DOCSLIB.ORG

Mouse Spa17 Conditional Knockout Project (CRISPR/Cas9)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mouse Spa17 Conditional Knockout Project (CRISPR/Cas9) https://www.alphaknockout.com Mouse Spa17 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Spa17 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Spa17 gene (NCBI Reference Sequence: NM_011449 ; Ensembl: ENSMUSG00000001948 ) is located on Mouse chromosome 9. 5 exons are identified, with the ATG start codon in exon 2 and the TGA stop codon in exon 5 (Transcript: ENSMUST00000002013). Exon 3~4 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Spa17 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-443I14 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 3 starts from about 34.68% of the coding region. The knockout of Exon 3~4 will result in frameshift of the gene. The size of intron 2 for 5'-loxP site insertion: 4148 bp, and the size of intron 4 for 3'-loxP site insertion: 2306 bp. The size of effective cKO region: ~2395 bp. The cKO region does not have any other known gene. Page 1 of 7 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 3 4 5 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Spa17 Homology arm cKO region loxP site Page 2 of 7 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the GC Content Distribution Window size: 300 bp Sequence 12 Summary: Full Length(8895bp) | A(32.12% 2857) | C(19.28% 1715) | T(30.87% 2746) | G(17.73% 1577) Note: The sequence of homologous arms and cKO region is analyzed to determine the GC content. No significant high GC-content region is found. So this region is suitable for PCR screening or sequencing analysis. Page 3 of 7 https://www.alphaknockout.com BLAT Search Results (up) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr9 - 37607938 37610937 3000 browser details YourSeq 60 1219 1323 3000 88.4% chr2 + 132407771 132407877 107 browser details YourSeq 60 1219 1350 3000 95.6% chr2 + 27193416 27193621 206 browser details YourSeq 58 1201 1317 3000 86.5% chr5 + 125235706 125235821 116 browser details YourSeq 54 1221 1317 3000 89.8% chr2 + 167551126 167551231 106 browser details YourSeq 53 1230 1318 3000 88.6% chr7 - 127264895 127264981 87 browser details YourSeq 53 1228 1316 3000 85.8% chr3 - 69251120 69251206 87 browser details YourSeq 53 1219 1317 3000 88.9% chr13 + 103979155 103979252 98 browser details YourSeq 52 1174 1317 3000 96.5% chr1 + 79952567 79952747 181 browser details YourSeq 51 1219 1317 3000 91.3% chr5 - 66256400 66256497 98 browser details YourSeq 51 1216 1311 3000 82.8% chr12 - 16481419 16481504 86 browser details YourSeq 50 1222 1314 3000 91.1% chr1 - 135318755 135318846 92 browser details YourSeq 49 1273 1344 3000 93.0% chr11 - 6535998 6550642 14645 browser details YourSeq 49 1230 1312 3000 86.3% chr8 + 119556887 119556967 81 browser details YourSeq 48 1230 1317 3000 85.2% chr9 + 106055494 106055577 84 browser details YourSeq 48 1230 1315 3000 85.0% chr6 + 31506448 31506531 84 browser details YourSeq 47 1220 1317 3000 87.8% chr3 - 99321891 99321987 97 browser details YourSeq 46 1219 1317 3000 90.2% chr9 - 65066655 65066751 97 browser details YourSeq 46 1219 1297 3000 79.5% chr17 + 46881201 46881279 79 browser details YourSeq 44 1230 1318 3000 82.0% chr3 - 27696890 27696971 82 Note: The 3000 bp section upstream of Exon 3 is BLAT searched against the genome. No significant similarity is found. BLAT Search Results (down) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr9 - 37602543 37605542 3000 browser details YourSeq 130 1447 1623 3000 87.7% chr7 + 57180934 57181100 167 browser details YourSeq 130 1451 1611 3000 90.3% chr1 + 153647547 153647696 150 browser details YourSeq 130 1451 1599 3000 95.8% chr1 + 91247641 91247790 150 browser details YourSeq 129 1447 1577 3000 99.3% chr2 - 24106571 24106701 131 browser details YourSeq 129 1441 1577 3000 97.9% chr1 - 33773511 33773681 171 browser details YourSeq 127 1447 1577 3000 98.5% chr1 + 120451006 120451136 131 browser details YourSeq 123 1447 1577 3000 95.4% chrX - 84093230 84093359 130 browser details YourSeq 123 1449 1577 3000 97.7% chr6 - 38467179 38467307 129 browser details YourSeq 123 1452 1603 3000 88.7% chr2 - 13075011 13075154 144 browser details YourSeq 123 1451 1577 3000 98.5% chr1 - 180426920 180427046 127 browser details YourSeq 123 1451 1577 3000 98.5% chr16 + 55965830 55965956 127 browser details YourSeq 123 1451 1577 3000 98.5% chr12 + 4858392 4858518 127 browser details YourSeq 123 1447 1577 3000 97.0% chr11 + 78135327 78135457 131 browser details YourSeq 122 1447 1577 3000 94.6% chr14 + 120290633 120290761 129 browser details YourSeq 121 1454 1590 3000 94.9% chr7 - 120827407 120827704 298 browser details YourSeq 121 1451 1577 3000 97.7% chr7 + 118750251 118750377 127 browser details YourSeq 121 1451 1577 3000 97.7% chr7 + 113298627 113298753 127 browser details YourSeq 120 1452 1577 3000 97.7% chr9 - 64183275 64183400 126 browser details YourSeq 120 1416 1577 3000 93.5% chr15 - 10446054 10446617 564 Note: The 3000 bp section downstream of Exon 4 is BLAT searched against the genome. No significant similarity is found. Page 4 of 7 https://www.alphaknockout.com Gene and protein information: Spa17 sperm autoantigenic protein 17 [ Mus musculus (house mouse) ] Gene ID: 20686, updated on 12-Aug-2019 Gene summary Official Symbol Spa17 provided by MGI Official Full Name sperm autoantigenic protein 17 provided by MGI Primary source MGI:MGI:1333778 See related Ensembl:ENSMUSG00000001948 Gene type protein coding RefSeq status VALIDATED Organism Mus musculus Lineage Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus Also known as Sp17 Expression Biased expression in testis adult (RPKM 108.0) and CNS E11.5 (RPKM 4.0) See more Orthologs human all Genomic context Location: 9; 9 A4 See Spa17 in Genome Data Viewer Exon count: 5 Annotation release Status Assembly Chr Location 108 current GRCm38.p6 (GCF_000001635.26) 9 NC_000075.6 (37603294..37613916, complement) Build 37.2 previous assembly MGSCv37 (GCF_000001635.18) 9 NC_000075.5 (37410883..37421207, complement) Chromosome 9 - NC_000075.6 Page 5 of 7 https://www.alphaknockout.com Transcript information: This gene has 3 transcripts Gene: Spa17 ENSMUSG00000001948 Description sperm autoantigenic protein 17 [Source:MGI Symbol;Acc:MGI:1333778] Gene Synonyms Sp17, band 34 Location Chromosome 9: 37,603,290-37,613,722 reverse strand. GRCm38:CM001002.2 About this gene This gene has 3 transcripts (splice variants), 149 orthologues, 2 paralogues and is a member of 1 Ensembl protein family. Transcripts Name Transcript ID bp Protein Translation ID Biotype CCDS UniProt Flags Spa17- ENSMUST00000002013.10 696 149aa ENSMUSP00000002013.9 Protein coding CCDS22982 Q545M2 Q62252 TSL:1 201 GENCODE basic APPRIS P1 Spa17- ENSMUST00000214786.1 730 130aa ENSMUSP00000150651.1 Protein coding - A0A1L1SU87 CDS 3' incomplete 202 TSL:3 Spa17- ENSMUST00000215336.1 419 No - Retained intron - - TSL:2 203 protein 30.43 kb Forward strand 37.60Mb 37.61Mb 37.62Mb Genes Siae-202 >protein coding (Comprehensive set... Siae-206 >protein coding Siae-205 >retained intron Siae-201 >protein coding Siae-204 >protein coding Siae-207 >retained intron Contigs AC160125.2 > Genes (Comprehensive set... < Spa17-201protein coding < Spa17-202protein coding < Spa17-203retained intron Regulatory Build 37.60Mb 37.61Mb 37.62Mb Reverse strand 30.43 kb Regulation Legend CTCF Open Chromatin Promoter Promoter Flank Gene Legend Protein Coding Ensembl protein coding merged Ensembl/Havana Non-Protein Coding processed transcript Page 6 of 7 https://www.alphaknockout.com Transcript: ENSMUST00000002013 < Spa17-201protein coding Reverse strand 10.43 kb ENSMUSP00000002... MobiDB lite Low complexity (Seg) Coiled-coils (Ncoils) Superfamily SSF47391 SMART cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domain IQ motif, EF-hand binding site Pfam cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domain IQ motif, EF-hand binding site PROSITE profiles IQ motif, EF-hand binding site PIRSF Sperm surface protein Sp17 PANTHER Sperm surface protein Sp17 PTHR10699 Gene3D 1.20.890.10 1.20.5.190 CDD cd12100 All sequence SNPs/i... Sequence variants (dbSNP and all other sources) Variant Legend missense variant synonymous variant Scale bar 0 20 40 60 80 100 120 149 We wish to acknowledge the following valuable scientific information resources: Ensembl, MGI, NCBI, UCSC. Page 7 of 7.
Load more

Recommended publications
  • The Complex SNP and CNV Genetic Architecture of the Increased Risk of Congenital Heart Defects in Down Syndrome
    Downloaded from genome.cshlp.org on September 24, 2021 - Published by Cold Spring Harbor Laboratory Press Research The complex SNP and CNV genetic architecture of the increased risk of congenital heart defects in Down syndrome M. Reza Sailani,1,2 Periklis Makrythanasis,1 Armand Valsesia,3,4,5 Federico A. Santoni,1 Samuel Deutsch,1 Konstantin Popadin,1 Christelle Borel,1 Eugenia Migliavacca,1 Andrew J. Sharp,1,20 Genevieve Duriaux Sail,1 Emilie Falconnet,1 Kelly Rabionet,6,7,8 Clara Serra-Juhe´,7,9 Stefano Vicari,10 Daniela Laux,11 Yann Grattau,12 Guy Dembour,13 Andre Megarbane,12,14 Renaud Touraine,15 Samantha Stora,12 Sofia Kitsiou,16 Helena Fryssira,16 Chariklia Chatzisevastou-Loukidou,16 Emmanouel Kanavakis,16 Giuseppe Merla,17 Damien Bonnet,11 Luis A. Pe´rez-Jurado,7,9 Xavier Estivill,6,7,8 Jean M. Delabar,18 and Stylianos E. Antonarakis1,2,19,21 1–19[Author affiliations appear at the end of the paper.] Congenital heart defect (CHD) occurs in 40% of Down syndrome (DS) cases. While carrying three copies of chromosome 21 increases the risk for CHD, trisomy 21 itself is not sufficient to cause CHD. Thus, additional genetic variation and/or environmental factors could contribute to the CHD risk. Here we report genomic variations that in concert with trisomy 21, determine the risk for CHD in DS. This case-control GWAS includes 187 DS with CHD (AVSD = 69, ASD = 53, VSD = 65) as cases, and 151 DS without CHD as controls. Chromosome 21–specific association studies revealed rs2832616 and rs1943950 as CHD risk alleles (adjusted genotypic P-values <0.05).
    [Show full text]
  • © Copyright 2021 Heather Raquel Dahlin
    © Copyright 2021 Heather Raquel Dahlin The Structure of Sperm Autoantigenic Protein (SPA17): An R2D2 Protein Critical to Cilia and Implicated in Oncogenesis Heather Raquel Dahlin A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Washington 2021 Reading Committee: John D. Scott, Chair Ning Zheng Linda Wordeman Program Authorized to Offer Degree: Pharmacology University of Washington Abstract Structure of SPA17: An R2D2 Protein Critical to Cilia and Implicated in Oncogenesis Heather Raquel Dahlin Chair of the Supervisory Committee: John D. Scott, Ph.D., Edwin G. Krebs- Speights Professor of Cell Signaling and Cancer Biology Pharmacology A-Kinase Anchoring proteins (AKAPs) localize the activity of cyclic AMP (cAMP)-Dependent Protein Kinase (PKA) through interaction of an amphipathic helix that binds to a conserved RIIα docking and dimerization (R2D2) domain on the N-terminus of PKA. Genome analysis indicates that at least thirteen other RIIα superfamily proteins exist in humans, which are not coupled to cyclic nucleotide binding domains and are largely localized to cilia and flagella. The newly reported R2D2 proteins exist in two lineages differing by their similarity to Type I or Type II PKA. Moreover, R2D2 domains bind to AKAPs and can contain extra regulatory sequences conferring novel functions and binding specificity. Here we detail the structure of one such domain comprising the N-terminus of Sperm Autoantigenic Protein 17 (SPA17) resolved to 1.72 Å. The structure of core hydrophobic sites for dimerization and AKAP binding are highly conserved between PKA and SPA17. Additional flanking sequences outside of the core R2D2 domain occlude the AKAP binding site and reduce the affinity for AKAP helices in the absence of heterodimerization with another R2D2 protein, ROPN1L.
    [Show full text]
  • Evaluation of a New Method for Large-Scale and Gene-Targeted Next Generation DNA Sequencing in Nonmodel Species
    University of Montana ScholarWorks at University of Montana Graduate Student Theses, Dissertations, & Professional Papers Graduate School 2013 Evaluation of a New Method for Large-Scale and Gene-targeted Next Generation DNA Sequencing in Nonmodel Species Ted Cosart The University of Montana Follow this and additional works at: https://scholarworks.umt.edu/etd Let us know how access to this document benefits ou.y Recommended Citation Cosart, Ted, "Evaluation of a New Method for Large-Scale and Gene-targeted Next Generation DNA Sequencing in Nonmodel Species" (2013). Graduate Student Theses, Dissertations, & Professional Papers. 4133. https://scholarworks.umt.edu/etd/4133 This Dissertation is brought to you for free and open access by the Graduate School at ScholarWorks at University of Montana. It has been accepted for inclusion in Graduate Student Theses, Dissertations, & Professional Papers by an authorized administrator of ScholarWorks at University of Montana. For more information, please contact [email protected]. EVALUTATION OF A NEW METHOD FOR LARGE-SCALE AND GENE- TARGETED NEXT GENERATION DNA SEQUENCING IN NONMODEL SPECIES By Ted Cosart BA, University of Montana, Missoula, Montana, 1983 MS, University of Montana, Missoula, Montana, 2006 Dissertation presented in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Individualized, Interdisciplinary Graduate Program The University of Montana Missoula, Montana August, 2013 Approved by: Sandy Ross, Associate Dean of The Graduate School Graduate School Dr. Jesse Johnson, Co-Chair Computer Science Dr. Gordon Luikart, Co-Chair Flathead Biological Station Dr. Jeffrey Good Division of Biological Sciences Dr. William Holben Division of Biological Sciences Dr. Stephen Porcella Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases Dr.
    [Show full text]
  • Downloaded from the Tranche Distributed File System (Tranche.Proteomecommons.Org) and Ftp://Ftp.Thegpm.Org/Data/Msms
    Research Article Title: The shrinking human protein coding complement: are there now fewer than 20,000 genes? Authors: Iakes Ezkurdia1*, David Juan2*, Jose Manuel Rodriguez3, Adam Frankish4, Mark Diekhans5, Jennifer Harrow4, Jesus Vazquez 6, Alfonso Valencia2,3, Michael L. Tress2,*. Affiliations: 1. Unidad de Proteómica, Centro Nacional de Investigaciones Cardiovasculares, CNIC, Melchor Fernández Almagro, 3, rid, 28029, MadSpain 2. Structural Biology and Bioinformatics Programme, Spanish National Cancer Research Centre (CNIO), Melchor Fernández Almagro, 3, 28029, Madrid, Spain 3. National Bioinformatics Institute (INB), Spanish National Cancer Research Centre (CNIO), Melchor Fernández Almagro, 3, 28029, Madrid, Spain 4. Wellcome Trust Sanger Institute, Wellcome Trust Campus, Hinxton, Cambridge CB10 1SA, UK 5. Center for Biomolecular Science and Engineering, School of Engineering, University of California Santa Cruz (UCSC), 1156 High Street, Santa Cruz, CA 95064, USA 6. Laboratorio de Proteómica Cardiovascular, Centro Nacional de Investigaciones Cardiovasculares, CNIC, Melchor Fernández Almagro, 3, 28029, Madrid, Spain *: these two authors wish to be considered as joint first authors of the paper. Corresponding author: Michael Tress, [email protected], Tel: +34 91 732 80 00 Fax: +34 91 224 69 76 Running title: Are there fewer than 20,000 protein-coding genes? Keywords: Protein coding genes, proteomics, evolution, genome annotation Abstract Determining the full complement of protein-coding genes is a key goal of genome annotation. The most powerful approach for confirming protein coding potential is the detection of cellular protein expression through peptide mass spectrometry experiments. Here we map the peptides detected in 7 large-scale proteomics studies to almost 60% of the protein coding genes in the GENCODE annotation the human genome.
    [Show full text]
  • Genome-Wide Analysis of Cancer/Testis Gene Expression
    Genome-wide analysis of cancer/testis gene expression Oliver Hofmanna,b,1, Otavia L. Caballeroc, Brian J. Stevensond,e, Yao-Tseng Chenf, Tzeela Cohenc, Ramon Chuac, Christopher A. Maherb, Sumir Panjib, Ulf Schaeferb, Adele Krugerb, Minna Lehvaslaihob, Piero Carnincig,h, Yoshihide Hayashizakig,h, C. Victor Jongeneeld,e, Andrew J. G. Simpsonc, Lloyd J. Oldc,1, and Winston Hidea,b aDepartment of Biostatistics, Harvard School of Public Health, 655 Huntington Avenue, SPH2, 4th Floor, Boston, MA 02115; bSouth African National Bioinformatics Institute, University of the Western Cape, Private Bag X17, Bellville 7535, South Africa; cLudwig Institute for Cancer Research, New York Branch at Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021; dLudwig Institute for Cancer Research, Lausanne Branch, 1015 Lausanne, Switzerland; eSwiss Institute of Bioinformatics, 1015 Lausanne, Switzerland; fWeill Medical College of Cornell University, 1300 York Avenue, New York, NY 10021; gGenome Exploration Research Group (Genome Network Project Core Group), RIKEN Genomic Sciences Center (GSC), RIKEN Yokohama Institute, 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa, 230-0045, Japan; and hGenome Science Laboratory, Discovery Research Institute, RIKEN Wako Institute, 2-1 Hirosawa, Wako, Saitama, 3510198, Japan Contributed by Lloyd J. Old, October 28, 2008 (sent for review June 6, 2008) Cancer/Testis (CT) genes, normally expressed in germ line cells but expression profile information frequently limited to the original also activated in a wide range of cancer types, often encode defining articles. In some cases, e.g., ACRBP, the original antigens that are immunogenic in cancer patients, and present CT-restricted expression in normal tissues could not be con- potential for use as biomarkers and targets for immunotherapy.
    [Show full text]
  • Novel Targets of Apparently Idiopathic Male Infertility
    International Journal of Molecular Sciences Review Molecular Biology of Spermatogenesis: Novel Targets of Apparently Idiopathic Male Infertility Rossella Cannarella * , Rosita A. Condorelli , Laura M. Mongioì, Sandro La Vignera * and Aldo E. Calogero Department of Clinical and Experimental Medicine, University of Catania, 95123 Catania, Italy; [email protected] (R.A.C.); [email protected] (L.M.M.); [email protected] (A.E.C.) * Correspondence: [email protected] (R.C.); [email protected] (S.L.V.) Received: 8 February 2020; Accepted: 2 March 2020; Published: 3 March 2020 Abstract: Male infertility affects half of infertile couples and, currently, a relevant percentage of cases of male infertility is considered as idiopathic. Although the male contribution to human fertilization has traditionally been restricted to sperm DNA, current evidence suggest that a relevant number of sperm transcripts and proteins are involved in acrosome reactions, sperm-oocyte fusion and, once released into the oocyte, embryo growth and development. The aim of this review is to provide updated and comprehensive insight into the molecular biology of spermatogenesis, including evidence on spermatogenetic failure and underlining the role of the sperm-carried molecular factors involved in oocyte fertilization and embryo growth. This represents the first step in the identification of new possible diagnostic and, possibly, therapeutic markers in the field of apparently idiopathic male infertility. Keywords: spermatogenetic failure; embryo growth; male infertility; spermatogenesis; recurrent pregnancy loss; sperm proteome; DNA fragmentation; sperm transcriptome 1. Introduction Infertility is a widespread condition in industrialized countries, affecting up to 15% of couples of childbearing age [1]. It is defined as the inability to achieve conception after 1–2 years of unprotected sexual intercourse [2].
    [Show full text]
  • Anti-SPA17 Monoclonal Antibody, Clone 4C7 (CABT-22184MH) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-SPA17 monoclonal antibody, clone 4C7 (CABT-22184MH) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. Mouse monoclonal antibody raised against a partial recombinant SPA17. Immunogen SPA17 (NP_059121, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human Clone 4C7 Conjugate Unconjugated Applications WB,sELISA,ELISA Sequence Similarities EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKE EVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE* Size 100 μg Buffer In 1x PBS, pH 7.2 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics
    [Show full text]
  • Application of Genomic Technologies to Study Infertility Nicholas Rui Yuan Ho Washington University in St
    Washington University in St. Louis Washington University Open Scholarship Arts & Sciences Electronic Theses and Dissertations Arts & Sciences Spring 5-15-2016 Application of Genomic Technologies to Study Infertility Nicholas Rui Yuan Ho Washington University in St. Louis Follow this and additional works at: https://openscholarship.wustl.edu/art_sci_etds Part of the Bioinformatics Commons, Genetics Commons, and the Molecular Biology Commons Recommended Citation Yuan Ho, Nicholas Rui, "Application of Genomic Technologies to Study Infertility" (2016). Arts & Sciences Electronic Theses and Dissertations. 786. https://openscholarship.wustl.edu/art_sci_etds/786 This Dissertation is brought to you for free and open access by the Arts & Sciences at Washington University Open Scholarship. It has been accepted for inclusion in Arts & Sciences Electronic Theses and Dissertations by an authorized administrator of Washington University Open Scholarship. For more information, please contact [email protected]. WASHINGTON UNIVERSITY IN ST. LOUIS Division of Biology and Biomedical Sciences Computational and Systems Biology Dissertation Examination Committee: Donald Conrad, Chair Barak Cohen Joseph Dougherty John Edwards Liang Ma Application of Genomic Technologies to Study Infertility by Nicholas Rui Yuan Ho A dissertation presented to the Graduate School of Arts & Sciences of Washington University in partial fulfillment of the requirements for the degree of Doctor of Philosophy May 2016 St. Louis, Missouri © 2016, Nicholas Rui Yuan Ho Table of
    [Show full text]
  • Setd1 Histone 3 Lysine 4 Methyltransferase Complex Components in Epigenetic Regulation
    SETD1 HISTONE 3 LYSINE 4 METHYLTRANSFERASE COMPLEX COMPONENTS IN EPIGENETIC REGULATION Patricia A. Pick-Franke Submitted to the faculty of the University Graduate School in partial fulfillment of the requirements for the degree Master of Science in the Department of Biochemistry and Molecular Biology Indiana University December 2010 Accepted by the Faculty of Indiana University, in partial fulfillment of the requirements for the degree of Master of Science. _____________________________________ David Skalnik, Ph.D., Chair _____________________________________ Kristin Chun, Ph.D. Master’s Thesis Committee _____________________________________ Simon Rhodes, Ph.D. ii DEDICATION This thesis is dedicated to my sons, Zachary and Zephaniah who give me great joy, hope and continuous inspiration. I can only hope that I successfully set a good example demonstrating that one can truly accomplish anything, if you never give up and reach for your dreams. iii ACKNOWLEDGEMENTS I would like to thank my committee members Dr. Skalnik, Dr. Chun and Dr. Rhodes for allowing me to complete this dissertation. They have been incredibly generous with their flexibility. I must make a special thank you to Jeanette McClintock, who willingly gave her expertise in statistical analysis with the Cfp1 microarray data along with encouragement, support and guidance to complete this work. I would like to thank Courtney Tate for her ceaseless willingness to share ideas, and her methods and materials, and Erika Dolbrota for her generous instruction as well as the name of a good doctor. I would also like to acknowledge the superb mentorship of Dr. Jeon Heong Lee, PhD and the contagious passion and excitement for the life of science of Dr.
    [Show full text]
  • Nanostring® Technologies | WHITE PAPER | Ncounter Pancancer
    WHITE PAPER NanoString Technologies®, Inc. nCounter® PanCancer Immune Profiling Panel Multiplexed Cancer Immune Response Analysis nCounter® PanCancer Immune Profiling Panel for Gene Expression Lucas Dennis, Seely Kaufmann, Patrick Danaher, Christina Bailey and Joseph Beechem v1.0 | SEPTEMBER 2014 NanoString Technologies, Inc., Seattle, WA 98109 Molecules That Count® Pathway-based Translational Research Oncology Research WHITE PAPER Multiplexed Cancer Immune Response Profiling Multiplexed Cancer Immune Response Profiling Using the nCounter® PanCancer Immune Profiling Panel Introduction The ability of mutated cells to give rise to pathological cancer relies upon PanCancer Immune Profiling Panel: 770 Genes the capability of these cells to evade immune recognition, suppress immune activity, and persist in a chronically inflamed environment1,2. Tremendous growth in the understanding of these complex processes is beginning to generate breakthroughs in the treatment of cancer, and “Cancer Immunotherapy” was Immune Response Categories: 3 recently named the “Breakthrough of the Year” by Science in 2013 . However, • B Cell Functions • T Cell Functions our understanding of the immune response to cancer is far from complete. • NK Cell Functions There is a need for tools that enable researchers to explore the tumor • Antigen Processing • Adhesion microenvironment in new and different ways. This report describes a novel • Cell Cycle • Cell Functions gene expression panel that will enable researchers to create profiles of the • Chemokines human immune
    [Show full text]
  • Gene Batteries) in Mammals
    Predictive screening for regulators of conserved functional gene modules (gene batteries) in mammals S Nelander, E Larsson, E Kristiansson, R Månsson, O Nerman, Mikael Sigvardsson, P Mostad and P Lindahl Post Print N.B.: When citing this work, cite the original article. Original Publication: S Nelander, E Larsson, E Kristiansson, R Månsson, O Nerman, Mikael Sigvardsson, P Mostad and P Lindahl, Predictive screening for regulators of conserved functional gene modules (gene batteries) in mammals, 2005, BMC Genomics, (6), 68. http://dx.doi.org/10.1186/1471-2164-6-68 Licensee: BioMed Central http://www.biomedcentral.com/ Postprint available at: Linköping University Electronic Press http://urn.kb.se/resolve?urn=urn:nbn:se:liu:diva-74452 BMC Genomics BioMed Central Research article Open Access Predictive screening for regulators of conserved functional gene modules (gene batteries) in mammals Sven Nelander1, Erik Larsson1, Erik Kristiansson2, Robert Månsson3, Olle Nerman2, Mikael Sigvardsson3, Petter Mostad2 and Per Lindahl*1 Address: 1Sahlgrenska Academy, Department of medical and physiological biochemistry Box 440, SE-405 30 Göteborg, Sweden, 2Chalmers Technical University, Department of mathematical statistics, Eklandagatan 76, SE-412 96 Göteborg, Sweden and 3Lund Strategic Research Center for Stem Cell Biology and Cell Therapy, BMC B10, Klinikgatan 26, SE-221 48 Lund, Sweden Email: Sven Nelander - [email protected]; Erik Larsson - [email protected]; Erik Kristiansson - [email protected]; Robert Månsson - [email protected]; Olle Nerman - [email protected]; Mikael Sigvardsson - [email protected]; Petter Mostad - [email protected]; Per Lindahl* - [email protected] * Corresponding author Published: 09 May 2005 Received: 27 July 2004 Accepted: 09 May 2005 BMC Genomics 2005, 6:68 doi:10.1186/1471-2164-6-68 This article is available from: http://www.biomedcentral.com/1471-2164/6/68 © 2005 Nelander et al; licensee BioMed Central Ltd.
    [Show full text]
  • A High-Throughput Study in Melanoma Identifies Epithelial- Mesenchymal Transition As a Major Determinant of Metastasis
    Research Article A High-Throughput Study in Melanoma Identifies Epithelial- Mesenchymal Transition as a Major Determinant of Metastasis Soledad R. Alonso,1 Lorraine Tracey,1 Pablo Ortiz,4 Beatriz Pe´rez-Go´mez,5 Jose´ Palacios,1 Marina Polla´n,5 Juan Linares,6 Salvio Serrano,7 Ana I. Sa´ez-Castillo,6 Lydia Sa´nchez,2 Raquel Pajares,2 Abel Sa´nchez-Aguilera,1 Maria J. Artiga,1 Miguel A. Piris,1 and Jose´ L. Rodrı´guez-Peralto3 1Molecular Pathology Programme and 2Histology and Immunohistochemistry Unit, Centro Nacional de Investigaciones Oncolo´gicas; Departments of 3Pathology and 4Dermatology, Hospital Universitario 12 de Octubre; 5Centro Nacional de Epidemiologı´a, Instituto de Salud Carlos III, Madrid, Spain; and Departments of 6Pathology and 7Dermatology, Hospital Universitario San Cecilio, Granada, Spain Abstract with a less favorable prognosis as potential candidates for adjuvant Metastatic disease is the primary cause of death in cutaneous or novel therapies. malignant melanoma (CMM) patients. To understand the Currently, the prognosis of primary CMM is mainly based mechanisms of CMM metastasis and identify potential on histopathologic criteria. The most important of these is the predictive markers, we analyzed gene-expression profiles of Breslow index, although it is merely a measure of tumor depth. 34 vertical growth phase melanoma cases using cDNA micro- New molecular markers that correlate with melanoma genesis and/or progression are continuously being identified but, to date, arrays. All patients had a minimum follow-up of 36 months. Twenty-one cases developed nodal metastatic disease and 13 most of them have been obtained in experimental models and did not.
    [Show full text]