DOCSLIB.ORG

2014-2015 Catalog, Part 1

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
2014-2015 Catalog, Part 1 SunBody Hats 1-800-310-7093 2014-2015 Catalog www.sunbody.com Let’s Have Fun! 1-713-861-5133 Page 2 Hi! Whats so special about palm-leaf hats? In October 2013 we passed a mile stone: They’re tough - rain or shine: WE SOLD OUR MILLIONTH HAT! 6HZQEUDLGSDOPOHDIKDWVDUHDERXWWKHWRXJKHVWKDWV\RX¶OO¿QG The overlapping layers of palm braid form an almost impenetrable “FUN” and “PRACTICAL” are two of the biggest factors VXQEORFN$QGZKHQWKH\JHWZHWWKH\VWLIIHQDQGNHHSWKHLUVKDSH in our success. Being able to get the hats wet and shape PDNLQJWKHPJUHDWLQWKHUDLQRUWKHULYHU them yourself, as a dealer or an end user, is an endless source of entertainment. You can wet ‘m and shape ‘m: 7KH\DUHHDVLO\UHVKDSHGWRRZLWKSODLQZDWHUQRVWHDPLVUH- And the fact that they stand up to the beating they get TXLUHG<RXFDQXVHDVSUD\ERWWOHKROGLWXQGHUWKHIDXFHWRUGLSLW in the rough and tumble of outdoor life,combined with a LQDEXFNHW7KH\FDQEHVKDSHGE\KDQGDQG\RXFDQPRGLI\\RXU reasonable price, makes them the most practical hats around. SUHVKDSHGKDWWR\RXUGHVLUHGORRN The 125 or so hats you see in this catalog are just a You can crush ’m and pop ’m back out to shape: sampling of the endless possibilities. Starting with the 31 $KRUVHFDQVWHSRQRQHDQGLIWKHKRRIGRHVQ¶WFXWFRPSOHWHO\ unshaped hat bodies we stock, we can shape and trim the WKURXJK\RXFDQSRSLWEDFNRXWDQGNHHSZHDULQJLW3DFNLQJWKHP hats like you want them.We can bind the edges in many ÀDWLQDVXLWFDVHLVSRVVLEOHEXWZLOOUHTXLUHVRPHUHVKDSLQJDQGLV different colors and patterns, eyelet in different colors, QRWUHFRPPHQGHG shape in different ways, use a variety of different hat bands and choose from several different stampede strings (chin straps). Five Different Hat Qualities: (Shown actual size) 2QRXUZHEVLWH\RXZLOOÀQGHYHQPRUHKDWVDQGWULPPLQJ possibilities, along with information on how the hats are made, getting the right size and links to the long history of palm leaf hat making. Register and we’ll send you information on special sales and new hats. A. Guatemalan Economy Palms: VWUDQGVRIEUDLGSHULQFK8VHG You can even order online if you wish. We’ve made it easier RQWKHNLG¶VRQHVL]HKDWVDQGWKHHFRQRP\SDOPV SDJHV for wholesale buyers with a table-style order form. 1RVWLIIHQHUDGGHG “We’re the leader in palm leaf hats” is not just a slogan: B. Guatemalan Standard Palms:VWUDQGVRIEUDLGSHULQFK2XU 30 years of experience working directly with hatmakers PRVWSRSXODUKDWV1RVWLIIHQHUVDGGHGVKDSHGE\KDQGRQZRRGHQ in Guatemala and Mexico that sew them together and PROGV(DVLO\UHVKDSHGXVLQJZDWHU1RVWHDPQHFHVVDU\0D\VKULQN DOLWWOHLIGULHGLQWKHKHDW&RQIRUPWRZHDUHU¶VKHDG5HSHDWHG GRLQJWKHÀQLVKLQJLQRXUVKRSLQ+RXVWRQJLYHVXV ZDVKLQJVZLOOUHVXOWLQDVRIWHUKDW XQULYDOHGÁH[LELOLW\LQVXSSO\LQJ\RXZLWKWKHKDWV\RXZDQW C. Guatemalan Fine Palms: VWUDQGVRIEUDLGSHULQFK/LNH We have: DOORIRXU*XDWHPDODQSDOPVWKH\FDQEHUHVKDSHGZLWKSODLQZDWHU DQGDUHÀH[LEOH7KHSDOPLVEOHDFKHGVRWKDWQRZKLWHQHULVQHHGHG The Most Styles: Guatemalan and Mexican palm leaf +DWVDUHDYDLODEOHKDQGFUHDVHG ZLWKFROGZDWHURQZRRGHQPROGV hats. Exclusive dealer of the Guatemalan Fine Palms RURSHQFURZQ (see right). We have 31 open crown hats. The Most Options: Creasing, eyeletting, edge-binding, brim lacing, sweatbands, accessories. The Most Sizes: Miniatures for dolls and dogs, sizes 5 to 6-1/4 for babies and toddlers, children’s one- D. VL]HÀWVmost, and up to size 8 in our adult hats. We can ÀWDQ\ERG\ D. Guatemalan Oak-Colored Palms: VWUDQGVRIEUDLGSHULQFK 7KHSDOPLVERLOHGIRUWKUHHKRXUVSULRUWREUDLGLQJ7KLVWXUQVLWD We invite you to have fun with us by selling our hats. And OLJKWEURZQFRORU1RG\HRUVWDLQLVXVHG7KH\DUHVRIWHUDQGPRUH by all means, give us you ideas for new hats, new ways we ÀH[LEOHWKDQWKHVWDQGDUGSDOPV(DVLO\UHVKDSHG can have fun together. E. Mexican Fine Palms: VWUDQGVRIEUDLGLQFKJLYLQJWKHKDWVD YHU\¿QHDSSHDUDQFHQLFHGUHVVKDWV6WLIIHQHGDQGZKLWHQHGZLWKD Jimmy Pryor, President FKDON\OLTXLG3UHVVHGLQKHDWHGPROGV+DUGWRUHVKDSH:DWHUZLOO wash out the stiffener and leave the hat with a rougher and darker DSSHDUDQFHEXWVWLOOYHU\IXQFWLRQDO 1-800-310-7093 SunBody Hats How Guatemalan Palm www.sunbody.com 2014-2015 Catalog Leaf Hats Are Made 1-713-861-5133 Page 3 The palm for Guatemalan palm leaf hats is harvested from palm palm shoots from young trees. When the trees are older, the new trees on the southern coast of Guatemala where they grow wild leaves are too high for easy harvesting. The harvesters return to near the mangrove swamps. Independent harvesters paddle out the beach where they sell their day’s harvest to palm dealers. in their boats before the break of day to cut slender, un-opened The dealers open the fronds and tear off the outer edges of the The dried palm is trucked to Quiche in the Western highlands. It is leaves which are dark green. The inner leaf, untouched by sun, is bleached and sold in the marketplace on Thursdays and Sundays. a pale yellow color. The leaves are opened up like fans and spread The buyers, peasant women, take the palm home and braid it into on the beach to dry and be sun bleached. DÀDWVHYHQVWUDQGSODLW7KH\UHWXUQWRPDUNHWWRVHOOWKHEUDLG Table of Contents Open crown, unshaped hats: Pages 4-5> Riatas and Elkos: Pages 6-7> Western Classics: Pages 8-11> Kids, Baby, Miniatures: Page 12-13> Mexican Pressed Palms: Pages 14-15> Gus and Old West: Pages 16-17> Laced-Brims: Pages 18-20> Bound-Edge Gus: Page 21> Fun & Funky: Pages 22-23> Fashion Favorites: 24-26> Hatbands and Accessories: Pages 27-29> The hatmakers, mostly men, buy the braid, take it home, and sew it into hats. They begin with the top of the crown and sew Palm River Economy Hats: Page 30> in a spiral, overlapping the braid as they go. For more pictures Photos of Hatmakers & Sun Bodies: Page 31> and a more detailed account of this story, visit our website: www.SunBody.com. SunBody Hats 1-800-310-7093 2014-2015 Catalog www.sunbody.com Shaping Palm Page 4 1-713-861-5133 Leaf Hats You, too, can shape a palm-leaf hat! Try it! You’ll be surprised at how much fun it is. 1. Get it wet. Dealers Who Shape Hats 'XQNLQJLQDWXEZRUNVEHVW Just dip it in and pull it right EDFNRXW'RQ¶WVRDNLW7KDWZLOO Sell More! wash the natural starch out and Shaping palm-leaf hats always attracts a crowd. PDNHLWVRIW Dunk a palm-leaf hat into a bucket of water and watch people VWRSLQWKHLUWUDFNV:DWFKWKHDZHDQGDPD]HPHQWDV\RXSOXFN $IWHU\RXGXQNLWOHWWKHZDWHU WKHGULSSLQJKDWIURPWKHEXFNHWDQGEHJLQWRVKDSHLW3HRSOHDUH VRDNLQWRWKHSDOP¿EHU:KHQ DOZD\VGUDZQWRDFWLRQDQGDJRRGVKRZ2XUEHVWFXVWRPHUVDUH WKHKDWLVZHWLWZLOOEHKDUGDQG WKRVHWKDWVKDSHSDOPOHDIKDWVIRUWKHLUFXVWRPHUV VWLII%XWWKDW¶VDOVRWKHWLPH\RX FDQVKDSHLW 2. Shape the crown. 7RPDNHDFDWWOHPDQXVHWKHVLGH of your hand to make a crease in WKHWRSRIWKHKDW8VHWKHVPDOO rectangle of palm at the very top of the crown and the small seam in the brim that marks the middle RIWKHEDFNDVJXLGHV 7RDFKLHYHV\PPHWU\LWVRPH- times helps to look at the hat IURPWKHERWWRP 3. Shape the brim. 8VLQJERWKKDQGVIROGWKHVLGHV RIWKHEULPXS7U\LWE\ORRN- ing at the hat from the front and the back to see what works best IRU\RX SunBody’s Hats Earn 'RQ¶WEHDIUDLGWRH[SHULPHQW Highest Protection Rating ,IWKHKDWLVZHW\RXZRQ¶W KXUWLW $QLQGHSHQGHQWODERUDWRU\KDVFHUWL¿HGWKDW$//RI6XQ%RG\¶V SDOPOHDIKDWVERWK*XDWHPDODQDQG0H[LFDQEORFNRI Just get your hat wet and play KDUPIXOXOWUDYLROHQW 89 VXQOLJKWDQGDUHFHUWL¿HGWRXVHWKH ZLWKLW<RX¶OOEHVXUSULVHGDW highest protective rating of UPF 50 KRZPXFKIXQLWLV 2XUKDWVEORFNERWK89$ZKLFKFDXVHVVXQEXUQDQG89% 7RWU\DQHZVKDSH\RXFDQSXVKWKHFURZQEDFNRXWWRDURXQGHGVKDSHDQG ZKLFKFDXVHVVNLQFDQFHU)RUPRUHLQIRUPDWLRQYLVLWRXUZHEVLWH ÀDWWHQWKHEULPDJDLQVWDWDEOHWRS:KHQWKHKDWGULHVLWZLOOUHPHPEHUWKH ZZZVXQERG\FRP VKDSHLWKDVDQGSRSEDFNRXWWRWKDWVKDSHLILWJHWVFUXVKHG 1-800-310-7093 SunBody Hats www.sunbody.com 2014-2015 Catalog Open Crown! 1-713-861-5133 Page 5 31 Different Hat Bodies -7 different brim widths -6 crown heights -4 qualities and price levels - Optional Eyeletting - Optional Edge-binding (many colors) - Endless possibilities. 1/3 of all the hats we sell are OPEN CROWN! ECONOMY Guatemalan Palms (Five to Six strands of braid per inch.) hg4a-eco 4" Brim, 5-1/4" Crown (see p. 30) hg5a-eco 5” Brim, 5-1/4” Crown (not shown) STANDARD Guatemalan Palms (Seven strands of braid per inch.) KJE %DE\+DWVVL]HVWR¿WPRQWKVWRPRQWKVEULP and crown dimensions proportionate to hat size. See price list hg25-oak 2-1/2" brim, 5-1/4" crown, oak-colored hg3 3" Brim, 5-1/2" Crown hg35 3-1/2" Brim, 5-3/4" Crown hg35aw 3-1/2” Brim, 5-1/4” Crown, wire in brim (not shown) hge 4" Brim, 4" Vented Crown (Espanola, see p.26 ) hg4t 4" Brim, Topless (no crown) hg4a 4" Brim, 5-1/4" Crown hg4a-oak 4" Brim, 5-1/4 crown, oak-colored (see p. 10) hg4ap 4" Brim Alligator Palm (Open Crown, not shown) hg4aw 4" Brim, 5-1/4" Crown, wire in brim (not shown) hg4b 4" Brim, 5-3/4" Crown hg45 4-1/2" Brim, 5-1/2" Crown (not shown) hgv 4" Brim, 5-3/4" Vented Crown hg5x4 5" Brim, 4" Crown hg5a 5" Brim, 5-1/4" Crown hg5b 5" Brim, 5-3/4" Crown hg5b-oak 5" Brim, 5-3/4" Crown, Oak-colored (not shown) hg5c 5" Brim, 6-1/2" Crown hg5v 5" Brim, 5-1/2" Vented Crown KJÀDW %ULP&URZQ VL]HRQO\QRWVKRZQ hg6a 6" Brim, 5-1/4" Crown hg6b 6" Brim, 5-3/4" Crown hg8b 8" Brim w/roll, 6" Crown FINE Guatemalan Palms Available ONLY from SunBody Hats! (11 strands of braid per inch.) hg2.5f 2-1/2" Brim, 5-1/2" Crown (not shown) hg3f 3" Brim, 5-1/2" Crown (not shown) hg35f 3-1/2" Brim, 5-3/4" Crown (not shown) hg4f 4" Brim, 5-1/2" Crown hg5af 5" Brim, 5-1/2" Crown EYELETTING & EDGE-BINDING We’ll add ventilation or stampede string eyelets to any hat. We will also bind the edge and make a matching hatband for any hat. Many colors to choose from. See page 27 for eyeletting and color
Load more

Recommended publications
  • C H R I S T Y &
    C h r i s t y & C ooC Since 1773 History and Legacy by Irra K With special thanks to The Stockport library and hat museum FamilyFamily Six reigns of Royals, and Eight generations of the Christy family have forged the brand of Christys London since it’s foundation by Miller Christy in 1773, 237 years ago Following his apprenticeship to a Hatter in Edinburgh, Miller Christy created a company that would survive for generations, outliving thousands of hat makers across the former British Empire: by 1864 for example there were 53 hatting firms in Stockport alone. Throughout hundreds of years, the factory was still managed by direct descendants of the founder of the Firm ValuesValues 1919 Christys readily registered their own The Christy Collection in Stockport is appreciation testament to the influence the company of workers’ had. At its height, it employed 3000 excellent local people leaving a valuable legacy service < - During World War II, hats were not rationed in order to boost morale, and Christys supported the effort within their family-run company, effectively running it like an extended family Celebrating Victory as well as mourning the fallen at the -> end of World War I Trade MarksTrade Marks The Stockport Collection With business of Christy Papers includes a expanding to 500 page booklet detailing foreign lands, trade marks registered safeguarding around the world at the the insignia in height of the British Empire. all it’s forms These involve registering the full name, letters 'C', it’s became vital – insignia, shape, and colours as we shall see In the early days, < - several variations - > of company marks and insignia were circulated, later consolidating into the Christy crown and heraldry which is now recognised the world over Trade Marks iiiiTrade In many territories, Trade Marks were either disputed or had to be re-registered.
    [Show full text]
  • Accat2013.Pdf
    Allens Crowns Tiaras A103 1 1/2" Tall A107 1 3/8" Tall A113 1 1/2" Tall Little Princess Tiara* Small Loop Tiara Princess Tiara* A122 1 5/8" Tall A123 2" Tall A133 1 1/4" Tall Small Heart Tiara Royal Princess Tiara* Looping Tiara A162 2" Tall A350 2" Tall AA240 2 1/2" Tall Fleur Di Lis Mardi Gras Tiara* Spring Tiara† ** Interlocking Loop Tiara B102 1 1/2" Tall B110 1 3/8" Tall B120 1 1/2" Tall Loop Tiara Curls & Loop Tiara Loop Tiara* ** Made from cast metal. † Jewel insert available in multiple colors. * Made from cast metal, capped with genuine Austrian rhinestone crystal by Swarovski™. 2 Allens Crowns B149 2" Tall C100 1 1/2" Tall C102 1 5/8" Tall Valentine's Day Tiara* Little Aztec Tiara* Loops Tiara C103 1 3/4" Tall C104 1 1/2" Tall C112 1 5/8" Tall Peak & Loop Tiara Loops & Heart Tiara Three Loops Tiara C117 1 3/8" Tall C206 1 5/8" Tall C301 1 7/8" Tall Five Loops Tiara Shooting Star Tiara Small Jewel Tiara† C350 3" Tall D109 2" Tall D117 1 5/8" Tall Spring Tiara†** Loops & Pearl Tiara Three Loops with Pearls Tiara ** Made from cast metal. † Jewel insert available in multiple colors. * Made from cast metal, capped with genuine Austrian rhinestone crystal by Swarovski™. 3 Allens Crowns D121 2 1/4" Tall E110 2" Tall E113 3" Tall Teardrop & Loops Tiara Peak Tiara Queen Tiara* F100 1 7/8" Tall G111 2 1/4" Tall G120 2" Tall Heart & Loops Tiara Peaked Heart Tiara Loop Tiara* G127 2 3/8" Tall J100 2" Tall J124 2 5/8" Tall Basketweave Tiara Heart Tiara Elevated Star Tiara J168 2" Tall K100 2 1/4" Tall K101 1 7/8" Tall Stars Tiara* Hearts & Loops Tiara Tie the Knot Tiara * Made from cast metal, capped with genuine Austrian rhinestone crystal by Swarovski™.
    [Show full text]
  • Dressing for the Times: Fashion in Tang Dynasty China (618-907)
    Dressing for the Times: Fashion in Tang Dynasty China (618-907) BuYun Chen Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2013 © 2013 BuYun Chen All rights reserved ABSTRACT Dressing for the Times: Fashion in Tang Dynasty China (618-907) BuYun Chen During the Tang dynasty, an increased capacity for change created a new value system predicated on the accumulation of wealth and the obsolescence of things that is best understood as fashion. Increased wealth among Tang elites was paralleled by a greater investment in clothes, which imbued clothes with new meaning. Intellectuals, who viewed heightened commercial activity and social mobility as symptomatic of an unstable society, found such profound changes in the vestimentary landscape unsettling. For them, a range of troubling developments, including crisis in the central government, deep suspicion of the newly empowered military and professional class, and anxiety about waste and obsolescence were all subsumed under the trope of fashionable dressing. The clamor of these intellectuals about the widespread desire to be “current” reveals the significant space fashion inhabited in the empire – a space that was repeatedly gendered female. This dissertation considers fashion as a system of social practices that is governed by material relations – a system that is also embroiled in the politics of the gendered self and the body. I demonstrate that this notion of fashion is the best way to understand the process through which competition for status and self-identification among elites gradually broke away from the imperial court and its system of official ranks.
    [Show full text]
  • Qinqiang Opera Drama Costume Connotation and Aesthetic
    2nd International Conference on Education Technology, Management and Humanities Science (ETMHS 2016) Qinqiang opera drama costume connotation and aesthetic implication 1, a Yugang Chen 1Jiangxi Institute of Fashion Technology, Jiangxi, Nanchang, 330201 [email protected] Keywords: Qinqiang opera drama; Clothing; The cultural connotation Abstract. Qinqiang opera drama is one of the most exquisite stylized performance of traditional Chinese local operas. Qinqiang opera drama clothing, and other theatrical performances of traditional clothing similarity is exquisite and stylized, decorative effect as well as the audiences in the symbolization of abstract feelings, dramatic clothes in qinqiang opera drama very expressive aesthetics and art. Introduction Qinqiang opera drama as a traditional Chinese drama conductions, its dramatic clothes also represents the character appearance of traditional drama clothing, under the stylized costumes or wear shows of the respect and inheritance on traditional culture. Studies of qinqiang opera costume for one of the models, style characteristic, found that it contains the cultural connotation and aesthetic implication, the essence of traditional clothing, for the development of qinqiang opera drama has a positive and far-reaching significance. The formation of Qinqiang opera drama clothing Qin has been active in shanxi, gansu and the northwest region is the vast land of an ancient opera. The earliest qinqiang opera originated in shanxi guanzhong area, from the perspective of the change of type c, Qin Sheng, qin three stages. In the qianlong period reached for her best. From the point of geography, shanxi, gansu, ningxia, qinghai, xinjiang northwest five provinces close to geographical culture, so the ancient qin, with its wide sound big voice spoke quickly popular in this area.
    [Show full text]
  • Official Selection 16Th
    Prefeitura da Cidade do Rio de Janeiro, Secretaria Municipal de Cultura presents official selection 16th 2021 24 MAY to 13 JUNE >> https://animarte.kinow.tv << INTERNATIONAL STUDENTS MAXI official selection International Students th Maxi 16 2021 SINGAPORE ENGLAND ESTONIA INDIA TAIWAN A Chameleon Story A Flea in a Jar A Kiss for a Dead Man A Little More Blue A Mysterious Hat Kamal Ayesha Fathima, Ong Shu Yi Vicky Carr Anna Dvornik Sugandha Bansal Du, Yen-Ting NTU - Nanyang Technological UCA - University for the Creative Arts EKA - Estonian Academy of Arts MIT Art, Design and Technology TNUA - Taipei National University University University of the Arts ISRAEL / JAPAN RUSSIA FRANCE ENGLAND ENGLAND / TAIWAN A Tasty Fish A Warm Salty Wind Adagio Alma Alona Chihiro Tazuro Maria Korzhova, Maria Laricheva, Guillaume Oury Rola Hafez, Francesco Cordari, Kea Xie Alexandra Megerdichian The School of Visual Theater Sofia Petrova LISAA - L’Institut Supérieur des Arts UAL - University of the Arts London Animatseh Appliqués Escape Studios official selection International Students th Maxi 16 2021 FRANCE USA ENGLAND ENGLAND / USA CROATIA Alone a Wolf’s Winter An Almost Perfect Any Instant Whatever Arachnarche Arbor Inversus Damien Grellety, Victor Dumur, Carla Vacuum Emma Jordan Nikolina Žabčić Humbert, Gaël Bourdeu, Clara Malleviale, Michelle Brand Marine Vilcot, Rebecca Belle, Bérénice Lefevre Andre Huang RCA - Royal College of Art AUB - Arts University Bournemouth ALU - Academy of Fine Arts Zagreb ESMA - École Supérieure des Métiers SJSU - San José
    [Show full text]
  • LIST of the WOOD PACKAGING MATERIAL PRODUCER for EXPORT 2007/2/10 Registration Number Registered Facility Address Phone
    LIST OF THE WOOD PACKAGING MATERIAL PRODUCER FOR EXPORT 2007/2/10 Registration number Registered Facility Address Phone ０００１００２ ITOS CORPORATION KAMOME-JIGYOSHO 62-1 KAMOME-CHO NAKA-KU YOKOHAMA-SHI KANAGAWA, JAPAN 045-622-1421 ASAGAMI CORPORATION YOKOHAMA BRANCH YAMASHITA ０００１００４ 279-10 YAMASHITA-CHO NAKA-KU YOKOHAMA-SHI KANAGAWA, JAPAN 045-651-2196 OFFICE ０００１００７ SEITARO ARAI & CO., LTD. TORIHAMA WAREHOUSE 12-57 TORIHAMA-CHO KANAZAWA-KU YOKOHAMA-SHI KANAGAWA, JAPAN 045-774-6600 ０００１００８ ISHIKAWA CO., LTD. YOKOHAMA FACTORY 18-24 DAIKOKU-CHO TSURUMI-KU YOKOHAMA-SHI KANAGAWA, JAPAN 045-521-6171 ０００１０１０ ISHIWATA SHOTEN CO., LTD. 4-13-2 MATSUKAGE-CHO NAKA-KU YOKOHAMA-SHI KANAGAWA, JAPAN 045-641-5626 THE IZUMI EXPRESS CO., LTD. TOKYO BRANCH, PACKING ０００１０１１ 8 DAIKOKU-FUTO TSURUMI-KU YOKOHAMA-SHI KANAGAWA, JAPAN 045-504-9431 CENTER C/O KOUEI-SAGYO HONMOKUEIGYOUSHO, 3-1 HONMOKU-FUTO NAKA-KU ０００１０１２ INAGAKI CO., LTD. HONMOKU B-2 CFS 045-260-1160 YOKOHAMA-SHI KANAGAWA, JAPAN ０００１０１３ INOUE MOKUZAI CO., LTD. 895-3 SYAKE EBINA-SHI KANAGAWA, JAPAN 046-236-6512 ０００１０１５ UTOC CORPORATION T-1 OFFICE 15 DAIKOKU-FUTO TSURUMI-KU YOKOHAMA-SHI KANAGAWA, JAPAN 045-501-8379 ０００１０１６ UTOC CORPORATION HONMOKU B-1 OFFICE B-1, HONMOKU-FUTOU, NAKA-KU, YOKOHAMA-SHI, KANAGAWA, JAPAN 045-621-5781 ０００１０１７ UTOC CORPORATION HONMOKU D-5 CFS 1-16, HONMOKU-FUTOU, NAKA-KU, YOKOHAMA-SHI, KANAGAWA, JAPAN 045-623-1241 ０００１０１８ UTOC CORPORATION HONMOKU B-3 OFFICE B-3, HONMOKU-FUTOU, NAKA-KU, YOKOHAMA-SHI, KANAGAWA, JAPAN 045-621-6226 ０００１０２０ A.B. SHOUKAI CO., LTD.
    [Show full text]
  • Crown Copyright Catalogue Reference
    (c) crown copyright Catalogue Reference:CAB/65/18/32 Image Reference:0001 THIS DOCUMENT IS THE PROPERTY OF HIS BRITANNIC MAJESTY'S GOVERNMENT Printed for the War Cabinet. May 1941. SECRET. Copy No. W.M. (-11) 53rd Conclusions. TO BE KEPT UNDER LOCK AND KEY. It is requested that special care may be taken to ensure the secrecy of this document. WAR CABINET 53 (41). CONCLUSIONS of a Meeting of the War Cabinet held at 10 Downing Street, S.W. 1, on Monday, May 26, 1941, at 5 P.M. Present: The Right Hon. WINSTON S. CHURCHILL, M.P., Prime Minister (in the Chair). The Right Hon. C. R. ATTLEE, M.P., The Right Hon. Sir JOHN ANDERSON, Lord Privy Seal. M.P., Lord President of the Council. The Right Hon. ANTHONY EDEN, M.P., The Right Hon. A. GREENWOOD, M.P., Secretary of State for Foreign Minister without Portfolio. Affairs. The Right Hon. LORD BEAVERBROOK, The Right Hon. Sir KINGSLEY WOOD, Minister of State. M.P., Chancellor of the Exchequer. The Right Hon. ERNEST BEVIN, M.P., Minister of Labour and National Service. The following were also present: The Right Hon. HERBERT MORRISON, I The Right Hon. VISCOUNT CRANBORNE, M.P., Secretary of State for the Home Secretary of State for Dominion Department and Minister of Home Affairs. Security. The Right Hon. LORD MOYNE, Secre- The Right Hon. A. V. ALEXANDER, tary of State for the Colonies. M.P., First Lord of the Admiralty. The Right Hon. H. D. MARGESSON, The Right Hon. Sir ARCHIBALD M.P., Secretary of State for War.
    [Show full text]
  • Ahead Corporate HEADWEAR & ACCESSORIES SECOND EDITION
    Ahead Corporate HEADWEAR & ACCESSORIES SECOND EDITION 20 19 WWW.AHEADCORPORATE.COM INTRODUCING SONICWELD! SONIC BOOM! Use AHEAD’s new SONICWELD technique to add POP to your logo with texture, dimension, & dynamic color. This proprietary technique offers a modern alternative to traditional embroidery. ORNAMENTATION - MIX IT UP Nobody has more ways than AHEAD to help you present your logo in so many eye catching, and innovative ways. With variety like this, Ahead can offer you a multitude of was to transform and present your logo. Direct Embroidery Name Drop Name Drop w/ Logo 3D/Bounce Embroidery Printed Label-Coolmax Printed Label-Canvas 3D Printed Vintage Label Custom Vin Therm Vintage Label w/Embroidery 3D Printed Label w/Embroidery Applique W/ Embroidery Open Edge Printed Applique Woven Applique Label Rubber Applique Sonic Weld Grafix Weld *Please contact your AHEAD Sales Representative for pricing. TABLE OF CONTENTS 04 MODERN TREND HATS 37 KATE LORD 50 MONEY CLIPS/HAT CLIPS/BAG TAGS 06 CLASSIC COTTONS 41 PRIVATE LABEL 51 STOCK LEATHER/POKER CHIPS 13 FITTED 42 PERSONALIZATION 52 TOWELS/BLANKETS/BAGS 14 PERFORMANCE 43 T-SHIRT CAP COMBO 53 CHROMAPLATE 24 CASUALS 44 TOURNAMENT GIFT PACKS 54 APPAREL 29 VISORS 47 CORPORATE ACCESSORIES 56 T-SHIRTS 32 BRIMMED HATS 48 BALLMARKER/COMMEMORATIVE 58 PANTONE MATCHES 34 KNITS 49 DIVOT TOOLS 59 INDEX Icon Legend GRAFIXWELD SONIC WELD SO MANY WAYS TO GET AHEAD! LADIES’ APPAREL MEN’S APPAREL HEADWEAR ACCESSORIES & GIFTS CORPORATE HEADWEAR TEAM/COLLEGIATE HEADWEAR ASI#33220 PPAI#552592 EVEN MORE REASONS TO GET AHEAD! Corporate Social Responsibility AHEAD, LLC is committed to a platform corporate responsibility, striving for business solutions that integrate financial responsibility with long term social and environmental perspectives.
    [Show full text]
  • 5 Types of Kokoshnik Tiaras
    5 TYPES OF KOKOSHNIK TIARAS There’s a surprising variety of design possibilities for kokoshnik tiaras. Here are 5 drool-worthy examples and their stories. FILE UNDER: TIARAS WANT ME TO READ THIS POST TO YOU? N A PREVIOUS POST, I TALKED ABOUT I Grand Duchess Hilda of Baden’s stolen tiara. That tiara is a kokoshnik, so I thought I’d explain what that means and show you a few examples. WHAT’S A KOKOSHNIK? THE KOKOSHNIK IS A TRADITIONAL Russian headdress. It’s shaped like a halo, widest above the forehead and a little narrower at the sides. If you’ve seen the golden halos of saints in Russian icons or other Christian art, you get the general idea. Here’s a Russian icon of Our Lady of Kazan from the 19th century: IMAGE B Y ХОМЕЛКА, CC BY- SA 3.0 VIA WIKIMEDIA COMMONS. GIRLINTHETIARA.COM | 5 TYPES OF KOKOSHNIK TIARAS The earliest versions of kokoshniks were covered with fabric and tied on with ribbons at the side. This version is from a painting by Viktor Vasnetsov – he was famous for his romanticized depictions of Russian history and folklore, including a super-famous painting of Ivan the Terrible you’d probably recognize if you saw it. You know the one – Ivan’s throwing creeptastic side-eye, dressed in a fur cap and gold brocade tunic, and holding a staff with a pointy end like he’s about to stab a bitch. IMAGE BY ВАСНЕЦОВ, P UBLIC DOMAIN VIA WIKIMEDIA COMMONS. GIRLINTHETIARA.COM | 5 TYPES OF KOKOSHNIK TIARAS The kokoshnik was part of traditional Russian folk dress, along with the sarafan – a sort of jumper or pinafore with a blouse underneath.
    [Show full text]
  • Culture of Azerbaijan
    Administrative Department of the President of the Republic of Azerbaijan P R E S I D E N T I A L L I B R A R Y CULTURE OF AZERBAIJAN CONTENTS I. GENERAL INFORMATION............................................................................................................. 3 II. MATERIAL CULTURE ................................................................................................................... 5 III. MUSIC, NATIONAL MUSIC INSTRUMENTS .......................................................................... 7 Musical instruments ............................................................................................................................... 7 Performing Arts ....................................................................................................................................... 9 Percussion instruments ........................................................................................................................... 9 Wind instruments .................................................................................................................................. 12 Mugham as a national music of Azerbaijan ...................................................................................... 25 IV. FOLKLORE SONGS ..................................................................................................................... 26 Ashiqs of Azerbaijan ............................................................................................................................ 27 V. THEATRE,
    [Show full text]
  • Head, Face & Welding
    WHAT’S INSIDE HEAD, FACE & WELDING Hard Hats Wherever there is a potential for falling objects, flying objects, impacts or bumps, hard hats should be there. Adjustable, imprintable and dependable, Honeywell has the hard hat to meet your needs. North® and Fibre-Metal® hard hats and accessories provide comfortable, reliable head protection your employees will want to wear, featuring stylish, lightweight shell designs, suspension height adjustment and comfortable padding. Our pin lock, quick fit and ratchet adjustment suspensions all make use of the natural shape of the head, providing workers with comfort all day long. Greater compliance and worker safety are an active part of our ongoing commitment to quality, innovation and the enhancement of head protection in the workplace. Welding Helmets Workers worldwide depend on Honeywell products for quality and rugged protection that helps reduce injuries, increases productivity and improves the quality of work life. All workers who find themselves in harm’s way on the job deserve top performing protective equipment. That’s why every product we make is focused on quality that performs – the kind of quality that results from using only the best grade raw materials, advanced product design and the latest technology. Each model is designed to have a full complement of exclusive performance and comfort features to satisfy the needs of today’s high-production workers and ensure a safer, more productive workplace. 14 | www.honeywellsafety.com | Head, Face & Welding Protection FACE SHIELDS Uvex Turboshield™
    [Show full text]
  • Costume and Courtly Culture in Ming China and Mughal India
    PEOPLE: International Journal of Social Sciences ISSN 2454-5899 Murali & Gupta, 2019 Volume 5 Issue 2, pp. 24 - 33 Date of Publication: 19th July 2019 DOI-https://dx.doi.org/10.20319/pijss.2019.52.2433 This paper can be cited as: Murali, A. S., & Gupta, V., (2019). Comparing Sartorial Indices: Costume and Courtly Culture in Ming China and Mughal India. PEOPLE: International Journal of Social Sciences, 5(2), 24 - 33. This work is licensed under the Creative Commons Attribution-Non Commercial 4.0 International License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc/4.0/ or send a letter to Creative Commons, PO Box 1866, Mountain View, CA 94042, USA. COMPARING SARTORIAL INDICES: COSTUME AND COURTLY CULTURE IN MING CHINA AND MUGHAL INDIA Anu Shree Murali Undergraduate Student, Gargi College, Delhi University, New Delhi, India [email protected] Vidita Gupta Undergraduate Student, Gargi College, Delhi University, New Delhi, India [email protected] Abstract Mughal India and Ming China, two of the greatest empires in medieval Asia, were successful in influencing the cultures of their respective territories and beyond. Although the two empires differed on many grounds like art, society, environment etc., there are nonetheless striking similarities between the two. These similarities are often overshadowed and neglected because of the differences. One such similarity is the clearly defined social hierarchy in the society, articulated explicitly in the functioning of the court, of both these empires. An individual’s attire in Ming China clearly reflected his/her position in the courtly hierarchy. Building on this, we tried to look at the role played by attire in establishing social rank in an equally powerful and hierarchical empire of the Mughals in India.
    [Show full text]