could possibly shock these lost souls in seared Christmas lights. 3 min Language 2015 Running Time Country Form Narrative Year Sweden Premiere Status Yorkshire him before, but it turns never seen out he knows Anna bumps into Jesper on the morning train. She’s A short about and surveillance film everything in postmodern about her. society. Hebrew, Language Running Time 24 min 2015 Hebrew, Country UK Form Narrative Premiere Status Israel Year Editor Saar Mizrahi Cinematographer Leah Tonic Or Sinai Producer Or Sinai Screenwriter Russian Director for a free night, roaming the herself alone, without her son. She sets out Anna unexpectedly finds moment. even just for one brief streets of her small desert her, town, looking for a man who can touch 13 min Language 2016 Running Time English Narrative CountryPremiere Status UK Form Australia Year Ariel Cinematographer Charles Williams Producer Warnock Yianni Screenwriter Warnock Director Yianni Kleiman Contact [email protected] Victor Miu Music Victor Contact [email protected] Louis le Prince International ShortInternational Prince le Louis 6 Competition Film Oh What a Wonderful Feeling Oh What a Wonderful A Night in Tokoriki Mother I Follow You Homebodies Anna 108 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY The Empty Eagle Blue Deer Flower Cosmic Jacuzzi Bamboo Temple Street The BaldFuture WORLD ANIMATION AWARD Contact [email protected] Kim KangminScreenwriterProducer KimKangminAnimator RepublicofKoreaYearForm NarrativeCountry 2015RunningTime8minLanguageNoDialogueDirector Contact [email protected] Dialogue DirectorAnikóTakács Producer JózsefFülöp Year Hungary Premiere StatusUKFormNarrativeCountry 2015 Running Time9minLanguageNo Contact [email protected] Lukas ThieleAnimatorBaoyingBilgeriEditor Director BaoyingBilgeriScreenwriterProducerRunning Time14minLanguageGerman Year Germany Original TitleBambustempelstrassePremiereStatusUKFormNarrativeCountry 2015 Contact [email protected] Screenwriter PaulCabonProducer PaulCabonWAG Prod.AnimatorPaulCabon FranceYearForm NarrativeCountry 2016RunningTime6minLanguageFrenchDirectorPaulCabon Contact [email protected] Jeong, JooimKim,NicolasRoland,Wonjin JangEditorDaheeJeongMusicSangwooMa Dialogue DirectorDaheeJeongScreenwriter DaheeJeongProducer RonDyens,DaheeJeong Animator Dahee FranceYearPremiere StatusUKFormNarrative Country 2016RunningTime10minLanguageNo Contact [email protected] Screenwriter Will RoseAnimatorWill Rose Music JuliaHolter UKYearForm NarrativeCountry 2016RunningTime4minLanguageNoDialogue Director Will Rose animation mirrors thecontemplationoflifeandspace. film. Commenting onhowaroomcantellstories of aperson’s life,the breath-taking,hand-painted After thesuccessofManonChair, directorDahee Jeongcontinuestoastoundwithhisnewest her mountainhome. chicks tofeedandshefindsthattherearemanytemptingtreats be foundinthesleepytownbelow Set tothemusicofJuliaHolter, Will Rose’s joy. colourful latestfilmis a short, EagleBluehashungry stunning animatedexperiencefromSouthKoreathatyouwon’t soonforget. rare speciality. Whattheythinkisarestorativeritualtomakehimstrong,onlyendsinbadblood, Summer, toexperience their 1992.Amotherandfathertaketheirsononatriptospecialfarm, dizzying climax. ofhumanity,of alienabductiontakesintheentirehistory thensluices italldownaplugholeintruly thaneitherofthemexpected.Thiscomictale lonely road,twotruckerssetoutonatripmuchfurther Have youeverwantedacloseencounterwithdolphininhat?Thenthisisthefilmforyou!On come togetherdespitetheirdifferences. houses ofwealthyupperclasspeopleandthebarrackspoormigrantworkers.Onedaythesegirls about friendship.BaoandLililiveatBambooTemple Street,astreetthatmarkstheborderbetween Based onchildhoodmemoriesofdirectorBaoyingBilgeri,Bambustempelstrasseinacaptivatingstory bald, butthatyoudon’t havetolikeit. withgoing In thisfunnyandinventiveanimation,PaulCabonshowsusthatyoucancometoterms

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30

109

WORLD ANIMATION AWARD ANIMATION WORLD Roel Oude Nijhuis Animator Marlies van der Wel Producer Marlies van der Wel Contact [email protected] Wel creates a Using a blend of pencil drawings and photographs, filmmaker Marlies van der the main distinctive collage technique which has resulted in a stunning piece of animation. With got easy to see where he’s character of Jonas being a craftsman in bringing together unique finds, it’s his talent from. Director 2015 Running Time 6 min Language No Dialogue Form Narrative Country Switzerland Year Ivan is obsessed with dough, especially kneading, touching and squeezing dough. Ivan innocently becomes daydreams as he kneads the dough but soon he meets a woman and his obsession quickly same way not so innocent. A hilariously erotic animation which will make you never look at bread the again. 2015 Running Time 12 min Language No Dialogue Director Form Narrative Country Netherlands Year 2016 Running Time 6 min Language English Director The Brothers McLeod Form Narrative Country UK Year Angell Music Tom Screenwriter Myles McLeod Animator Greg McLeod Contact [email protected] with sound designer and composer newest film is an experimental collaboration The Brothers Mcleod’s is a stunningly visceral animation that plunges us into the eldritch inner spaces of Angell. The film Tom ‘who is in control?’ our unconscious minds, asking us the question Jürgen Haas, Gerd Gockell Animator Manuela Lukas Suter Producer Leuenberger, L. Montaño, Manuela Veronica Lukas Suter Music Michiko Hanawa, Christian Fischer Leuenberger, Contact [email protected] Franck Dion’s gentle, poetic film invites us to share the journey gentle, poetic film invites living with of an elderly woman Franck Dion’s the As we’re guided by as her confused mind leaves her open to danger. degenerative dementia, Equally as clever into her world becoming just as bewildered. narration, we are slowly pulled woman’s as it is beautiful. 2015 Running Time 3 min Language French Director Emma Vakarelova Form Narrative Country France Year Volsy Editor Thomas Belair Music Yan Animator Emma Vakarelova Mieux Prod. Tant Producer Contact [email protected] Based on a poem by surrealist poet Robert paintings of Denos, this beautiful animation evokes the longs for the earth-bound Kandinsky as The Horizon, cloaked in stars, Marc Chagall and Wassily to universal longing. woman he can never reach. An enthralling ode 20 min Language 2016 Running Time Estonia Year Country UK Form Narrative Premiere Status Norway, Norwegian Sam Mcloughlin Elin GrimstadMusic Director Contact [email protected] Norwegian multi-level glass tables, technique of using the distinctive With animator Elin Grimstead fairyhas created a darkly mystical death from the world as they tale. A girl and a boy seek to remove rites for the dead animals they find. create their own funeral 10 min Language 2016 Running Time Form Narrative CountryOriginal Title Une tete disparait France Year Richard van der Boom, Julie Roy Richard van der Boom, JulieAnimator Screenwriter Franck Dion Producer English Director Franck Dion Franck Dion Music Pierre Caillet Contact [email protected] Jonas and the Sea Ivan’s Need Ivan’s The Inverted Peak I Have Dreamed of You So Much I Have Dreamed of You The Head Vanishes Eternal Hunting Grounds Eternal 110 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Merlot A LoveStory Lili The Lighthouse The LegendofCrabePhare Kaputt WORLD ANIMATION AWARD Contact [email protected] Gil Landau Dombe, Tom KourisScreenwriterHaniDombeProducer HaniDombeAnimatorDombe,Tom KourisMusic IsraelYearForm NarrativeCountry 2016RunningTime10minLanguageNoDialogueDirectorHani Contact [email protected] Martin Simon ScheiberScreenwriterProducer SimonScheiberAnimator SimonScheiberMusicNicolas NetherlandsYearForm NarrativeCountry 2015RunningTime11minsLanguageNoDialogueDirector Contact [email protected] Lusbaronian Benjamin Lebourgeois,ClaireVandermeersh, AlexandreVeaux, MengjingYang Producer SupinfocomRubikaAzad FranceYearForm NarrativeCountry 2015RunningTime7minLanguageEnglishDirectorGaëtanBorde, Contact [email protected] Volker SchlechtEditorVolker Schlecht Music HannesSchulze Schlecht, AlexanderLahlScreenwriterMaxMoench,Producer DieKulturingenieureAnimator Year Germany Form NarrativeCountry Director Volker 2016RunningTime7minLanguageGerman Contact [email protected] Giulia Martinelli Gennari, AnimatorMarta Gennari,GiuliaMartinelli Screenwriter Marta Gennari,GiuliaMartinelli Director Marta ItalyYearPremiere StatusUKFormNarrative Country 2016RunningTime6minLanguageNoDialogue Contact [email protected] Edward, AlvildeNaterstadAnimatorAnushkaKishani,NaanayakkaraEditor JosephComarMusicMarcinSzumilas Naanayakkara ScreenwriterAnushkaKishaniNaanayakkara,ElenaRuscombe-King Cinematographer Yinka UKYearForm NarrativeCountry 2016RunningTime7minLanguageNoDialogue Director AnushkaKishani across theworld, thisdebutanimationisaworkof realvintage. reimagining ofLittle RedRidingHood.Winner ofthisyear’s Hamburg Animationawardandscreened A lostbottleofwineleadstoaninterconnected seriesofeventswhichcleverlydeconstructsaboozy made. adesperatechoicehastobe afflicted byadarknesswhichthreatenstopulltheirknittedworldapart, into therelationshipbetweentwowoollencreatures,astheirlivesbecome entangled.Whenoneis The agesoldstory, toldlikeyou’veneverseenitbefore.Asurprisingamountofemotioniswoven realisedandpoignanttaleofachildhoodlosttohistory.constructed awonderfully conquering. Inthisintriguingstopmotionfilm,IsraeliDirectorsHaniDombeand Tom Kourishave shehasnohopeof rooftop,Liliwaits...andpreparestodobattlewithastorm On adesert keeper’s surprisingdiscovery. ofalighthouse of 7years.Andtheresult?Astunningblackandwhitenarrativewhichtellsstory of 14,000photographs,TheLighthouseisaneonoirstopmotionanimationcraftedoverthecourse Filmmaker SimonSchieberisquicklybecomingonetowatch,withhisimpressivedebutfilm.Madeup to buildhiscollection. just toaddthemhiscollection.Butthecrabisgettingoldandit’s gettingharderandforhim crustacean.Hecapturestheboatsofseamenwhohavelosttheirway,The CrabePhareisalegendary bring vitalanduncompromisingsubjectstolight. filmillustrateshowpotentanimationcanbeto documentary prison between1950-90,thispowerful Presenting thestarktestimonyofcommunistpoliticalprisonersheldinnotoriousGDRHoheneck

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 111

WORLD ANIMATION AWARD ANIMATION WORLD With its effortless style and humour, it’s easy to see why this light-hearted easy has screened at so film it’s its effortless style and humour, With needs to many prominent festivals. In Spring Jam a young stag, lacking impressive antlers, knows he mating season. A slick, vibrant breath of fresh to have any chance during improvise sweet music if he’s air. 2016 Running Time 5 min Language English Director Naghmeh Form Narrative Country USA Year Farzaneh Screenwriter Naghmeh Farzaneh Animator Naghmeh Farzaneh Music Naghmeh Farzaneh Contact [email protected] unexpected events that can take one’s life, a chapter with Immigration is a new chapter in one’s life down paths different from the one imagined. Scent of Geranium is a simple and light-hearted autobiographical account of Iranian animator Naghmeh Farzaneh and her experiences. 2016 Running Time 6 min Language No Dialogue Director Ned Form Narrative Country New Zealand Year Music Ben Sinclair Animator Ned Wenlock Georgiana Plaister Producer Screenwriter Ned Wenlock Wenlock Contact [email protected] ő Kováts Gerg, Music Ajtai Péter, Fülöp József Animator Bárány Dániel, Menráth András Bárány Dániel Producer Porteleki Áron, Bognár Szabolcs Contact [email protected] 2016 Running Time 5 min Language No Dialogue Director Robert Duncan Form Narrative Country UK Year Animator Robert Duncan Music Rupert Uzzell Contact [email protected] a remarkable sense of depth, RobertUsing a series of layered paper cut-outs to create Duncan’s attention of complete silence, the viewer’s graduate animation is hypnotising. Using a back-drop how it explores the themes of memoryis drawn straight to the incredible technique and and reminiscence. Inspired by the novel Vercoquin and the Plankton by Boris Vian, this short film is a but impressionable by Boris Vian, and the Plankton Inspired by the novel Vercoquin shapes and forms.hazy jumble of bodies, Startingdrinking and chatting, the party with simple seems but as more guests arrive the partylike any other gathering, descends into chaotic drunkenness and sex. Kasper 2015 Running Time 10 min Language No Dialogue Director Form Narrative Country Estonia Year Animator Kasper Jancis Editor Kasper Jancis Music Kalev Tamm Jancis Screenwriter Kasper Jancis Producer features an interconnecting series of characters whose This bleakly humorous Estonian black comedy out of tune finale. culminating in a beautifully off kilter and stories each slowly come together, 2016 Running Country Form Narrative UK Original Title A nyalintás nesze Premiere Status HungaryYear Nadja Andrasev Screenwriter Ádám Bodor, Director Nadja Andrasev Language No Dialogue Time 9 min Marci Kristóf Music Bálint Szabó, Animator Nadja Andrasev József Fülöp Producer Contact [email protected] of film The Noise graduation Andrasev’s After earningprestigious MOME University, an MA at the of Hungarian Film Critics. Hungarian Animation of the year by the Association Licking was voted Best of imagination and reality, and sexuality together the film treads the line By blending voyeurism unsettling animation. creating an intriguing yet 4 min Language No Dialogue Director 2015 Running Time PreForm Narrative Country Hungary Year Kasper Jancis, Madis Muul Contact [email protected] Spring Jam Scent of Geranium Record/Record Piano Party The Noise of Licking The Noise 112 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY The WildBoar Waiting fortheNewYear Velodrool Travelling Country Totems Summer’s PukeisWinter’s Delight WORLD ANIMATION AWARD Contact [email protected] Joon AnimatorSanderMusicPõldsaar, AndresDajek EstoniaYearForm NarrativeCountry 2015RunningTime6minLanguageNoDialogueDirectorSander Contact [email protected] Adam ButcherEditorIvanBogdanovMusicPetarDundakov Producer Vessela Dantcheva,CompoteCollectiveAnimatorIvanKošuti,JelenaOroz,PetraZlonoga,DarkoVidačKovi, No DialogueDirectorVessela Dantcheva,IvanBogdanovScreenwriterVessela Dantcheva,IvanBogdanov ,CroatiaYearPremiere StatusUKFormNarrativeCountry 2016RunningTime14minLanguage Contact [email protected] Pascal Vermeersch, ConstantinBeineEditorPaulJadoulMusic Dialogue DirectorPaulJadoulScreenwriterAnimatorPierreMousquet,Jadoul,DaphnéCassini, FranceYearPremiere StatusUKFormNarrativeCountry 2016RunningTime8minLanguageNo Contact [email protected] Editor SawakoKabukiMusicSeinosukeSaeki Year 2016RunningTime3minLanguageNoDialogueDirectorSawakoKabukiAnimator France,Japan Premiere StatusUKOriginalTitleNatsunogerowahuyusakanaFormExperimentalCountry Contact [email protected] Animator BellaSzederkényiMusicFabrizioTentoni min LanguageNoDialogueDirector BellaSzederkényiScreenwriterProducer LissiMuschol Premiere StatusYorkshire Hungary, Form NarrativeCountry Germany, FranceYear 2016RunningTime14 Contact [email protected] Yves Drapeau Leschiov ScreenwriterVladimirProducer VladimirLeschiovAnimatorMusicPierre LatviaYearForm NarrativeCountry 2016RunningTime8minLanguage NoDialogueDirectorVladimir into thedarkness ofthewoods. acontrastofworlds astheorphanescapescity and greys andmuted greens, Szederkényiportrays animation about ahomelessorphan.Using a colourpaletteof withthis effortless world, shereturns After BellaSzederkényi’s filmOrsolya,thatwonmany prestigiousfilmprizesacrossthe extraordinary wayofstory-telling. amazes withhissimpleandwonderful Year theseasonspassinhopeofareply. andpatientlyobserves Animator VladimirLeschiovyetagain In thisbeautifullyhandpaintedanimation,alonelywomanwrites letteronthefirstdayofNew butitpromisestobeawildride. best surrealisttradition.Thedestinationmightbeuncertain, single 6minutefilm?TheyareallhereandmoreinthisbrillianthanddrawnEstoniananimationthe cycling,cigarettes,murder,Where elsecanyoufindsport fishing andpsychoactiverabbit-lickingina themtotheir oncehappyworld,oristhecycledoomedtobeginagain? return a newgoat-huggingsocietyiscreated,ruledbyviolence,brutalityandgreed.Canouroutcasthero onthebackofagianthorse...Butparadiseisruinedwhen Once uponatimetherewascountry stuck. Asheistrappedinabeautifulbutcruelenvironment,thedespairawakenshisprimalinstincts. inner animaldisposition.Alumberjackisworkinginaforestwhentreefallsdownandhisleggets An excellentexampleofhowsometimesdialogueisnotnecessary, Totems isavisualdisplayofour explicit filmistrulydemented,butwithaseriouscoreburieddeepwithinitsdelightfulinsanity. on thesensesishappilynodifferent.Aninvigoratingandexperimentalpalatecleanser, herdeliriously Renowned forsuchoutréfilmsasDon’t Tell MomandMASTERBLASTER,SawakoKabuki’s newassault

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 113

Coming Together Coming BRITISH SHORT FILM COMPETITION 1 COMPETITION FILM SHORT BRITISH Trainee doctor Sam is taking his final practical examination. In a world well known to actors - of faking doctor Sam is taking his final practical examination. In a world well known to Trainee illnesses and playing a part, Sam has to deal with a variety of characters, who have a wide range of in a final consultation that takes a very different turn. abilities. But then he has to diagnose Amy, Rory Waudby-Tolley 2015 Running Time 9 min Language English Director Rory Waudby-Tolley Form Narrative Country UK Year Eva Wagner, Animator Rory Waudby-Tolley, Rory Producer Waudby-Tolley Screenwriter Rory Waudby-Tolley Maurico Arrieta Sound Mix Music Paul Devlin Contact [email protected] Mr Documenting a series of conversations between the film-maker and a self-styled spiritual healer. less than Madila or The Colour of Nothing is a clever metaphysical animation which explores nothing the inner mind, the fabric of the universe, and the nature of reality itself. 2016 Running Time 15 min Language Premiere Status European Form Narrative Country UK Year English Marianna Dean, Zoe Cunningham, OllieDirector Marianna Dean Screenwriter Christopher R. Brown Producer Ruaraid Achilleos-Sarll Editor Jon Dean Music Neil Myers Cinematographer Watts Contact [email protected] 2015 Running Time 17 min Language English Form Narrative Country UK Year Premiere Status World Cinematographer Chris Clarke Sarah Tulloch Producer Screenwriter Andrew Tulloch Director Andrew Tulloch Editor Andy Morrison Contact [email protected] Naive to Lonely Jim ‘The Fish’ enters the world of internet dating after mourning the death of his father. as empty as his fishing creels. Then, a chance encounter technology and finding love, he is left feeling to seek companionship in a more traditional fashion. with a fish evokes a new confidence in Jim In a claustrophobic country inquisitive daughter with a cottage, a controlling mother is tutoring her is convinced by her mother that her bizarre lessons. When her father dies, she strange set of rules and is, until he begins to rot. if they can show how much they miss him. That dead dad will resurrect 2015 Running Time 15 min Language English Director Rene Pannevis Form Narrative Country UK Year Sidell Editor Richard Graham Jennifer Eriksson Cinematographer Tim Screenwriter Rene Pannevis Producer Contact [email protected] Rothwell) are semi-professional car and Russell (Charley Palmer (Thomas Turgoose) Friends Waylen they have to consider some verythieves, but when they break into a car and find personal property, they decide to do the right thing? the morality of their actions. Will Language 2016 Running Time 11 min Country European Form Narrative Premiere Status UK Year John Wallace Wilkinson, Matthew James Simon Bird Producer Simon Bird Screenwriter English Director Boulding Jamie CairneyCinematographer Editor Tommy Contact [email protected] pubs As they pass by village north old ladies drive through car. Sligo in a neat Japanese County Two consolation their one today, the terrible, immoral lives people are living and beaches, they imagine they decide to act on their children. But things do not go to plan when being the innocence of funny and macabre tale. convictions, in this darkly 25 min Language 2016 Running Time Form Narrative CountryPremiere Status European UK Year Chiara Cardoso, Flavia MonaldiScreenwriter Andrea Niada Producer English Director Andrea Niada Music Andrea Boccadoro Cinematographer Poom Saiyavath Contact [email protected] Symptoms Mr Madila Jim ‘The Fish’ Jacked Home Education Ernestine & Kit Ernestine 114 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Pauline The Party On Paper New Gods The Lights An ArmsLength Falling Apart BRITISH SHORTFILMCOMPETITION2 Contact [email protected] Contact [email protected] Sebastián Lojo English DirectorNicholasNazariScreenwriterProducer ClaraDublanc Cinematographer UKYear FormNarrativeCountry Premiere StatusInternational 2016RunningTime18minLanguage Contact [email protected] Cinematographer EdgarDubrovskiy English DirectorJackBurkeScreenwriterBurke,RobHayesProducer JackBurke,CarissaHopeLynch UKYearPremiere StatusEuropeanFormNarrativeCountry 2016RunningTime15minLanguage Contact [email protected] Editor Tim Hughes SpencerMusicBernard Barrick ScreenwriterKieranGrantProducer AndreaFarrena,SophieReynoldsCinematographerJamesRhodes UKYearForm NarrativeCountry 2015RunningTime11minLanguageEnglishDirectorKieranGrant,Lucy ScreenwriterMaxWeilandCartamkhoob CinematographerSteveAnnis UKYearForm NarrativeCountry 2015RunningTime10minLanguageEnglishDirectorDenna Contact [email protected] Editor Ryan Beck Screenwriter FredRowsonProducer CorinTaylor, PaulWeston, RobJelley Cinematographer Will Humphris UKYearForm NarrativeCountry 2016 Running Time6minLanguageEnglishDirectorFredRowson McGrail Harkin ScreenwriterConorMacneillProducer EmmetFleming,FarahAbushweshaCinematographerPiers UK,IrelandYearForm NarrativeCountry 2016RunningTime15minLanguage EnglishDirectorAndrea Contact [email protected] linger atthegate.’ ‘MynameisPaulinePolter, andIhavegot aghostinmyoven.’ andmalevolence. Andtheywilltellyouadamp chillfallsuponanyonebraveenough to lies misery London.They saythatbeyondit’s‘Locals crosstheroadtoavoidthis terracedhouseinNorth threshold scarred thecityandit’s fracturedcommunityexplodesintotheiryounglives. ofdrinkinganddancingwiththeir friends.Butthepoliticalviolencethathas celebrate, withaparty Irishconflictof1970sBelfast,Laurencewelcomes hiscousinMickeyhometo Set amidsttheNorthern relationship? meaningful long-term of thecouples’testimonies.Butwhataresmalltruthsandstoriesthatproveasuccessful Mr. peoplewishingtoapplyformarriagevisasandmustdecideontheveracity Hamiltoninterviews tested inthemostextremeway. the Communityfor8years,butwhenshesuccumbstoabrutalandcontagiousillness,herfaithis aspectoftheindividualissublimatedtoitsgreatergood–includinglife.Sophiehaslivedwith every The Community’s teachingsplacethesanctityoftheirisolatedpastoralsocietyaboveallelse,where more waysthanone.Shouldhebringthelightsback,orisdarknessinhousebestleftalone? in thehomeofamelancholicMrElliot,LloydbeginstorealisethatChristmaslightsarehazard of ahousecoveredwithChristmaslights,butit’s themiddleofJuly. Ashebecomesanunwillingguest When electricianLloydreceivesacall-outinthedeadofnight,hefindshimselfstandingondoorstep bond. with, inadesperateacttofinallybreakfreeofhismaternal he’sSuffocating underheroverbearinglove,hefinallyresolvestoleavethecomfort beenbroughtup forfreedomandadeeptietohismother.Leonard isaJewishboytrappedbetweenhisyearning

Editor CatherineCreedMusicGarethAverill

Editor MatteoZeniniMusicSallaLuhtala

Editor JackBurkeMusicTheoVidgen

Editor DanSherwen

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30

115

Editor

Falling ApartFalling Music JM Holt

BRITISH SHORT FILM COMPETITION 2 COMPETITION FILM SHORT BRITISH YORKSHIRE SHORT FILM COMPETITION YORKSHIRE Katie uses her imagination to escape from the less than idealistic life she has with her parents, Katie uses her imagination to escape from the less than idealistic life she has with her parents, stop won’t constructing a reality in which only she and her brother Laurie exist. But her subconscious bringing the dark truth of what happened to Laurie to the forefront of her mind. 2015 Running Time 7 min Language English Director Glen Milner Form Documentary Country UK Year Glen Milner Editor Alex Elkins Music LennertProducer Busch Contact [email protected] This short documentary follows Karim and Katari Chand, who have a combined age of 211 years and have been married for 88. Having left India for the industrial north of England in the 1960’s impact on their life and it’s the film is provides an insight into their married and raised a huge family, continued family history. 2016 Running Time 13 min Language English Form Narrative Country UK Year Premiere Status World Jack Simpson Director John Powell Screenwriter Jack Simpson, John Powell Producer Contact [email protected] Contact [email protected] 2016 Running Time 8 min Language English Form Narrative Country UK Year Premiere Status World StewartDirector Katie Ross Screenwriter Katie Ross Producer Ross Cinematographer Stewart Ross comrade taking refuge under a bridge. I, a young soldier meets a shell-shocked War During World Fearful may find a for their lives, both soldiers begin to find common ground and live in hope that they way home. 2015 Running Time 21 min Language English Director Zoe Kinross Form Documentary Country UK Year Zoe Kinross Zoe Kinross Cinematographer Producer perception of her documentaryBlue Grey is a vivid and unflinchingly direct about a daughter’s a series of personal interviews mental health, challenged and channeled through and the mother’s creation of a sequence of intimate portraits. 16 min Language 2015 Running Time English Form Narrative Country UK Year Yorkshire Premiere Status Cinematographer Dan Winch Diarmid Scrimshaw, Sean BuckleyProducer Screenwriter Director Sean Buckley Editor Chris Wyatt Ole Bratt Birkland Contact [email protected] escalates into a terrible act of Fleeing onto a train, his fear and paranoia Aaron is being pursued. him is indelibly linked to his past: something But the rage that pursues violence on a fellow passenger. childhood. that has haunted him since Jonnie Petherbridge Contact [email protected] Happy Place Elders Collaborator Blue Grey Polar Bear 116 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Steady PastYour GrandmaWhileShe’s Dancing The SprintKing Manners Boxing Left Behind YORKSHIRE SHORTFILMCOMPETITION Contact [email protected] Music JonathanEato Producer SamLawrenceCinematographerCarolynMendelsohn,CraigGoode Choreographer SamLawrence UKYear Country Form Documentary 2016RunningTime13minLanguageEnglishDirector SamLawrence Contact [email protected] James Ducker Screenwriter BenjaminDuckerProducer BenjaminDucker, MikeEtherington,JamesDuckerCinematographer UKYearForm NarrativeCountry 2016RunningTime12minLanguageEnglishDirectorBenjaminDucker Contact [email protected] Producer GarethBowlerCinematographer UKYear Country Form Documentary 2016RunningTime4minLanguageEnglishDirectorGarethBowler Contact [email protected] Editor JakeRichardson Director OlivierChevalleyScreenwriterJakeRichardsonProducer ChrisLoweCinematographerRyan Goff Premiere StatusWorld UKYear FormNarrativeCountry English 2016RunningTime14minLanguage shared joyofdancingtogether. bond betweenfourgenerationsofwomeninoneYorkshire family, andcapturesthedelightintheir 1930’s dancebandmusic,thistouchingfilm aboutdance,agingandrelationshipsfocusesonthe Through apatchworkofchoreographedimpressions,lacedtogetherwithhumourandthesounds horse,Soba. bright lightsofthetrack.Finallyhegetshisshotridingwildandunrulyfarm hisbodytoit’sbattles inthearenasofstableboxingandstarves limits,toprovehimselfreadyforthe ofaYorkshireBased ontheremarkabletruestory jockey, DandyNichollsisarunawayboywho effect hopeandchangeinthelivesofothers. Manners findawaytobetterplaceinhislife.Infindingcalmcentreown,heisablehelp film,MannersBoxingshowshowboxinghashelpedNick documentary formed butperfectly A short, world. supplies. Accompaniedbyaresentfuloldergirl,Eveystrugglestoproveherselfinthisharshnew thegroup’s housefor a handfulofsurvivors, leaderordershertolootanabandonedcountryside Evey isayounggirlorphanedinworlddecimatedbydeadlywater-borne virus.Travelling with

Gareth Bowler Editor GarethBowler

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 117

Concha Vidal, Cristina Monge Editor Concha Vidal, Cristina Monge Contact [email protected] A tragicomic tale of a Japanese train guard who controls large crowds with sweeping, graceful for him or gestures. Soon he finds himself in his worst nightmare: an unfamiliar world that has no need his signals. Language No 2016 Running Time 6 min Country Form Narrative UK Year Premiere Status Yorkshire Scottish Ballet Creative Cinematographer Eve McConnachieDialogue Director Eve McConnachie Producer Choreographer Sophie Laplane Editor Eve McConnachie Music Xela Contact [email protected] as they explore a labyrinthine derelict Glasgow swimming young people discover each other Two pool. A high-energy contemporary dance piece shot in the emptied Govanhill Baths in Glasgow. 2015 Running Time 14 min Language No Premiere Status UK Form Narrative Country Netherlands Year Dialogue Director Camiel Zwart Screenwriter Camiel Zwart Klaus Jürgens Cinematographer Martijn Cousijn Animator Jesse Hovestreijdt Choreographer Klaus Jürgens Editor Joël Hielckert Music Rijndert van Woudenberg Contact [email protected] Concha Vidal Cinematographer Concha Vidal Producer Concha Vidal Screenwriter Director Concha Vidal No Dialogue No 2016 Running Time 5 min Language Premiere Status UK Form Experimental Country USA Year Andrew Michael Ellis Choreographer Ernest Ernest Felton Baker, Dialogue Director Andrew Michael Ellis Producer Felton Baker Editor Ben Stamper Contact [email protected] urban train station, juxtaposed with vivid sea and A subway worker dances through a monochrome of a formersand dune landscapes. The archival voice-over an African American slave, provides engaging context to his movement. This year, we open with a student film curtain from Northern raiser School of ContemporaryThis year, Dance. Four performers movement. fashion an intriguing narrative with their pedestrian in a field 6 min 2015 Running Time Country Form Experimental Year Canada Premiere Status Yorkshire Bernadet Marc Stephenson Cinematographer Yves Language No Dialogue Director Brian Johnson Producer Choreographer Company 605, Josh Martin,Editor Aram Coen Lisa Gelley Contact [email protected] Filmed in an empty factoryaugment and featuring sixteen dancers, the film warps time and place to and expand the raw physicality of its protagonists. Running Time 4 min Language 2015 Form ExperimentalCountry Spain Year Yorkshire Premiere Status A lone female performer an aqueous material. slowly emerges from a curious vat filled with 2 min Language No 2016 Running Time Form Experimental Country UK Year Premiere Status World Choreographer Susanna Wallström, Cinematographer Gabriella Engdahl Dialogue Director Gabriella Engdahl Karlsson Editor Gabriella Engdahl Music Chilly Gonzales Dahlgren, Melinda Lydia Ngo, Tina Contact [email protected] LEEDS INTERNATIONAL SCREENDANCE COMPETITION SCREENDANCE INTERNATIONAL LEEDS Platform 13 Maze Jonah Inheritor Recordings Flamongi Diving Into Your Absence Into Your Diving 118 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY To theEndsof theFingertips Timecode She/Her Samba #2 LEEDS INTERNATIONAL SCREENDANCECOMPETITION Contact [email protected] Choreographer SophieArstall,ElizabethBarkerEditorRoswithaChesherMusicJonTraynor CollinsCinematographer RoswithaChesher No DialogueDirectorRoswithaChesherProducer Martin Premiere StatusYorkshire UKYear FormNarrativeCountry 2016RunningTime3minLanguage Contact [email protected] Villanueva, MéndizCinematographerPerePueyo Arturo Spanish DirectorJuanjoGiménezScreenwriterPereAltimira,Producer JuanjoGiménez,Daniel Premiere StatusYorkshire SpainYear FormNarrativeCountry 2016RunningTime15minLanguage Contact [email protected] Wyss ScreenwriterSonjaWyss,CeciliaMoisioProducer FloorOnrust NetherlandsYearForm NarrativeCountry 2016RunningTime11minLanguageEnglishDirectorSonja Contact [email protected] Choreographer NaoYamada ProducerDialogue DirectorRosaneChamecki,AndreaLerner Tanja MedingCinematographerFrankStanley BrazilYearPremiere StatusUKFormExperimentalCountry 2015RunningTime3minLanguageNo freedom andfulfillment. A visuallyrichandsurrealtale,whichshadowstwowomenastheyslipthroughtimeonaquestfor FilmPalmed’OratCannes2016. This delightfulproductionwonthecovetedShort Luna andDiegoaretheparkinglotsecurityguards.Hedoesnightshift,sheworksbyday. family scenariosoonshiftstoatensepower-struggle, beforesettlingintoitsfinalresolution. asaneveryday inarestaurant.Whatstarts Mother anddaughterattempttocelebrateabirthday camera dissectsamesmerising,fleshylandscape A sambadancerfilmedinextremeslowmotion.Zoomedtightlytoframethehipsofdancer, the

Music IvánCéster

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 119

Editor

Music Miguel Torres

Jonatan Etzler, Joachim Nakagawa Stråning Editor Jonatan Etzler,

LEEDS SHORT FILM AUDIENCE AWARD AUDIENCE FILM SHORT LEEDS Daniel Moshel, August Schram No Dialogue Director Daniel Moshel Screenwriter Daniel Moshel Producer Music Editor Christine Gottscheber Cinematographer Arturo Smith Choreographer Jasmin Avisar [email protected] Contact [email protected], in MeTube After Elfie and her nerdy son August successfully proved themselves on their home webcam flash mob 1, the odd pair venture onto the street to present the biggest, boldest, and sexiest operatic the internet has ever witnessed! Contact [email protected], [email protected] Language No 2016 Running Time 6 min Country Form Narrative UK Year Premiere Status Yorkshire Scottish Ballet Creative Cinematographer Eve McConnachieDialogue Director Eve McConnachie Producer Choreographer Sophie Laplane Editor Eve McConnachie Music Xela Contact [email protected] as they explore a labyrinthine derelict Glasgow swimming young people discover each other Two pool. A high-energy contemporary dance piece shot in the emptied Govanhill Baths in Glasgow. 2016 Running Time 6 min Language Form Narrative Country Austria Year Premiere Status Yorkshire Alexis Morante Alexis Morante Bruno Morante Producer Alexis Morante, Alexis MoranteScreenwriter Spanish Director Juanma CarmonaCinematographer Nikki Music Janne Huttunen Teemu Contact [email protected] 3 min Language 2015 Running Time Country Form Narrative Year Sweden Premiere Status Yorkshire Jonatan Etzler Cinematographer ErikProducer Swedish Director Jonatan Etzler Screenwriter Jonatan Etzler Hassel Contact [email protected] him before, but it turns never seen out he knows Anna bumps into Jesper on the morning train. She’s A short about social media and surveillance film everything in postmodern about her. society. This short documentary a combined age of 211 years follows Karim and Katari Chand, who have for 88. Having left India for the industrial northand have been married of England in the 1960’s their impact on an insight into their married life and it’s the film is provides and raised a huge family, continued family history. 2016 Running Time 9 min Language Finnish Premiere Status UK Form Narrative Country Year Jani Pösö Cinematographer Sari Aaltonen Producer Nikki Nikki Screenwriter Teemu Director Teemu a farm boy who is tired of eating potatoes, is determined to show his parents a new and exciting Tero, source of nourishment... Language Running Time 4 min 2015 Country UK Form Narrative Premiere Status Spain Year gonna get. of chocolates; you never know what you’re Sharing car is like a box 7 min Language English Director Glen Milner 2015 Running Time Form Documentary Country UK Year Glen Milner Editor Alex Elkins Music LennertProducer Busch Contact [email protected] MeTube 2 MeTube Maze I Follow You Fantasy Elders Bla Bla Bla Bla Bla 120 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY The Wall Trial andError A Town Called :theNoiseofGrey Spring Jam Spark Pauline LEEDS SHORTFILMAUDIENCEAWARD Contact [email protected] Dialogue DirectorStéphaneAubier, Vincent PatarAnimatorStéphaneAubier, Vincent PatarMusicDaan Premiere StatusYorkshire FranceYear FormNarrativeCountry 2015RunningTime3minLanguageNo Contact [email protected] Wenlock ScreenwriterNedWenlock Producer GeorgianaPlaisterAnimatorNedWenlock MusicBenSinclair NewZealandYearForm NarrativeCountry 2016RunningTime6minLanguageNoDialogueDirectorNed Contact [email protected] Anita vanPeltCinematographerRobijnVoshol 8 minLanguageDutchDirectorEdgarKappKubaSzutkowskiScreenwriterElfie Tromp Producer IrenePronk, Premiere StatusUKOriginalTitleVonk NetherlandsYear FormNarrativeCountry 2015RunningTime Contact [email protected] Editor Ryan Beck Screenwriter FredRowsonProducer CorinTaylor, PaulWeston, RobJelleyCinematographerWill Humphris UKYearForm NarrativeCountry 2016RunningTime6minLanguageEnglishDirectorFredRowson Contact [email protected] VervoortNicolas GeorgesCinematographerBernard EditorNicolasBier Music PierreGillet Producer Lesfilmsducarré HugoLampaert ScreenwriterSamuelLampaert, Chinese DirectorSamuelLampaert Premiere StatusYorkshire BelgiumYear Form NarrativeCountry 2015RunningTime10minLanguage Contact [email protected] AntjeHeynMusicPeerKleinschmidt Screenwriter AlexanderIsert, Year Germany Form NarrativeCountry 2016RunningTime5minLanguageEnglishDirectorAntjeHeyn the wall. themselves incramped studios.Untilthedaywhere Chung,abachelor, decidestohang apictureon Hong-Kong. Amultitudeofhigh-rise concretebuildingswithoutpersonality. Inside, peoplekeepto parrots–andalong-lostfriend. aunts, busycats,startled button,perfectionist A filmaboutalostshirt crazy stoogesfilltheplace,givingitlifeandcolor. Untilatroublemakerenters andruinseverything… A stillframe,thehallwayofgray, dullhouseofHorse,CowboyandIndian.his improvise sweetmusicifhe’s tohaveanychanceduringmatingseason. many prominentfestivals.InSpringJamayoungstag,lackingimpressiveantlers,knowsheneedsto With styleandhumour, itseffortless it’s filmhasscreenedatso easytoseewhythislight-hearted of maletenderness. guyandahard-knockweldertogether. Fate bringsaclumsydelivery Beneaththecomedyliesastory linger atthegate.’‘MynameisPaulinePolter, andIhavegotaghostinmyoven.’ andmalevolence.Andtheywilltellyouadampchillfallsuponanyonebraveenoughto lies misery London.Theysaythatbeyondit’s‘Locals crosstheroadtoavoidthisterracedhouseinNorth threshold

Editor NielsDekkerMusicMarcelvanAs,JohanHendrikse

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 121 Andreya Triana - Branches of Life (Katerina Athanasopoulou) - Branches Andreya Triana & Irina of PsyDoc Film, St. Petersburg) Aukai - Hidden (Anton (Lewis Rose) Beardyman - Mountainside Cavern Gate (Peter Strickland) of Anti-Matter - Liquid (Connor Hurley) El Perro del Mar - In The Woods Elliot Moss - Pattern Repeating (HochR) Gothic Chicken - Overthrow (Matty Groves) Decide (Lu Pulici) Jon Kenzie - Can You Say Stay (David Campesino) Kristoffer and the Harbour Heads - When You (Spencer Bayles) Navigation Day - Town Pekko - Hunger (Anton Tammi) Bjorn and John - Breakin’ Point (HochR) Peter, Sculpture - Untitled (Sculpture) Winterson - Dreams (Bear Damen) Sofie Steve Mason - Planet Sizes (Anna Ginsburg) Freeman) (Alanna Thicket - Taunt Murray) Tom - Shooting Off The Set (Cheryl Gelover, Tulipomania Zmatsusi - Mogadishu (Shaun Boldison) The Leeds International Music Video Award, now thriving in its third year, is a celebratory is a in its third year, now thriving Award, InternationalThe Leeds Music Video style in the contemporary innovation and of outstanding aesthetic showcase music video. of all manner of mélange an enthralling and challenging presents programme This year’s consummate and artful ranging from visual brilliance storytelling to the truly avant-garde and everything the art music video in an incredibly healthy of the else in between. With and ever- ever-changing proudly presents the vanguard of this state, this programme influential artform. VIDEOS LEEDS INTERNATIONAL MUSIC VIDEO AWARD VIDEO MUSIC INTERNATIONAL LEEDS When You Say Stay When You Pattern Repeating Mogadishu Hidden Can You Decide Can You Breakin’ Point 122 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Refuge Make InishturkGreatAgain From Space,SyriaisHere Figure Dear Peter Bunkers Nine MovingStories SHORT DOCUMENTARY FILMSPANORAMA Contact [email protected] Turkey Country Form Documentary Year 2016RunningTime8minLanguageTurkish DirectorErolMinta Piekarski, KatarzynaSzczerba Director KatarzynaGondekProducer KatarzynaGondek,BenVandandaele, AgnieszkaTraczewska, Jarosław Poland,Belgium Year Country Form Documentary 2015RunningTime9minLanguageNodialogue English DirectorScottWillis Producer ScottWillis CinematographerScottWillis UKYear Country Premiere StatusEnglishFormDocumentary 2016RunningTime26minLanguage Contact [email protected] Editor AnaAcostaMusicBenoitRenaudin Claire AdetScreenwriterAnne-ClaireProducer Yasmine AbdElAzizCinematographerAnne-ClaireAdet SwitzerlandYear Country Form Documentary 2016RunningTime12minLanguageEnglishDirectorAnne- Contact [email protected] Editor StephenMichaelSimon Language ArabicDirectorMatthewFirpo Screenwriter MatthewFirpoProducer MaximilianGuen,MatteoZevi Premiere StatusYorkshire Greece,USAYear Country Form Documentary 2016RunningTime20min Contact [email protected] Language EnglishDirectorDavidFreidProducer MELFilms Ireland,USAYear Country Premiere StatusEuropeanFormDocumentary 2016RunningTime10min Contact [email protected] refugee crisis. ofa harrowingchronicleoftheongoing European from Syria.Their testimonies tothecameraarepart ofrefugees ofaseriesnobleportraits 2016, thefilmisformed Shot onlocationinGreece,January considering emigratingthere,intheeventofaTrump presidency? What dotheislandersoftinyislandInishturkthinkhundreds ofAmericanswhoare rebels. against thedictatorialAssadregimefiveyearsago,hesidedwithFreeSyrianArmy al-Assad fromspacein1987andnowlivesasarefugeeIstanbul.WhentheSyrianpeopleroseup ofthefirstSyrianastronaut,MuhammedFaris,whosentamessagetoPresidentHafez This isthestory Contact [email protected] buildings isagloriousmeditationonmeaningandpermanence. andsubsequentresurrectioninaminiatureparkforreligious Paul IIonaflatbedtruck.Itsjourney The filmwordlesslyandsomewhatabsurdlydocumentsthevoyageofa14mtallstatuePopeJohn totrackdowntheirownerwasirresistible. knew him.Ajourney the messagesonpostcardscreatedapictureofmancalledPeter, throughthewordsofthosewho When filmmakerScott Willis discoveredacollectionofhandwrittenpostcardsinsecondhandshop, one ofthem. wholivesin nuclearfallout.ConditionsinsidethebunkerarerevealedbyaSudanesejournalist survive hasbeen‘housing’refugeesinundergroundbunkersoriginallydesignedto The Swissgovernment Taylan Minta ş Producer CharliePhillips,MustafaKhaliliScreenwriterErolMinta

Editor KatarzynaGondekSoundSzczerba ş , Taylan Minta

Scott Willis Editor ScottWillis ş

Editor ErolMinta

ş , ş 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 123

Tim Roza Editor Tim

Nine Moving Stories Moving Nine This documentary was the Jury Award Winner at SXSW this year. It explores the life of gay country This documentary at SXSW this year. Winner Jury was the Award an American countrysinger Patrick Haggerty music Country, who wrote and recorded as Lavender band formed in 1972. 2016 Running Time 5 min Language Premiere Status English Form Documentary CountryEnglish UK Year Magenta Sharp Producer Director Faye Carr-Wilson Contact [email protected] at a local drag show Venus Dimilo) first saw Sophie (a.k.a director Faye Carr-Wilson When the film’s her experiences, her I wanted to know her story, she said ‘I was immediately captivated by her. feelings’. The film is a confident portrait of a unique beauty. Director Edward 16 min Language Dutch 2015 Running Time Form DocumentaryCountry Netherlands Year Baptist, Nienke Korthof Jefrim Rothuizen Cinematographer Willem Cook Producer Contact [email protected] just does what she and hates girly stuff. She who likes skateboards girl Keet is a feisty ten-year-old what others might think. should be doing the same, regardless of wants and says more girls Language 2015 Running Time 16 min Form Documentary Country USA Year Premiere Status Yorkshire Editor David Mehlman Christy Park Cinematographer Damon Hoydysh Producer English Director Dan Taberski Music Patrick Haggerty Contact [email protected] SHORT DOCUMENTARY FILMS PANORAMA FILMS DOCUMENTARY SHORT Venus These C*cksucking Tears These C*cksucking Skatekeet 124 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Party Manoman Little Appliances Kissy LipsMan Ivan’s Need Teat BeatofSexSeries TEAT BEAT OFSEX+X-RATED SHORTS Contact [email protected] Manuel Campos Screenwriter ManuelArijaProducer ManuelArijaCinematographerCarlosPadial SpainYearForm NarrativeCountry 2012RunningTime9minLanguageSpanishDirectorManuelArija Contact [email protected] Screenwriter Will Webb CinematographerWill Webb UKYearForm NarrativeCountry 2015RunningTime3minLanguageEnglishDirectorWill Webb Contact [email protected] Leuenberger, LukasSuterMusicMichikoHanawa,ChristianFischer Veronica L.Montaño,ManuelaLeuenberger, LukasSuterProducer JürgenHaas,GerdGockellAnimatorManuela SwitzerlandYearForm NarrativeCountry 2015RunningTime6minLanguageNoDialogueDirector Contact [email protected] Baumane ScreenwriterSigneAnimator Latvia,Italy,Form NarrativeCountry USAYear 2008RunningTime30minLanguageEnglishDirectorSigne Contact [email protected] Áron, BognárSzabolcs Dániel Producer FülöpJózsefAnimatorBárányDániel,MenráthAndrás MusicAjtaiPéter, KovátsGerg,Porteleki Year Hungary Form NarrativeCountry 2015RunningTime 4minLanguageNoDialogueDirectorBárány Contact [email protected] Paco SweetmanMusicTerence Dunn Editor Producer KamillaKristianeHodolAnimatorSimonCartwright ScreenwriterSimonCartwright Cartwright UKYearForm NarrativeCountry 2015RunningTime11minLanguageNoDialogue Director Simon sex. descendsintochaotic drunkennessand like anyothergathering, butasmoreguestsarrive theparty seems withsimpledrinking and chatting,theparty Starting hazy jumbleofbodies, shapesandforms. Inspired bythenovelVercoquin andthePlankton byBorisVian, butimpressionable filmisa thisshort insane rampageofananimation.Afilmaboutlimits,withnolimits! impossible tocontrol.Hisnowuninhibitedimpulsesleaddisastrous consequencesinthisnight-long into hisprimalsenseofself,finallygoestoofarwhenhecreatesa raging homunculusthathefinds AAAAAARRGGHH! Andsofollowsanabjectlessonintheperilsof therapy. Glen,whocannottap withmechanicalenhancements love story odd tobareallbutwhentheyundressisnotasitseems.Avery A coupleontheirfirstdatestart Man -anoldermanwhomakeskissingfacesathim. In thisabsurdandcreepycomedyayoungmanisfollowedhomefromthelaundrettebyKissyLips again. not soinnocent.Ahilariouslyeroticanimationwhichwillmakeyouneverlookatbreadthesameway daydreams ashekneadsthedoughbutsoonmeetsawomanandhisobsessionquicklybecomes Ivan isobsessedwithdough,especiallykneading,touchingandsqueezingit.innocently tribulations ofsexfromawoman’s pointofview. matters. Theoutrageousanimationsareexplicitlyeducationalandhilariouslydepictthetrails In twofifteenminuteepisodesSigneBaumanerevealshermostsecretthoughtsontheintimate

Editor Will Webb MusicAranBruce-Caddick

Editor DavidVarela Music

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 125

Polishsiorowska Producer ą Volodymyr Antoniv Music Volodymyr Renata G siorowska Screenwriter siorowska ą ą Animator Renata G ź TEAT BEAT OF SEX + X-RATED SHORTS X-RATED + SEX OF BEAT TEAT Contact [email protected] Carlo 2014 Running Time 6 min Language No Dialogue Director Form Narrative Country Luxembourg Year Music Jean-Luc Spagnolo, Animator Carlo Vogele Carlo Vogele Producer Carlo Vogele Screenwriter Vogele David O’Brien Isabelle Andrivet, Johann Sebastian Bach, Cédric Kennel, Jim Studer, Contact [email protected] has not Earning wonderful, a reputation for animating the bizarre and animator Carlo Vogele Set in a world of meat, it tells the story who wants to of a white sausage disappointed with Wurst. enjoy the sun, sea and surf in peace, but has to contend with the other rowdy beach sausages. Sacrebleu Productions, Negativ Animator Michaela Pavlátová Editor MichaelaMichaela Pavlátová Producer Pavlátová, Milos Krejcar Music Petr Marek Contact [email protected] 2016 Running Time 2 min Language English Director Sophie Marsh Form Narrative Country UK Year Sarah Cox Animator Sophie Marsh, James Jones Morris, Max Goodman,Screenwriter Sophie Marsh Producer Andrew Gladwell Katrina Hood, Alexander Bufton, Efa Blosse-Mason Music Contact [email protected] Learn more than you wanted to know about the animal with this melody of furry facts, made for Channel 4 Random Acts. A young girl spends the evening alone at home. She decides to have some solo pleasure time, but not evening alone at home. She decides to have A young girl spends the everythingto plan. goes according Director 2012 Running Time 7 min Language No Dialogue Form Narrative Country Czech Republic Year conductress until she starts to get turned on by the daily routine for the Tram’s the usual humdrum It’s and the rhythm of the ticket machine. vibrations road’s Anna Ginsburg Anna GinsburgLanguage English Director Running Time 4 min 2015 Form DocumentaryCountry UK Year George Wheeler, Anderson, Will Peter Millard, Loup Blaster, Animator Moth Collective, Anna Ginsburg Producer Anna Ginsburg Anna Ginsburg Editor Mark Prendergast, Contact [email protected] of A range in this intimate documentary. sexuality and vaginas discuss masturbation, genitals Talking by a different animator. and desires and each voice is visualised people share their insecurities 2015 Running Time 8 Cipka Form Narrative CountryPremiere Status UK Original Title Poland Year Director Renata G min Language No Dialogue National Film School in Łód Wurst Untamed Truths Tram Pussy Private PartsPrivate 126 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY The MoreIKnow Happy End Fences Cowboyland Composition Beyond AnimationForumNewTalentsVisegrad 2016 WORLD ANIMATION PANORAMA Cinematographer NataliaKrawczukAnimatorEditorMagdalenaChowa Cinematographer JanSaskaAnimatorEditorMusic FrancMiheli,Alkehol,Ji Mitja Man Cinematographer MarekNáprstekAnimator MarekNáprstekEditorMat Director NataliaKrawczukScreenwriterProducer PolischNationalFilmSchoolinŁód PolandYearOriginal TitlePłotyFormNarrativeCountry 2015RunningTime7minLanguageNoDialogue Contact [email protected] Cinematographer DávidŠtumpfAnimatorEditor inBratislava Arts Dialogue DirectorDávidŠtumpfScreenwriterProducer AcademyofPerforming SlovakiaYearOriginal TitleKovbojskoFormNarrativeCountry 2014RunningTime5minLanguageNo No DialogueDirectorMitjaMan SloveniaYearOriginal TitleKompozicijaFormExperimentalCountry 2015RunningTime4minLanguage Contact [email protected] Animator MilanKopasz,Vivien SarkanyEditorJudizCzako Kopasz ScreenwriterMilanProducer KrisztinaHolloLelesziCinematographerBalazsVarju Toth Year Hungary Form NarrativeCountry 2015RunningTime10minLanguageNoDialogueDirectorMilan Language CzechDirectorMarekNáprstek Screenwriter MarekNáprstekProducer ZuzanaKu Original Title Language NoDialogueDirectorJanSaskaScreenwriterProducer FAMU Ond CzechRepublicYearOriginal TitleHappyEndFormNarrativeCountry 2015 Running Time6min he takes us on a journey throughhismemories. he takesusona journey his lifewithus.While hisrelativeswaitoutsidethe door, eager togetashareofwhatwasonce his, oldmanispreparingtodie.Havingnothing moretofear,A weary hedecidestosharethesecretof comedy aboutdeathwithahappyending. Hunters, atractordriver, adiscoboy, acorpse.Asplendidchainofunlikelyencounters.black is areflectionontheroleof‘fences’inourlives.Realonesasmuchthoseminds. oneofusdealswiththeminourownway.accompany ourlivesfrombeginningtoend.Every Thefilm ofvariouskinds A birdinacage,toddlerplaypen,twodogsoneithersideoffence.Partitions sheriff’s horsebreaksandachicken interferes. According tothelawofWild West, thievesmustbe punished.Butitisn’t quiteaseasywhenthe sound. Heartheimage.It’s music,onthescreen. relationshippossiblebetweenthem.Seethe audiovisual mediuminordertotriggerthemostharmonic Two filmbasics–soundandimagearecreatedbythesamelinesengraveddirectlyonprimary closer… Somestepback,somemove black hole.PlacesandsituationsofunusualattractionalsoexistonEarth. A placeinspacewheretheattractionofgravityissostrongthatevenlightcannotescapecalled Contact [email protected] Contact [email protected] Contact [email protected] Contact [email protected] Martin Klusák,MichalPavlí Martin č ek Animator MitjaMan Č CzechRepublicYearím vícvímFormNarrativeCountry 2015RunningTime8min č ek, MichaelKocáb č ek ScreenwriterMitjaMan č ek Editor BorkoRadeš č ek MusicMitjaMan č ek Producer MitjaMan ě j PospíšilMusicMat č ek č ek Cinematographer ř ń ej ska Šejnoha Šejnoha ě j D č erová erová ů ř ras í Saska, í Saska, ź

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30

127

4 min 2015 Running Time Narrative Countryledziony Form Year Poland ś Visegrad Animation Forum New Talents 2016 Visegrad Talents New Forum Animation 2015 Running Time 5 min Language je igre Form Narrative Country Croatia Year č WORLD ANIMATION PANORAMA ANIMATION WORLD Andrea Guizar Maria Editor Andrea GuizarMusic Andrea Guizar Andrea GuizarAnimator Cinematographer ź Czechowska Contact [email protected] Polish National Film Polish National Andrea GuizarProducer Screenwriter Director Andrea Guizar Language No Dialogue School in Łód ALU i Ustanova Zagreb film 2015 No Dialogue Director Jelena Oroz Screenwriter Jelena Oroz Producer Cinematographer Jelena Oroz Animator Jelena Oroz Editor Jelena Oroz Contact [email protected] Attila Bertóti, Péter Vácz, Nándor Bera, Márk Juhász, Virág Kiss, Mátyás Kungl, Soma Sebesvári Kiss, Mátyás Kungl, Soma SebesváriJózsef Fülöp Animator Attila Bertóti, Péter Vácz, Nándor Bera, Márk Juhász, Virág Editor Judit Czakó Music Máté Hámori Contact [email protected] Original Title Vu Just where are their In a large house, three young wolves are spending late afternoon together. parents, who complete the idyllic family pictures on the walls? Animator Krisztina Hollo Leleszi Screenwriter Nadja Andrasev Producer No Dialogue Director Nadja Andrasev Zeno Mira Editor Judit Czako Andras Menrath, Maja Szakadat, Soma Sebesvari, Zoltan Koska, Zsuzsanna Kreif, Kristof Music 12Z, Balint Szabo, Marci Contact [email protected] 2014 Running Time 8 min Language Original Title Mese Form Narrative Country Hungary Year Hungarian Director Attila Bertoti Screenwriter Attila Bertoti based on a short story by Daniil Kharms Cinematographer the guards, the horse, the Lenochka, the king, the queen, the robber, Animated short about Vanya, on a shortblacksmith, the fire chief and his wife, based story by Daniil Kharms. Every day, a woman is scrutinized by her neighbour’s cat as she takes care of her exotic plants. This cat as she a woman is scrutinized by her neighbour’s Every day, stranger pays her a visit. when the cat disappears. Next spring a peculiar ritual comes to an end 2014 Running Time 3 min Language Polish Original Title Rzeki Form Narrative Country Poland Year Malgorzata Czyzewska Cinematographer Producer Director Daria Kopiec Screenwriter Daria Kopiec the river? As the river? This highly poetic film is based on a With A man grows up and old by the river. journey as part of the natural flow of life. poem by Czeslaw Milosz and illustrates man’s Mozaika walc Mozaika walc Original Title Nine colourful work, ‘the waltz of spleen’. A tragic are engaged in mysterious coordinated characters and sublime sentiments meet in the verycomedy where visceral same place. 2015 Running Time 9 min Language Form Narrative CountryOriginal Title A nyaintás nesze Hungary Year Adam WyrwasJaroslaw Bedyk, Maciek Bedyk, Daria Kopiec Animator Music Ola Bilinska Editor Monika Sirojc Contact [email protected] Wolf Games Wolf Tale Rivers The Noise of Licking The Noise of Mosiac, the Waltz of Spleen of the Waltz Mosiac, 128 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Capacities Bread Brass Heaven Borschtsch Bingo! AD 1364/TheEndofChivalry FilmFestival InternationalShort withHamburg In Partnership THREE-MINUTE QUICKIES Contact [email protected] Producer SimonEllisCinematographer UKYearForm NarrativeCountry 2015RunningTime3minLanguageEnglishDirectorSimonEllis Contact [email protected] Cinematographer StephanHeinzbvk No DialogueDirectorThomasM.BausenweinScreenwriterRichardKropfProducer SebastianStorm Year Germany Premiere StatusUKFormNarrativeCountry 2010RunningTime3minLanguage Contact [email protected] Walraven, MerelvandenBroek,NicoleDerksen Patrick SchoenmakerScreenwriterProducer DaanVelsink AnimatorBobWolkers, Florian NetherlandsYearForm NarrativeCountry 2015RunningTime3minLanguageNoDialogueDirector Contact [email protected] Director JakeMahaffyScreenwriterCinematographerEditor NewZealand,USAYearForm NarrativeCountry 2015RunningTime3minLanguageNoDialogue Contact [email protected] Fraun ScreenwriterKuestiCinematographer ChrisBrandl Year Germany Form NarrativeCountry 2011RunningTime1minLanguage NoDialogueDirectorKuesti Contact [email protected] Karabacak TurkeyForm NarrativeCountry Year 2014 Running Time3minLanguageNoDialogueDirectorBatıkan The shortest short filmyoumighteverseeandstilloneofthebiggestlaughs. short The shortest capitalism. ofmodern An allegory district forthelocal‘brass’.Thedrinkingbeginsaboardalow-costflight. weekend,groupsofEnglishmencelebrateanimminentmarriagebyvisitingHamburg’sEvery red-light polaroid picture. off,isn’tThe stoveisturned it?Bettercheck.Andcheckagain.ButBenjaminisclever. Benjamintakesa has onesparkofjoy:theweeklyBingonight. The seclusiveretirementhomeAfterglowisadepressingendstation.Fortunately, feistyelderlyGerda of chivalry. A LIFFalumnusfrom2015,thisfavouritedepictsthehistoricalcatastrophethatledtoendofera

Editor SimonEllisMusic

Editor ChrisBrandl

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 129

Editor Myrna Brinkman

Fitzcarraldo Films S.L. Fitzcarraldo Films Producer

Editor Matthias Hippler

THREE-MINUTE QUICKIES THREE-MINUTE [email protected], [email protected] Contact [email protected], his flatmates quite awake yet and all he wants is to enjoy a relaxed breakfast. Why don’t Alfred isn’t just leave him alone? A film about a feeling everyone sharing their kitchen will be able to empathise with. 2016 Running Time 3 min Language French Director Thomas Scohy Form Narrative Country France Year Cinematographer Paul Chapel Maxim Peignet Kevin Zonnenberg Screenwriter Mike Zonnenberg Producer A young man. And a mysterious switch. 3 min Language No Dialogue Director Kai 2015 Running Time Form Narrative Country GermanyYear Frank Herbort Cinematographer Andreas Artelt Kullack, Boris Kantzow, 2015 Running Time 2 min Original Title Heimaturlaub Form Documentary Country Germany Year Language GermanCinematographer Carsten Knoop, Dorit Kiesewetter Director Carsten Knoop, Dorit Kiesewetter Editor Carsten Knoop Dorit Kiesewetter Contact [email protected] in the kitchen. The crows did, too. The cows already got used to the compressor Editor Thomas Scohy Music Ronan Maillard Contact [email protected] Sheila Rodriguez Cinematographer Contact [email protected] Every action has a reaction. Celine 2013 Running Time 2 min Language No Dialogue Director Form Narrative Country France Year Cinematographer Louise Schmidt Groussard Screenwriter Celine Groussard, Denis Leluc acquaintance can be the verySometimes, conversations with a spontaneous sometimes, best. And makes it even better... having these conversations in a foreign language No Dialogue Director FranciscoLanguage No Dialogue Running Time 3 min 2015 CountryForm Narrative Spain Year Sheila Rodriguez Francisco Menchón, Rodriguez Screenwriter Menchón, Sheila we? Everyto us, don’t person in bed next love the single bit of them. We Director Anselm 2011 Running Time 1 min Language No Dialogue Form Narrative Country Germany Year Paul OhmertProducer Belser Screenwriter Anselm Belser Anselm Belser Cinematographer Anselm Belser Editor Contact [email protected] Contact [email protected], [email protected] In Partnership Hamburg with Short International Film Festival Phoneheads - Roll That Stone Off Home Leave French Kiss Felix... Delicatesen 130 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY The UpperStorey What’s Mean? Virgin Silence Relaxatron 5000 FilmFestival InternationalShort withHamburg In Partnership THREE-MINUTE QUICKIES Screenwriter MichaelDaviesProducer SandraGorelCinematographerIanSalvage UKYearForm NarrativeCountry 2008RunningTime3minLanguageEnglishDirectorMichaelDavies A braininajar, aguardandproblem.It’s allthere,intheupperstorey. Don’t loseit. Contact [email protected] Cinematographer RutgerStorm Time 3minLanguageNoDialogueDirectorAndréMaatScreenwriterProducer LiekeGeukers NetherlandsYearOriginal TitleBovenkamerPremiereStatusUKFormNarrativeCountry 2015Running Contact [email protected] Brodach ScreenwriterAleksanderTsoy Producer Yuri GrachevskyCinematographerMikhailVikhrov RussiaYearForm NarrativeCountry 2015RunningTime3minLanguageNoDialogueDirectorElena Contact [email protected] Director AndrewBrandProducer BadStudioAnimatorAndrewBrand UKYearPremiere StatusUKFormNarrativeCountry 2016RunningTime2minLanguageNoDialogue Contact [email protected],[email protected] Sometimes littlequestionsneedbiganswers…or, dothey? dreamsof. abouttheloveeveryone for manyyears.Astory old cinema,anagedcoupleisenjoyingafilmscreening,justastheyhavebeendoing In acharming -toomuchrelaxationmighthaveitssideeffects. Relaxatron 5000.Butbewarned Feeling alittletiredtoday?Awired?Take arestfromyourstressfullifewiththeexclusive

Editor BenPutlandMusicNickSmith@StainlessSound

Editor DavidThrasher 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 131 Oursie the bear and Ampersand the snail face the elements on a journey to reunite Ampersand with her family. 2015 Running Time 2 min Language No Dialogue Director Stuart Powers Form Narrative Country UK Year Animator Stuart Powers Contact [email protected] animation. The upwards adventures of a young boy come to life in this beautifully simple whiteboard 2015 Running Time 3 min Language No Dialogue Director Alex Anderson- Form Narrative Country US Year Kenney Animator Alex Anderson-Kenney Contact [email protected] Huang Ying 2016 Running Time 9 min Language No Dialogue Director Form Narrative Country China Year Contact [email protected] animated shortThe original Chinese name of this beautifully film means the end of a month in a lunar as they are meeting, playing and nesting Meet two birds and follow them throughout a year, calendar. as the seasons change. Deer is living a cosy life of hot chocolates and warmDeer is living a cosy life every blankets. But night, his world is shaken up by a suspicious earthquake... 2014 Running Time 5 min Language English Director Andy Martin Form Narrative Country UK Year Animator Andy Martin Contact [email protected] distinct worlds. The lives on these planets give us an An intergalactic adventure that takes us to various idea of a part be waiting to be discovered, as well as a mirror to how of outer space that might just we spend our lives on our own planet. No Dialogue Director Emma Brett- Language No Dialogue Running Time 30 sec 2016 CountryForm Narrative UK Year Phare Contact [email protected] An armadillo of bouncing. discovers the joy Language No Dialogue Director Örs 2015 Running Time 6 min Form Narrative Country Hungary Year Bárczy Contact [email protected] FAMILY SHORT FILMS AT KIRKGATE MARKET KIRKGATE AT FILMS SHORT FAMILY Travel Companions Travel Sky High The Plume The Planets 1, 3, 5, 11 & 12 The Planets 1, 3, 5, 11 & Hey Deer! Boing! 132 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Hurry up! Hurry Hey Deer! Catch It! Astronaut-K In CollaborationwithCiné-JeuneInternationalFilmFestival YOUNG EUROPEANCREATIONS ONTOUR#4 Circus ofRedPoppy Akouo At rushhour, afruitcrowdthrongsintothemetrotofrantic rhythmofthemusic. Contact [email protected] No dialogueDirectorMargotReumont BelgiumYearOriginal TitleGrouillionsnousForm NarrativeCountry 2015RunningTime5minLanguage by asuspiciousearthquake... night,hisworldisshakenup blankets. Butevery Deer islivingacosylifeofhotchocolatesandwarm Contact [email protected] Bárczy Year Hungary Form NarrativeCountry 2015 Running Time6minLanguageNodialogueDirectorÖrs to disturbtheirpeaceofmind... A groupofmeerkatstakescareitsbelovedanduniquefruitneartheirburrow, butavultureintends Contact [email protected] Marion Demaret,NadègeForner, Pierre-BaptisteMarty, JulienRobyn,JordanSoler FranceYearForm NarrativeCountry 2015RunningTime5minLanguageNodialogueDirectorPaulBar, possibility ofgettingback,hemustmakehiswayinthisexoticworld. astronaut extremelyclumsy, heisalsodoggedbybadluck.Aloneon a strangeplanetandwithno A koalaastronautventuresintoaliengalaxiesandexploresnewworlds.Unfortunately, notonlyisthe Contact [email protected] Daniel Harisberger SwitzerlandYearForm NarrativeCountry 2014RunningTime6minLanguageNodialogueDirector performances. night,asmallboywithheadfulloffantasieswitnessesdreamlikecircus Once uponastarry Contact [email protected] Smatana No dialogueDirectorMartin SlovakiaYearOriginal TitleRossoPapaveroFormNarrativeCountry 2015RunningTime5minLanguage In asilentworld,littlegirlsmeetsstrangecreature.Wonderful landscapesthenappear... Contact [email protected] Souquet, SophieAnnibal,Stanculescu,NinaDegrendel,Heidenreich FranceYearForm NarrativeCountry 2015RunningTime3minLanguageNodialogueDirectorClaire

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 133 60 min Country UK 2016 Year Running Time Format Digital Language English Director Various Inside an office there’s a coffeemaker which is used frequently by the employees. Little do they know which is used frequently by the employees. a coffeemaker Inside an office there’s kitchen and everythat the machine is a tiny by an opossum. Until one day… coffee is actually brewed 2015 Running Time 7 min Language No dialogue Director Elena Form Narrative Country Germany Year Walf Contact [email protected] to one another – oil, gold and fire. The little mountain Three great mountains show off their possessions something that appears to be small and useless. This sitting next to them, on the other hand, owns can be. animated film shows how deceptive first impressions Running Time 5 min 2015 Narrative Country Le Petit CordonnierForm Original Title France Year Lefebvre, Romain Cislo, Pierre-Yves Bonvard, Charley Carlier, Terry Director Galaad Alais, Language No dialogue Nawfal Benjamin Mariotte, Karen Philippe Lim, Contact [email protected] Who would have thought that his craft that he makes shoes that come to life. A cobbler is so good at helping him one day? they would even end up Director Paul 2014 Running Time 4 min Language No dialogue Form Narrative Country Germany Year Cichon Contact [email protected] In Collaboration with Ciné-Jeune International Film Festival Film International with Ciné-Jeune In Collaboration YOUNG EUROPEAN CREATIONS ON TOUR #4 / VR / #4 TOUR ON CREATIONS EUROPEAN YOUNG (Narrative, Eric Darnell , USA, 2016, 4 min, [email protected]) From the director of Madagascar comes Invasion!, a colourful From VR animated (Narrative, Eric Darnell , USA, 2016, 4 min, [email protected]) (Documentary, Arnaud France, UK, 2016, 15 min, contact@ Colinart, AmauryNotes on Blindness (Documentary, La Burthe, Peter Middleton, James Spinney, sensory and interactive VR project based on John Hull’s notesonblindness.co.uk) Alongside the feature film, Notes On Blindness : Into Darkness is an immersive, audio diary. a moment and a specific location from John’s psychological experience of blindness, each scene addressing a memory, day in it like to spend 23 hours a What’s Francesca Panetta, Lindsay Poulton, Anetta Jones, UK, 2016, 8 min, [email protected]) 6x9 (Documentary, first VR experience, which places you inside a US solitary confinement prison cell. a cell measuring 6x9 feet for weeks, months or even years? 6x9 is ’s Using the immersive storytelling Natalie Downing, UK, 2016, 2 min, [email protected]) of VR,Leeds: A City in Bloom (Documentary, vibrancy and its space. The end result is an experience A City in Bloom brings people close to the city of Leeds, allowing the viewer to get a feel of the city’s through the city giving a feeling of discovery untapped by any other artistic medium. skyline with this Enjoy a break taking view of London’s Natalie Downing, UK, 2016, 1 min, [email protected]) Monument (Documentary, vertiginous ‘out of body’ experience specifically designed to take advantage of the 360 views of virtual reality. A compelling demonstration of the Natalie Downing, UK, 2016, 5 min, [email protected]) (Documentary, Wonder a World Growing to the attending world leaders and heads of internationalpower of 360 content in influencing global decision making. Created for COP21 the film premiered development agencies. Four billion dollars was subsequently pledged to the initiative. Invasion! short are one of them! about a duo of aliens with grand ambitions to take over our world. Instead, they are greeted by two adorable, white bunnies….and you Bruntwood Virtual Reality Booth at Leeds Station Something Opossum The Little Shoe Maker The Little 134 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY Twisted The Present Diving IntoYour Absence Approaching ThePuddle programme andhighlightsthatthefoundationsforourpresentcinematiccelebrationswerereallylaidinpast. with theNationalMediaMuseum.AsampleofBFI’s EarlyCinema:PrimitivesandPioneersaddssomebetterknownsilentfilmclassicstothis some oftheearliestevercolouredmovingimagesbyEdwardRaymondTurner. Theworksofboththeseinnovatorsarepresentedinpartnership by happytobringthesefilmgemstheBigScreen.Theywillbecomplemented firstmovingimagesinLeeds1888andwearevery shot thevery Additionally, offilm.LouislePrince isreallytheoriginalform form aselectionofpre-1910earlysilentfilmsdrawsattentiontothefact thattheshort films which,duetonewmediaandwatchinghabits,gainincreasingrecognitionindependentlyfromfeaturelengthproductions. Two onLeedsBigScreenthisyear. filmform diverseprogrammeschampiontheshort Seasonallythemedproductionsexploretrendsinrecentshort Celebrating theNewandOld LEEDS BIGSCREENONMILLENNIUMSQUARE Contact [email protected] Producer AnnaMataczAnimatorJacobFrey Year Germany Form NarrativeCountry 2014RunningTime4minLanguageEnglishDirectorJacobFrey Contact [email protected] Cristina MongeEditorConchaVidal, CristinaMonge No DialogueDirectorConchaVidal ScreenwriterConchaVidal Producer ConchaVidal Cinematographer Premiere StatusYorkshire SpainYear FormExperimentalCountry 2015RunningTime4minLanguage Contact [email protected] Sebastian Gimmel,HomaiToyoda EditorSebastianGimmelMusicTobias Hartmann CologneCinematographerClaireJahnChoreographer Sebastian GimmelProducer AcademyofMediaArts Year Germany Form NarrativeCountry 2014RunningTime9minLanguageNoDialogueDirector Contact [email protected] Samplify BowenMusicRussellThornton, Stuart Screenwriter NicholasRussellProducer JodiMatterson,IlanaLazarCinematographerLachlanMilneEditor USAYearForm NarrativeCountry Bowen 2014RunningTime6minLanguage NoDialogueDirectorStuart with balloons is to make a poodle then this funny short willdefinitelychangeyourmind. with balloonsistomakeapoodlethenthisfunnyshort us withtwomendecidingtodobattlenothingmorethanballoons. Andifyouthinkallcando Heard ofdance-offs?Mayberapbattles?Buthaveyoueverheard balloonbattles?Twisted presents Jake spendsmostofhistimeplayingvideogamesindoorsuntilmumdecidestogivehimapresent. slowlyemergesfromacuriousvatfilledwithanaqueousmaterial. A lonefemaleperformer park. asurrealexplorationofanemptycar A curiouswomanandherfabulousyellowwelliesundertake

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 135 UK, France 1888 - 1904 20 min No Dialogue Country Year Running Time Digital Format Language Various Director LEEDS BIG SCREEN ON MILLENNIUM SQUARE MILLENNIUM ON SCREEN BIG LEEDS (James Williamson, UK, 1901, 4 min, Narrative) A forerunner of today’s action films, the fire brigade is working hard to rescue inhabitants out UK, 1901, 4 min, Narrative) A forerunner of today’s (James Williamson, (Arrivee d’un train en gare a La Ciotat, Auguste and Louis Lumière, France, 1895, 1 min, Documentary) a La Ciotat, Auguste and Louis Lumière, France, (Arrivee d’un train en gare One of the first The Arrival of a Train classic. Train is an absolute The Arrival of a to a wider audience and certainlyfilms ever to be exhibited most talked about to this day. one of the the medium film as the latest internet UK, 1901, 1 min, Narrative) Early filmmakers were just as creative with The Big Swallow (James Williamson, you on a very This film sends special journey. start-ups today. Louis Lumière, France, 1895, 1 min, Documentary) Auguste and The demolition of a wall doesn’t (Demolition d’un mur, Demolition of a Wall on film, but this shortsound like the most dramatic footage to capture is so captivating and inventive, that it will convince you otherwise. Fire! of their burning home. (extract), Georges Méliès, France, 1904, 7 min, Narrative) No list of film pioneers is a travers l’impossible (Voyage The Impossible Voyage Voyage is unmissable. The Impossible whose ideas have influenced films to this day. complete without the incredibly inventive Méliès (George Albert Hidden kisses in the cosy darkness of railway tunnels were a favourite Smith, UK, 1899, 1 min, Narrative) The Kiss in the Tunnel version is an especially charming example. topic of the earliest film pioneers and Smith’s Leaving the Factory (Sortie France, 1895, 1 min, Documentary) d’usine, Auguste and Louis Lumière, The Lumière brothers had a talent for seeing documentarythe dramatic in the most mundane situations. This shorta late 19th makes you wonder – how many people could have possibly fit into century factory? film, which stars great sense of humour is coming through in this Let Me Dream Again (George Albert Smith’s Smith, UK, 1900, 1 min, Narrative) a long-married couple in the leading roles… min, Documentary)Niagara (Auguste and Louis Lumière, France, 1897, 1 The Falls have invoked a fascination ever since mankind first laid their documentary they were a tourism hotspot even a century shows just how much eyes on them and Lumière’s ago Playing Cards (Partie d’ecarte, a relaxed afternoon Auguste and Louis Lumière, France, 1895, 1 min, Narrative) Spending playing cards with your friends? It could be even more enjoyable if everyone played to the rules, as this comedic short depicts… film Rough Sea at Dover (Birt Acres, UK, 1895, 1 min, Documentary) of the first international One the United States films to be exhibited in of film classic. America, Acres’ Rough Sea at Dover is an early go well Lumière, France, 1896, 1 min, Narrative) Snowball fights and cyclists don’t Snowball Fight (Bataille de Boules de neige, Auguste and Louis help but feel sorrytogether and you can’t battle. for the latter when he finds himself in the midst of a merciless UK Distributor British Film Institute LOUIS LE PRINCE FILMS Roundhay Garden Scene (Louis Aimé Augustin Le Prince, UK, 1888, 2.1 seconds, Documentary) Leeds Bridge (Louis Aimé Augustin Le Prince, UK, 1888, 2.7 seconds, Documentary) Accordion Player (Adolphe Le Prince) (Louis Aimé Augustin Le Prince, UK, 1888, 2 seconds, Documentary) The earliest known surviving of his examples of moving film which were made by Louis Le Prince in Leeds in 1888, using a single lens cine camera own invention. Contact [email protected] LEE & TURNER FILMS UK, 1902, 8.3 with Sunflowers (Edward Raymond Turner, & Wilfred Sidney Turner Agnes May Turner Alfred Raymond Turner, seconds, Documentary) UK, 1902, 6 seconds, Documentary) on a Swing (Edward Raymond Turner, Agnes May Turner UK, 1901/2, 7.7 seconds, Documentary) Corner (Edward Raymond Turner, Hyde Park Knightsbridge, London, Looking East Towards filmed family, Turner’s Footage includes images of Turner. Examples of the earliest moving colour film process invented and shot by Edward Raymond between 1901 and 1903. Contact [email protected] Silent ShortsSilent 136 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 SHORT FILM CITY To GetInTouch With Crows Rainbow The PassingoftheKeepersSalento:AMemorialtoObsolescence Last Acre Double Dapple Chalk Trace The Tetley FilmShowcase Open:Artist ARTIST FILM unexpectedly emotional. Nevertheless, shecontinuestomeetcrows inthepark.Theyallflyaway.unexpectedly emotional. Nevertheless, that shedoesn’t realisethatthecrowhasalready flownaway. Leftalonebythe birdshefindsherself A womantriestoengagewithcrows. Duringherfirstrendezvouswithacrowshegetssoexcited Contact [email protected] English DirectorRhonaMühlebach Premiere StatusWorld UKYear FormExperimentalCountry 2016RunningTime 7minLanguage Iran, whospeakoftheirchildhoodwhilelivingdailylivesat homeorinthecity. ofthreeindividualsin film,whichshows portraits Rainbow isadoublescreenshort Tehran, capitalof foundation fortherestofcharactertogrowonandmostitis usually hiddenfromouradultmind. periodsinlife,asitlaysthebasisand In myopinionchildhoodisoneofthemostimportant Contact [email protected] Language Farsi(Persian)DirectorNiloufarZabihi Premiere StatusYorkshire Iran,UKYear FormExperimental Country 2016RunningTime11min obsolescence in2014. a filmeddeclarationwiththetrainKeepersofPuglia,aboutmomenttheirrolefellinto ofthe‘MovingLandscapeproject’,documentsanddramatizes GAP andPepeNero(Italy)aspart The PassingoftheKeepersSalento:amemorialtoobsolescence,madewithorganizationsProgetto Contact [email protected] Italian DirectorAnn-MarieCreamer Italy,Premiere StatusUKFormExperimentalCountry UKYear 2015RunningTime11minLanguage this off-grid,outlyingcommunity Peter Warlock’s composition‘TheCurlew’,thefilmexploressocialandecologicaltopographyof the sanddunesofEngland’s With westcoastline,nearBarrow-in-Furness. asoundtrackfeaturing north centredonaremotesettlementofself-builtshedandcabinhomes,located portrait A documentary Contact [email protected] English DirectorNickJordanandJacobCartwright Premiere StatusYorkshire UKYear FormExperimentalCountry 2016RunningTime12minLanguage process. ThefilmwasdevelopedinbucketsatPhilHoffman’s ,Ontario,Canada,July2016. FilmFarm flickering shadows.Thehapticsensualityofthefilmresonatesthroughitsmaterialityandmaking ofthefilmstripthroughdoubleexposure,capturingdappledlightand Bodies meetonthesurface Contact [email protected] Stark&DavidChattonBarker Dialogue DirectorMary Premiere StatusWorld UKYear FormExperimentalCountry 2016RunningTime5minLanguageNo today –over60yearsafterRon’s originalgraffiti. changed networkofstreets.ThefilmwasphotographedintheoriginalstreetsOldhamastheystand ChalkTraceChadderton. throughanowmuch- commemoratesandreanimateshisgraffitijourney As achildinthe1950s,RonCockroftdrewchalklinefromhisschoolOldhamtohome Contact [email protected] UKYearForm ExperimentalCountry 2013RunningTime3minLanguageEnglishDirectorEstherJohnson

30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com SHORT FILM CITY BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 137

Utopian VisionsUtopian of Leeds 60 min Country UK 2016 Year Running Time Format Blu-Ray Language English Director Various Sales Company Lumen Contact [email protected] ARTIST FILM / FILMS FROM NOWHERE FROM / FILMS FILM ARTIST Matthew Denniss (sound by We Are Willow) (sound by We Matthew Denniss English Director Contact [email protected] We Operate a Ladder System explores the arcane nature of etiquette. Alton mines an array of cultural arcane nature of etiquette. Alton mines an array Operate a Ladder System explores the We etiquette cutleryphenomena, including; a private school’s wielding politicians, dystopian fction and Darwinianscale (that attempts to echo how the machinations of ), in order to consider powerful and forks. elites are enacted through their knifes 6 min Language 2015 Running Time Country Form Experimental Year UK Premiere Status Yorkshire By the end, you just seconds in, and Carol is revealing. One minute in, and Adam is so deep! Twenty created! believe this! Invest in your own Cultural Redevelopment and reject the reality you have won’t Commissioned by HOME as part of the exhibition ‘SAFE’(Nov 15 - Jan 16). 12 min Language 2013 Running Time Form ExperimentalCountry UK Year Yorkshire Premiere Status 2016 Running Time 9 min Language Form Experimental Country UK Year Premiere Status Yorkshire Pritchard) English Director Chris Alton (edited by Ralph Contact [email protected] English Director Chris Paul Daniels (original music by Graham Massey) Contact [email protected] Combining archival and original filmed footage with prints by Eduardo Paolozzi, the film incorporates original filmed footage with prints by Eduardo Combining archival and Text imagery pioneer Alan Turing. and work of mathematician and computer science referencing the life poem Aniara by Harryfrom the science fiction Martinson archival footage of early is used alongside and early space exploration. design systems computer-aided The Tetley Open: Artist Open: Showcase Film Tetley The Film from Nowhere (James Islip, UK, 2016, 8 min, Experimental) Experimental shortFilm from Holbeck in 2016. Interplay between bricks and surfaces filmed in with recorded live at Recon Festival 2015. modular synth soundtrack by Richard Formby, UK, 2016, 9 min, Documentary) structures which hide ancient sites to pre-Christian traditions which survive Linking man-made Ley-Lines (Anna Peaker, in the modern world, Ley-Lines uses analogue video effects and a home-made electronic soundtrack to evoke supernatural, sci-fi and horror tv of the 1970s. Leeds 2116, the air is flooded with ultrasound to cleanse the city of rodents, UK, 2016, 7 min, Narrative) Ultra Slick / Digital Village Idiot (Stu Bannister, insects and sporting injuries. Most citizens carry its function to listen in to the cacophony. a protective transmitter but some have reversed (James Islip, UK, 2016, 7 min, Documentary) Documentary years from about dark, ethereal passageways around Leeds City Centre, which 100 The Tunnel now may provide us with the only pedestrian routes around the City. UK, 2016, 10 min, Narrative) A utopian vision of how women in the near future may spend their recreational time. An (Kathryn Gray, Four Voices apparition of togetherness, alone time, intimacy and solitude, a hallucination of a choral ritual for four voices and bodies. UK, 2016, 10 min, Documentary) A fragmented visual record of a pilgrimage to sacred sites across Leeds with a (Giles Bailey, Elland Road Portal Tomb marginal locations of necropolises, hostelries and urban waterways. The work maps future ley lines stretching between the city’s live voice over. Films From Nowhere: Utopian Visions Nowhere: Utopian Films From of Leeds You Are A Powerhouse! You We Operate a Ladder System Operate We The Turing Suite The Turing

138 leedsfilm.com 30th LEEDS INTERNATIONAL FILM FESTIVAL @leedsfilmfest #LIFF30 BOX OFFICE: 0113 376 0318 INDEX INDEX -FEATURES 78The Handmaiden60 89Hacksaw Ridge19 Graduation Gimme Danger Ghostland Fukushima, MonAmour Francesca The First,theLast Bar Film PostersExhibitionatNorth Fantastic Mr. Fox Exit Smiling Elling Eggs Own Words Eat ThatQuestion:FrankZappainhis Drive Dougal andtheBlueCat Don't CallMeSon Dogs A DivorceBeforeMarriage The Devil Glen Matlock The DeclineofWestern Civilisationwith Daisies The CzechYear Creepy Cord Cleo from5to7 Claire inMotion Cinage: MiningtheMemories Chi-Raq WomenCertain Mixtape Cassette: ADocumentary Can You DigThis? Cameraperson Bugs Breakfast atTiffany's Restoration Blue Velvet: NewDigitalCinema ofaNation The Birth Belladonna ofSadness Being There The AutopsyofJaneDoe Assassination Classroom:Graduation As IOpenMyEyes ofNegativeThinking The Art Arctic Superstar Ambulance Amadeus -Director'sCut with theM41APulseRifle Screening Aliens: 30thAnniversary Action Space Exhibition atLeftBank Abandoned Yorkshire Photography 2001: ASpaceOdyssey 18 18 17 43 33 17 60 16 98 89 84 82 81 42 88 88 16 15 42 76 46 80 79 59 59 80 15 47 14 14 41 45 33 32 87 87 13 56 77 54 58 13 80 41 45 86 67 32 49 86 Norman JayLive Norman The NoondayWitch Napoleon My LifeasaCourgette MR James:WhistleandI'llCome to You Mr Gaga Mother Moonlight A MonsterCalls Mister Universo Mirrors toWindows: AsWoman TheArtist Mindhorn Mimosas Meru Mercenary The Matrix The MasterCleanse &Niki Martha A ManCalledOve Mali Blues The Lure Lost inTranslation Lonesome The LivesofTherese The LifeAquaticwithSteveZissou Life, Animated The LastDetail The LandBeneathOurFeet Lady Macbeth Labyrinth Koyaanisqatsi Kizumonogatari 1+2 Kitchen Stories Kids Police Jurassic Park Through FrenchCinema A Journey Johnny FrankGarrett'sLastWord Jaws It's OnlytheEndofWorld The IslandsandtheWhales The IslandFuneral Interstella 5555 In theHeatofNight In aGlassCage I AmNotaSerialKiller Homo Sapiens Here isHarold Hedi Heat: NewDigitalCinemaRestoration Headshot Harold andMaude Harmonium Harakiri The HappyFilm 98 64 85 63 48 37 24 23 63 23 36 62 22 67 22 69 52 36 21 43 62 93 84 35 93 35 78 47 21 92 92 56 83 61 91 98 61 91 20 34 20 90 90 68 52 46 82 19 68 60 78 19 89 34 Woman oftheDunes Wild The Wailing The Void United StatesofLove A UnitedKingdom Under theSkin Under theShadow Two Trains Runnin' Two LoversandaBear Train toBusan Tony Conrad:CompletelyinthePresent Tonight SheComes Toni Erdmann:LIFF30ClosingFilm Tomorrow Those WhoJump oftheNight The ThirdPart They CallMeJeegRobot The Tetley FilmShowcase Open:Artist Suntan ofNight Story Stop MakingSense Speedy A SilentVoice Sieranevada The Shining The Shepherd Shadows The ScientificMethodExhibition Schneider vs.Bax Scarred Hearts S1 Rock theBells Redline The RedTurtle Raw Quit StaringatMyPlate Purple Rain Pulp Fiction:BreakfastScreening Psychonauts, theForgottenChildren Pet Peelers Paterson: LIFF30OpeningFilm with SameTrade asMozart Patch-work: AnalogueElectronicNight Paris Tower 13atLeftBank On theSilverGlobe Old Stone Old CzechLegends The Odyssey O'Horten November 97 29 66 55 97 29 28 96 66 44 28 53 40 55 12 39 39 77 65 49 27 38 96 85 58 27 95 26 95 49 65 26 38 44 69 57 64 25 94 94 57 53 54 12 49 37 76 25 79 24 83 48 30th LEEDS INTERNATIONAL FILM FESTIVAL leedsfilm.com INDEX BOX OFFICE: 0113 376 0318 @leedsfilmfest #LIFF30 139 72 47 81 72 73 73 112 123 112 126 137 105 130 105 112 127 125 137 135 118 111 104 118 102 130 102 123 131 106 135 133 120 111 120 116 116 112 113 127 126 123 118 136 118 112 120 125 131 112 120 137 137 134 137 102 125 130 The Upper Storey Velodrool Venus for the New Year Waiting The Wall, Operate a Ladder System We Spent Afternoon A Well Mean? What's Virgin When Susurrus Stirs Hear The Bells When You Boar The Wild Games Wolf Wurst are a Powerhouse! You Roundhay Garden Scene Roundhay Samba #2 Samba Scent of Geranium Semele She Had A Dream She/Her The Signalman Silence The Silence Skatekeet Sky High Slope Small Talk Snowball Fight Something Spark Spring Jam The Sprint King Stalkers Grandma Steady Past Your While She's Dancing Summer's Puke is Winter's Delight The Swelling Symptoms Tale Beat of Sex Series Teat These C*cksucking Tears All Die in Space They Will Timecode with Crows Get in Touch To the Ends of the Fingertips To Totems Called Panic: the Noise A Town of the Grey Tram Companions Travel CountryTravelling and Error Trial The Tunnel Suite The Turing Twisted Idiot Ultra Slick / Digital Village Umpire Untamed Truths 70 70 84 72 47 70 47 72 47 70 110 114 110 103 124 133 110 105 122 116 124 117 119 110 119 133 126 127 107 113 114 135 107 111 127 133 129 107 114 133 103 111 124 114 136 114 120 129 111 131 117 135 131 115 134 125 125 136 111 122 130 105 127 135 INDEX - SHORTS INDEX The Lighthouse The Lights Lili Limbo Little Appliances Maker The Little Shoe A Love Story Hour The Mad Half Make Inishturk Great Again The Man Who Caught A Mermaid Manners Boxing Manoman Maze Merlot 2 MeTube The Midnight Shift Monument The More I Know of Spleen Mosiac, the Waltz Mother Mr Madila Relations My Wife's Nasty New Gods Niagara A Night in Tokoriki The Noise of Licking Notes on Blindness Off Feeling Oh What a Wonderful On Paper Opossum & Justice Orgreave Truth Campaign Oxytocin Party The Party The Passing of the Keepers of Salento: A Memorial to Obsolescence Pauline Pearlies Phoneheads - Roll That Stone Piano A Piece of Coal The Planets 1, 3, 5, 11 and 12 Platform 13 Playing Cards The Plume Polar Bear The Present Private Parts The Procedure Pussy Rainbow Record/Record Refuge Relaxatron 5000 Respect Rhapsody Rivers Roadside Assistance Rough Sea at Dover 57 71 70 73 71 73 71 59 73 62 113 109 104 119 129 126 104 122 137 135 117 137 106 129 122 106 133 126 115 109 131 132 104 113 129 107 105 132 107 119 109 104 135 117 133 109 106 124 109 113 113 117 109 110 135 124 135 136 135 135 133 116 110 135 103 106 137 Eternal Hunting Grounds Fantasy Father and Daughter A Father's Day Felix... Fences Ferris Wheel Figure Film from Nowhere Fire! Flamongi Four Voices Fox French Kiss From Space, Syria is Here The Frozen Eye Future Boyfriend The Geneva Convention Wonder Growing a World Happy End Happy Place The Head Vanishes Hey Deer! Home Home Education Home Leave Homebodies Homework Hurry up! I Follow You So Much I Have Dreamed of You Ideal Import The Impossible Voyage Inheritor Recordings Invasion! The Inverted Peak Iron Mountain It's Alright Ivan's Need Jacked Jim "The Fish" Jonah Jonas and the Sea Kaddish! Kaputt Keep Going Kindil The Kiss in the Tunnel Kissy Lips Man Knightsbridge, London, Looking Hyde Park Corner East Towards Last Acre Leaving the Factory Leeds Bridge Leeds: A City in Bloom Left Behind The Legend of Crabe Phare Let Me Dream Again Lethe Letting Go Ley-Lines Ernestine & Kit 72 73 35 80 85 47 70 71 47 47 71 71 47 133 135 128 135 132 135 103 114 107 134 135 132 108 108 103 106 126 135 128 118 115 131 128 105 128 128 122 103 128 132 136 104 132 102 115 126 108 126 122 108 129 102 135 117 134 136 108 115 119 137 108 6x9 Accordion Player Accordion End of ChivalryAD 1364 / The Adam Peiper Aden a Swing on Agnes May Turner Akouo Agnes Turner, Alfred Raymond Sidney & Wilfred May Turner with Sunflowers Turner Alzheimers: A Love Story Ambulance An Arms Length Anna Approaching The Puddle The Arrival of a Train Astronaut-K A Bagful of Fleas The Bald Future Street Bamboo Temple The Bathtub Battle of the Century The Beast Beyond The Big Swallow Bingo! Bla Bla Bla Blacker than Black Blue Grey Boing! Borschtsch Boys Brass Heaven Bread Bunkers The Call Campo Santo Capacities Catch it! Chalk Trace Cilaos Circus of Red Poppy Clan Claycat's Doom Coke Not Coal Collaborator The Community Shop: More Than Just Food Composition Compost Cosmic Jacuzzi Cowboyland Dear Peter Death Metal Deer Flower Delicatesen Those Delusion Is Redemption To In Distress Demolition of a Wall Diving into your Absence Double Dapple Eagle Blue Elders Elland Road Portal Tomb The Empty The Enemy Within