DOCSLIB.ORG

Greek and Latin Classics Iii

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Greek and Latin Classics Iii Blackwell rare books GREEK AND LATIN CLASSICS III Blackwell Rare Books 48-51 Broad Street, Oxford, OX1 3BQ Direct Telephone: +44 (0) 1865 333555 Switchboard: +44 (0) 1865 792792 Email: [email protected] Fax: +44 (0) 1865 794143 www.blackwell.co.uk/ rarebooks Our premises are in the main Blackwell bookstore at 48-51 Broad Street, one of the largest and best known in the world, housing over 200,000 new book titles, covering every subject, discipline and interest, as well as a large secondhand books department. There is lift access to each floor. The bookstore is in the centre of the city, opposite the Bodleian Library and Sheldonian Theatre, and close to several of the colleges and other university buildings, with on street parking close by. Oxford is at the centre of an excellent road and rail network, close to the London - Birmingham (M40) motorway and is served by a frequent train service from London (Paddington). Hours: Monday–Saturday 9am to 6pm. (Tuesday 9:30am to 6pm.) Purchases: We are always keen to purchase books, whether single works or in quantity, and will be pleased to make arrangements to view them. Auction commissions: We attend a number of auction sales and will be happy to execute commissions on your behalf. Blackwell online bookshop www.blackwell.co.uk Our extensive online catalogue of new books caters for every speciality, with the latest releases and editor’s recommendations. We have something for everyone. Select from our subject areas, reviews, highlights, promotions and more. Orders and correspondence should in every case be sent to our Broad Street address (all books subject to prior sale). Please mention Greek and Latin Classics Catalogue when ordering. Cover illustration: Item 25 1. Aeschylus. TragoediaeVII.[Geneva:]HenriciStephani.1557,FIRSTCOMPLETE EDITION,theEDITIOPRINCEPSofthe‘Agamemnon’,sometoningandspotting,lower cornertipoffirstfewleavesworn(esp.title),titlealittlecreasedfrombookplateon verso,pp.[viii],395,[3],4to,contemp.calf,expertlyrebackedpreservingoldlabel andendpapers,cornersrepaired,bookplateandstampofTrinityCollegeCambridge (‘sold’),good(Schreiber145;DibdinI237;MossI8) £2,750.00 The fourtheditionofAeschlyus,thefirstproducedbytheEstiennes,andthefirsttoprint thecompletetextoftheAgamemnon,ofwhichonlyasmallfractionhadpreviouslybeen printedduetoalacunainthemostimportantmanuscript,the11th-centuryMedicean codex.Theeditor,PietroVettori(‘Victorius’),bothrestoredthemissingversesand improvedthetextofthescholiausinga14th-centurycodex,andforthefirsttimehe distinguishestheAgamemnonfromtheChoirephoi,sinceallpreviouseditorshad consideredthefragmentspartofthefollowingplay.ThebookisprintedwiththeHenry Estienne’susualelegance,usingtwosizesofthegrecsduroi.‘Anexcellentandbeautiful edition...itisamuchmorevaluableimpressionthaneitherofitsprecursors...thisedition israreanddear’(Dibdin).‘Notwithstandingthegreatmeritsofthisedition’andthe profusepraisealreadyrecorded,Mossstillfeltthat‘itmeetsnotwiththeattentionit deserves’. 2. Aeschylus. TheTragediesofAeschylus translated.ByR.Potter.Norwich: PrintedbyJ.Crouse.1777,FIRSTEDITION ofthefirstcompleteEnglishtranslation, half-titleandinternalblanks(R4,Cc4, Q q3,Bbb3,&Lll3)discarded,light toning,somespottinginplaces,pp. [iii]-xxviii,[6],519,[1],4to,contemp. sprinkledcalf,boardswithagiltleaf rollborder,backstripwithfivegilt- milledraisedbands,redmoroccolabel insecondcompartment,theremainder infilledwithflower,leaf,andothertools, marbledendpapers,frontjointsplitting atbasebutstrong,rubbedandscratched atextremities,slightweartobackstrip ends,good(ESTCT87012) £600.00 ThistranslationbytheNorfolkclergymanRobertPottermarksthefirstcompleteEnglish- languageversionofthesurvivingplaysofAeschylus,whohadbeenlargelyneglectedin Englishuntilthatpoint(thefirstpublishedtranslationofanyindividualplayappeared onlyin1773).Potter’swork‘waspublishedtogreatacclaimin1777andbroughthim tothenoticeofLondonliterarysociety’(ODNB);aLondoneditionfollowedwithintwo yearsofthisfirstprinting,andPotter’stranslationswerestillbeingreprintedasastandard versionaslateas1938. 1 blackwell rare books 3. Anacreon. [Carmina.Greek:]HaitouAnakreontosodai.KaitatesSapphous,kaita touAlkaiouleipsana.Glasgow:ExcudebantR.&A.Foulis.1751,smalldampmarkto marginoftitle,alittlechippingtoedgeoffrontfreeendpaper,pp.[iv],75,[1],32mo (paper79x47mm),contemp.vellumboards,backstripinthreeplaincompartments, frontboardwithgiltmonogram,abitsoiled,fronthingecrackingandboardsalittle bowed,booklabel‘Nanhoron1935’andtwoearlyownershipinscriptions(J.Yates, H.H.EdwardsdePennant),good(Gaskell181;ESTCT85607) £350.00 Theregularpaperissue(somecopieswerealsoprintedonfourcoloursofsilk)ofthis miniatureeditionofAnacreonfromtheFoulisPress,producedtotheirusualattractive standards.AlsoincludedarefragmentsofSapphoandAlcaeus.Thiscopybearsthegilt monogramJYonthefrontboard,probablytheJ.Yateswhosignedthefrontendpaper, andwaslaterattheWelshestateofNanhoron. 4. Anacreon. Odaria.Praefixocommentarioquopoetaegenustradituretbibliotheca Anacreonteiaadumbratur.Parma:ExRegioTypographeio.1785,ONEOF50COPIES ONFINEPAPER(ofaneditionof310copies),engravedportraitontitleandvignette onsecondleaf,acoupleoffaintage-spots,pp.[iv],xciv,100,[2],4to,contemp.red straight-grainmorocco,boardswithagiltfilletborder,backstripdividedbyeight pairedraisedbands,athingreenmoroccobandbetweeneachpair,thesecondfull compartmentgilt-lettereddirect,theremainderinfilledwithgiltdots,diamonds, andothertools,bluewateredsilkendpapers,redmoroccoturn-ins,giltdentelles,the meresttouchrubbedatextremities,andonetinywormholetoeachjoint,preserved inabrownclothfolderinabrownclothslipcasebackedinbrownmorocco(thisabit rubbed),bookplatesofCharlesWhibley,HughMorristonDavies,and‘C.H.C.’,very good(Brooks287;MossI49;DibdinI265) £5,000.00 Item 4 2 GREEK AND LATIN CLASSICS ThefirstBodoniquartoeditionofAnacreon,followingonlyanoctavoof1784,anda lavishproduction,printedentirelyincapitals.Brooksstatesthat250copieswereprinted on‘blue’paper,50onfinepaper(likethisone),and5eachontwotypesofsuperfine paper.Thebindingmatchestheprintinginsumptuousness,withthebackstrippanels almostentirelyinfilledwithclosely-setgiltdots.TheformerownerCharlesWhibley (1859-1930)wasthejournalistandauthorwhorecommendedT.S.EliottoFaber&Faber. ThiscopywaslaterownedbyHughMorristonDavies(1879-1965),apioneeringsurgeon (called‘theDoyenofThoracicSurgery’)andacollectoroffinebindings,especiallythose oftheeighteenthcentury. ‘Thesecondeditionisaverybeautifulone’(Moss).‘Theeditionsof1785and1791are printedincapitalletters,andmoreelegantandexquisitelyfinishedproductionscannotbe conceived’(Dibdin). 5. Aurelius Antoninus (Marcus) TheThoughtsoftheEmperorMarcusAurelius Antoninus.InthetranslationofGeorgeLong:IllustratedaftertheWater-colour drawingsbyW.RussellFlint.PhilipLeeWarner,publishertotheMediciSociety. 1912,colourfrontispieceand11othercolourplates,twoleaveswithchipsfrom blankmargin,pp.lxxxvii,207,8vo,recenthalfbluemoroccobyAsprey&Co., boardsandbackstripruledingilt,secondcompartmentgilt-lettereddirect,marbled endpapers,a.e.g.,backstripsunned,verygood £50.00 6. Caesar (Gaius Julius) Hocvoluminecontinenturhaec.Commentariorumdebello GallicolibriVIII.Debellocivilipompeiano.LibriIIII.DebelloAlexandrino.Liber I.DebelloAfricano.LiberI.DebelloHispaniensi.LiberI.Venice:inaedibusAldi Item 6 3 blackwell rare books &AndreaeSoceri.1513,FIRSTALDINEEDITION,double-pagewoodcutmapcoloured byhand,fivefurtherfull-pagewoodcuts,lightspotting,partofthemapcolouring showingonreverse,ff.[xx],296,8vo,eighteenth-centurygreenmorocco,boards withagiltborderoflinkedcircles,backstripdividedbydoublegiltfillets,secondand thirdcompartmentsgilt-lettereddirect,topandbottominfilledwithachainpattern, a.e.g.,atouchrubbedatedges,backstripveryslightlysunned,armorialbookplateof W.H.Thompson,verygood(CNCE8147;DibdinI357) £5,000.00 ThefirstAldineeditionofCaesar,illustratedwithadouble-pagemapofFranceand fivewoodcutsdepictingfortifications,keyedtoexplanatorytext.TheworksofCaesar havealwaysbeenanimportantpartofLatinliterature,andformedthefirstexperience manymodernstudentshadreadingLatin(‘Galliaestomnisdivisa...’).Theywereequally popularintheearlysixteenthcentury:thiseditionwasalmostimmediatelycopiedby Giuntain1514,andasecondAldineappearedin1519,bothessentiallyreprintsofthis textandtheseillustrations(thoughthelatereditionsdidaddamapofSpain). Theeditor,GiovanniGiocondo,wasamanverymuchoftheRenaissance,beingan architect,ateacher,andaFranciscanpriestaswellasascholar:hedesignedthePalazzo delConsiglioinVeronaandthePontNotre-DameinParis(thelattermuchrebuilt, thoughGiocondo’sversionwasamongthelongest-lasting);heeditedVitruviusandCato theElder;amonghisstudentswastheyoungJ.C.Scaliger.Hisarchitecturalexperience– whichalsoincludedpartoftheprotectionofVenice’slagoons–contributesmuchtohis treatmentoffortificationshere. 7. Cicero. Opera.ExPetriVictoriicodicibusmaximaexpartedescripta,viriDocti etinrecensendiosauthorishuiusscriptiscauti&perdilentis...EiusdemVictorii explicationessuaruminCiceronemcastigationum.[5partsin2volumes].Paris: exofficinaRobertiStephani(Estienne).1538-39,6titleswithlargewoodcut printer’sdevices,woodcutinitials,substantialearlymanuscriptannotationson someleaves(largelyfaded-perhapsverygentlywashed,andoccasionallyshaved), ownershipinscriptionsonsometitlesof‘KennethusMurchison’,aninscription excisedfromuppercorneroffirsttitleineachvol.,brownedandsoiledinplaces, afewoldedgerepairs,pp. [xvi],288,640,[6];416,450,[2],158,[100],folio, modern darkcalf,boardspanelledinblind,spineswithsixraisedbands,red andgreenlettering-pieces,good (Renouardp.48;AdamsC1640;Ebert4255; SchweigerII103;MossI291) £2,000.00 TheEstiennefolioeditionoftheworksofCicero,and‘anelegantlyexecutededition’
Load more

Recommended publications
  • Lewis, Jenny. 2021. Translating Epic from an Unfamiliar Language: Gilgamesh Retold
    Lewis, Jenny. 2021. Translating Epic from an Unfamiliar Language: Gilgamesh Retold. Doctoral thesis, Goldsmiths, University of London [Thesis] https://research.gold.ac.uk/id/eprint/30429/ The version presented here may differ from the published, performed or presented work. Please go to the persistent GRO record above for more information. If you believe that any material held in the repository infringes copyright law, please contact the Repository Team at Goldsmiths, University of London via the following email address: [email protected]. The item will be removed from the repository while any claim is being investigated. For more information, please contact the GRO team: [email protected] Complete thesis: Jenny Lewis, March 2021. 1 Translating Epic from an Unfamiliar Language: Gilgamesh Retold Jenny Lewis Department of English and Comparative Literature Goldsmiths, University of London. Submitted for the PhD in Creative Writing, March 2021 Complete thesis: Jenny Lewis, March 2021. 2 Declaration of Authorship I declare that the work presented in this PhD submission is entirely my own. Signed: Date: 31st March 2021 Complete thesis: Jenny Lewis, March 2021. 3 Acknowledgements Firstly, huge thanks to my supervisors Stephen Knight and Isobel Hurst for helping me to bring Gilgamesh Retold and ‘Translating Epic from an Unfamiliar Language’ into being. I also thank my publisher, Michael Schmidt who published Gilgamesh Retold as a Carcanet Classic in 2018, and the first ever Carcanet Audiobook in 2019. I’m grateful to Arts Council England for Grants for the Arts awards for my ‘Writing Mesopotamia’ collaboration with the exiled Iraqi poet, Adnan Al-Sayegh (aimed at strengthening ties between English and Arabic-speaking communities) to translate into Arabic, dramatise and perform extracts from Gilgamesh Retold and test them widely on the public.
    [Show full text]
  • Las Primacías Eclesiásticas En Hispania Durante El Siglo IV
    POLIS. Revista de ideas y formas políticas de la Antigüedad Clásica 10, 1998, pp. 269-285. LAS PRIMACÍAS ECLESIÁSTICAS EN HZSPA2VIA DURANTE EL SIGLO IV* Josep 'VUella Masana Universidad de Barcelona La historia del cristianismo antiguo está orgánicamente vinciolada a la del Imperio romano, en el que nace, se desarrolla y se convierte en institución. Entre ambos se ftagua una relación que, con el paso de los años, se hace cada vez más unívoca, recíproca. Con el fracaso del régimen instaurado por Diocleciano y el apoyo al cristianismo por parte de Constantino 1, tiene lugar el paso del Imperio pagano al Imperio cristiano. Lo más novedoso no es la finalización de las persecuciones —que ya hacía años que no se producían en muchas zonas— sino el hecho de que se legisle a fevor de los cristianos — sobre todo de los eclesiásticos— y que prácticas cristianas de laiga tradición alcancen categoría de ley^ De modo parecido sucedió con * Este estudio se ha realizado en el marco de los proyectos y grupos de investigación PB97- 0891 y 1997SGR 357. El presente texto corresponde a nuestra qxjrtación al coloquio internacional dedicado a "Paciano y la Hispania cristiana del siglo IV", celebrado en Barcelona del 8 al 9 de marzo de 1996 y en Lyón del 28 al 30 de octubre del mismo año. 269 Josep Vilella Masana disposiciones de orden organizativo que el episcopado establece al convertirse en un estamento público y privilegiado. Sería éste el caso de algunos aspectos que, en el 325, re¿amenta el concilio de Nicea^. En Nicea se establece la agrupación de los obispos de una misma provincia bajo la presidencia del obispo de la capital provincial, denominado metropolitano.
    [Show full text]
  • Farming in Mediterranean France and Rural Settlement in The
    Farming in mediterranean France and rural settlement in the Late Roman and early Medieval periods : the contribution from archaeology and environmental sciences in the last twenty years Aline Durand, Philippe Leveau To cite this version: Aline Durand, Philippe Leveau. Farming in mediterranean France and rural settlement in the Late Roman and early Medieval periods : the contribution from archaeology and environmental sciences in the last twenty years. Miquel BARCELÓ; François SIGAUT. The Making of Feudal Agricultures ?, BRILL, pp.177-253, 2004, The transformation of the Roman World, 90-04-11722-9. halshs-01052529 HAL Id: halshs-01052529 https://halshs.archives-ouvertes.fr/halshs-01052529 Submitted on 28 Jul 2014 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Article published in BARCELÓ M. et SIGAUT F., (eds.), The Making of Feudal Agricultures ?, Boston-Leiden, Brill editor, coll. The transformation of the Roman World, vol. 14, 2004, p. 177-253. BARCELÓ M. et SIGAUT F., (eds.), The Making of Feudal Agricultures ?, Boston-Leiden, Brill editor, coll. The transformation of the Roman World, vol. 14, 2004, p. 177-253. Aline DURAND ([email protected]) Philippe LEVEAU ([email protected]) FARMING IN MEDITERRANEAN FRANCE AND RURAL SETTLEMENT IN THE LATE ROMAN AND EARLY MEDIEVAL PERIODS: THE CONTRIBUTION FROM ARCHAEOLOGY AND ENVIRONMENTAL SCIENCES IN THE LAST TWENTY YEARS Introduction From the end of the 19th C, French historiography has studied the period spanning the 5th - 10th C essentially along political and institutional lines.
    [Show full text]
  • Calendar of Roman Events
    Introduction Steve Worboys and I began this calendar in 1980 or 1981 when we discovered that the exact dates of many events survive from Roman antiquity, the most famous being the ides of March murder of Caesar. Flipping through a few books on Roman history revealed a handful of dates, and we believed that to fill every day of the year would certainly be impossible. From 1981 until 1989 I kept the calendar, adding dates as I ran across them. In 1989 I typed the list into the computer and we began again to plunder books and journals for dates, this time recording sources. Since then I have worked and reworked the Calendar, revising old entries and adding many, many more. The Roman Calendar The calendar was reformed twice, once by Caesar in 46 BC and later by Augustus in 8 BC. Each of these reforms is described in A. K. Michels’ book The Calendar of the Roman Republic. In an ordinary pre-Julian year, the number of days in each month was as follows: 29 January 31 May 29 September 28 February 29 June 31 October 31 March 31 Quintilis (July) 29 November 29 April 29 Sextilis (August) 29 December. The Romans did not number the days of the months consecutively. They reckoned backwards from three fixed points: The kalends, the nones, and the ides. The kalends is the first day of the month. For months with 31 days the nones fall on the 7th and the ides the 15th. For other months the nones fall on the 5th and the ides on the 13th.
    [Show full text]
  • "Ego, Scriptor Cantilenae": the Cantos and Ezra Pound
    University of Northern Iowa UNI ScholarWorks Dissertations and Theses @ UNI Student Work 1991 "Ego, scriptor cantilenae": The Cantos and Ezra Pound Steven R. Gulick University of Northern Iowa Let us know how access to this document benefits ouy Copyright ©1991 Steven R. Gulick Follow this and additional works at: https://scholarworks.uni.edu/etd Part of the Literature in English, North America Commons Recommended Citation Gulick, Steven R., ""Ego, scriptor cantilenae": The Cantos and Ezra Pound" (1991). Dissertations and Theses @ UNI. 753. https://scholarworks.uni.edu/etd/753 This Open Access Thesis is brought to you for free and open access by the Student Work at UNI ScholarWorks. It has been accepted for inclusion in Dissertations and Theses @ UNI by an authorized administrator of UNI ScholarWorks. For more information, please contact [email protected]. "EGO, SCRIPTOR CANTILENAE": THE CANTOS AND EZRA POUND An Abstract of a Thesis Submitted in Fulfillment of the Requirements for the Degree Master of Philosophy Steven R. Gulick University of Northern Iowa August 1991 ABSTRACT Can poetry "make new" the world? Ezra Pound thought so. In "Cantico del Sole" he said: "The thought of what America would be like/ If the Classics had a wide circulation/ Troubles me in my sleep" (Personae 183). He came to write an 815 page poem called The Cantos in which he presents "fragments" drawn from the literature and documents of the past in an attempt to build a new world, "a paradiso terreste" (The Cantos 802). This may be seen as either a noble gesture or sheer egotism. Pound once called The Cantos the "tale of the tribe" (Guide to Kulchur 194), and I believe this is so, particularly if one associates this statement with Allen Ginsberg's concerning The Cantos as a model of a mind, "like all our minds" (Ginsberg 14-16).
    [Show full text]
  • Ezra Pound's Odyssey
    SYMBOLAE PHILOLOGORUM POSNANIENSIUM GRAECAE ET LATINAE XXVII/2 • 2017 pp. 103–112. ISSN 0302-7384 dOI: 10.14746/sppgl.2017.XXVII.2.8 Gerson SchadE Frei Universität Berlin The son of Homer – Ezra Pound’S odyssey abstraCt. Schade Gerson, The Son of Homer – Ezra Pound’s Odyssey (Syn Homera – ‘Odyseja’ Ezry Pounda). Ezra Pound was obsessed with Ulysses. He identified with him throughout his Cantos, a work Pound opens by stealthily reworking a passage from an obscure 16th-century Latin translation of Homer’s Odyssey. The son of Homer Pound, Ezra led a Ulyssean life in various senses – leaving his home country only to return after his adventures, simulating madness, telling lies. He shares the lying and the way of life with his contemporary Lawrence of Arabia. Both translated the Odyssey and both, like Ulysses, lost all their friends (or alienated nearly everyone). All three were much despised for their habits, Ulysses in general by the Greek classical tragedians, Pound in particular by George Orwell, and Lawrence by practically everybody. keywords: multi-layered intertextuality; Alfred Tennyson; Andreas divus Justinopolitanus; Palamedes. I don’t know that one can read any trans. of the Odyssey. Perhaps you could read book XI. I have tried an adaptation in the ‘Seafarer’ metre, or something like it, but I don’t expect anyone to recognize the source very quickly. Ezra Pound, Letter to Iris Barry, London July 1916 (Paige 1951: 137) Prologue “Pound seems to have plumped definitely for Fascism, at any rate the Italian variety” George Orwell stated in 1940.1 And Pound was not alone.
    [Show full text]
  • Urbanisme En De Koloniesteden Van Gallia N Narbonensis
    Alfonso Medinilla Urbanisme en de koloniesteden van Gallia Narbonensis Een analyse van het stedelijk weefsel op basis van de veteranenkolonies: Narbonne, Arles, Fréjus, Orange en Béziers Scriptie voorgelegd tot het bekomen van de graad licentiaat in de archeologie Promotor: Prof. Dr. Frank Vermeulen Universiteit Gent, faculteit letteren en wijsbegeerte Academiejaar 2006 – 2007 Alfonso Medinilla 2de licentie Archeologie Urbanisme en de koloniesteden van Gallia Narbonensis Een analyse van het stedelijk weefsel op basis van de veteranenkolonies: Narbonne, Arles, Fréjus, Orange en Béziers Scriptie voorgelegd tot het bekomen van de graad licentiaat in de archeologie Promotor: Prof. Dr. Frank Vermeulen Universiteit Gent, faculteit letteren en wijsbegeerte Academiejaar 2006 – 2007 1 Dankwoord1 Mijn dank gaat uit naar mijn promotor Professor Frank Vermeulen, voor de begeleiding bij het uitwerken van het concept van deze scriptie, maar ook naar Dr. Patrick Monsieur voor de last-minute raadgevingen in Porto Recanati. Dieter De Meulemeester, een taalwetenschapper van formaat, dank ik voor de vele verbeteringen die hij tot het laatste moment is blijven doorgeven, en mijn moeder Gerd Wille voor de praktische ondersteuning. Mijn oneindige dank gaat tenslotte uit naar mijn vriendin Nel de Mûelenaere, die heel het wordingsproces van deze eindverhandeling van dichtbij heeft moeten meemaken. 1 Afbeelding voorpagina: op basis van Talbert R.J.A. (ed.), Barrington Atlas of the Greek en Roman World, Princeton University Press, Princeton, 2000, kaart 15. 2
    [Show full text]
  • Homer and Slovene Culture 1
    HOMER AND SLOVENE CULTURE 1. The beginnings of Homer’s influence upon Slovene artistic creativity are veiled in the mists of illiteracy, spun in A net of invisible, scarcely discernible threads, which are not likely ever to be disentangled or definitely identified. These traces can be felt in many Slovene folK songs where we notice ex­ pressions, thoughts and images which are at times surprisingly similar to the Homeric ones. So for instance in A folk song St. Scholastica, who is in mortal danger froM the Turks, is suddenly covered with A thick mist and hosts of angels who come to deliver her from her enemies.1 This reminds us of Ho­ meric scenes in which Apollo saves his protégé Hector by wrapping him in A thick haze, or of Poseidon saving Aeneas in A similar way. The folK wisdom which runs in Slovene proverbs, shows similar traits to the Homeric sayings.2 Moreover, we come across real Homeric motifs in Slovene folK tradition, in most cases, of course, in A Christianized version, e.g. the motif of Polyphe­ mus,3 Psychostasis,4 Gigantomachy.5 1. Cf. Karol Štrekelj’s collection of Slovene folk songs (Slovenske narodne pesmi, Ljub­ ljana 1895-1923) 38, 28-32. 2. Cf. Miroslav Žakelj’s article, published in the Reports of the Rijeka Secondary School (Izvestje gimnazije Reka 1868, 3-25). It is mainly the Croatian proverbs that Žakelj com­ pares with Homer, but these are on the whole identical with the Slovene ones (Žakelj was A Slovene by birth and thus of course knew the Slovene proverbs better than the Croatian ones).
    [Show full text]
  • (NE MEDITERRANEAN) (Two Volumes) SEID
    1 MICROPALAEONTOLOGICAL STUDIES OF RECENT SEDIMENTS FROM THE CILICIA BASIN (N. E. MEDITERRANEAN) (Two Volumes) SEID NOOREDDIN ALAVI, M.Sc. Thesis Submitted for the Degree Doctor of Philosophy of the University of London June, 1980 Department of Geology, Royal School of Mines, Prince Consort Road, London, S.W.7. 2 ABSTRACT The paraecology of dead assemblages of Foraminifera, Ostracoda and planktic molluscs (Pteropoda and Heteropoda) in 142 grab and core- top samples from the surface sediments of the Cilician Basin, recovered at 128 oceanographic stations ranging from a depth of 10 to about 2200m, have been studied. Four samples from the bottom of the Akyatan Lagoon and seven from parts of a piston core from station 1073 were also analysed. Altogether 405 species and varieties of Foraminifera (22 of planktic) and 50 genera of ostracodes have been identified. A list of identified pteropods is also given. Twenty five species of benthic Foraminifera belonging to 23 genera are left in open nomenclature. One ostracod species, tentatively assigned to Phlyctenophora sp., is believed •to be new. Most of the Foraminifera and some ostracodes are illustrated by S.E.M. photographs. Faunal abundance and diversity of the benthic Foraminifera and the abundance of ostracodes and planktic molluscs are mapped and their variation is discussed in terms of the productivity of the surface waters and bottom sediments and the rate of sedimentation. It Is concluded that the planktic/benthic foraminiferal ratio is a more reliable environmental indicator than Ostracoda/benthic Foraminifera ratio. The faunal poverty of the deep-water environment in the basin is discussed in the context of the geological and palaeo-oceanographical history of the E.
    [Show full text]
  • Ancient Perspectives: Maps and Their Place in Mesopotamia, Egypt
    seven Putting the World in Order: Mapping in Roman Texts Benet Salway The scanty survival of genuinely contemporary cartographic artifacts from Roman antiquity thrusts the simple textual description of geography into the limelight. While there is no denying the existence and public display of the grand carto- graphic visualizations discussed in the previous chapter, the dearth of surviving maps and diagrams frequently forces us to rely upon the examination of purely textual sources for evidence of “worldview,” whether explicitly expressed by them or embedded in their structure. Indeed, the paucity of direct evidence for visual mapping has led some modern scholars to downplay the role of graphic illustra- tion in the description of geographic information by the Romans. Such a view is encouraged by the prominence of itinerary lists in the surviving literature, giving rise to the idea that the Romans’ perception of the world was primarily linear, organized as so-called hodological space. However, the use of itineraries to record or present routes for travel need not be incompatible with the consultation of maps, map- based thinking, or general “map consciousness” in other contexts. This chapter sets out to examine a wide range of texts from Roman antiquity (in Greek and Latin) both for signs of map consciousness and for evidence of its nature. Specifi cally, the descriptive logic of the texts will be examined for evidence of the sort of picture of the world that the educated Roman carried around in his or her head. For example, on what was it centered? In which direction was it orientated? Was a cartographic image of the world even common at all? Obvi- ously the answers to these questions will have been diff erent at diff erent times and locations across Roman history.
    [Show full text]
  • Translator”; They Ments: Emerson’S Poems,” Cambridge Companion to Generate Future Incarnations: “I Want Ovid
    © Copyright, Princeton University Press. No part of this book may be distributed, posted, or reproduced in any form by digital or mechanical means without prior written permission of the publisher. 1456 TRANSLATION Yoder, Emerson and the Orphic Poet in America (); the iambs and trochees of anglophone verse would be Th e Transcendentalists, ed. J. Myerson ()—esp. unrecognizable to those who fi rst used the terms. essays by R. E. Burkholder and Myerson (Emerson), Th e form Keats employs, moreover, likewise derives F. C. Dahlstrand (Alcott), F. B. Dedmond (Chan- from foreign sources, as its Italianate name suggests: ning), R. N. Hudspeth (Fuller), M. Meyer (Th oreau), without the th-c. Petrarchan sonetto , there would D. Robinson (Cranch and Very); L. Buell, “Th e be no th-c. Eng. *sonnet celebrating a th-c. trans. American Transcendentalist Poets,” Columbia History from the ancient Gr. Indeed, the plethora of prosodic of American Poetry , ed. J. Parini (); Encyclopedia terms, in Eng. and other langs., that owe their existence of American Poetry: Th e Nineteenth Century , ed. E. L. to trans., ancient and mod., points to the constant Haralson ()—esp. H. R. Deese (Very), L. Hon- “crossbreeding and hybridization” (Osip Mandelstam) aker (Cranch), P. T. Kane (Emerson), J. Steele (Fuller), that shape the Western poetic trad. Trans. not only sus- K. Walter (Channing), E. H. Witherell (Th oreau), G. R. tain the cultural “afterlife” of poetic works, as Walter Woodall (Alcott); S. Morris, “ ‘Metre-Making’ Argu- Benjamin states in “Th e Task of the Translator”; they ments: Emerson’s Poems,” Cambridge Companion to generate future incarnations: “I want Ovid .
    [Show full text]
  • From Romans to Goths and Franks
    University of Texas Rio Grande Valley ScholarWorks @ UTRGV History Faculty Publications and Presentations College of Liberal Arts 2017 Shifting Ethnic Identities in Spain and Gaul, 500-700: From Romans to Goths and Franks Erica Buchberger The University of Texas Rio Grande Valley, [email protected] Follow this and additional works at: https://scholarworks.utrgv.edu/hist_fac Part of the History Commons, and the Medieval Studies Commons Recommended Citation Buchberger, E. (2017). Shifting Ethnic Identities in Spain and Gaul, 500–700: From Romans to Goths and Franks. Amsterdam: Amsterdam University Press. doi:10.2307/j.ctt1pk3jrb This Book is brought to you for free and open access by the College of Liberal Arts at ScholarWorks @ UTRGV. It has been accepted for inclusion in History Faculty Publications and Presentations by an authorized administrator of ScholarWorks @ UTRGV. For more information, please contact [email protected], [email protected]. Shifting Ethnic Identities in Spain and Gaul, 500-700: From Romans to Goths and Franks Erica Buchberger 1 Contents Acknowledgements ......................................................................................................................... 5 Introduction .................................................................................................................................... 7 Scholarly Tradition ...................................................................................................................... 8 Applying This Method ..............................................................................................................
    [Show full text]