Oxbow Book News 105

Total Page:16

File Type:pdf, Size:1020Kb

Load more

OXBOW BOOK NEWS 105 New and forthcoming titles for Spring 2020 Archaeology The Ancient World Greece and Rome The Middle Ages Welcome to the 105th Oxbow Book News, featuring all the latest archaeological titles from our own imprints and our partner publishers. Among our own publications, we are particularly pleased to announce Landscapes Revealed which presents the results of several years of surveying on Orkney between Skara Brae and Maeshowe to give a detailed picture of the changing landscape context of one of western Europe’s most important concentrations of prehistoric monuments. Landscapes Revealed should hit the shelves in June. We are also proud to bring the seminal work of Pierre Petrequin and Anne-Marie Petrequin to an English-speaking audience for the first time. Ecology of a Tool is a classic study of the ground stone axes of Irian Jaya in New Guinea. It explores their manufacture, exchange and economic significance, taking an object-centred approach. With nearly 200 titles, all of them brand new or back in stock due to popular demand, you will find a considerably expanded bargain section in the centre of this catalogue. We have great new reductions on a selection of our own title, plus fantastic lists from Spink, the Arizona Center for Medieval and Renaissance Studies, and Amberley, plus a mixed bag just in from the US. This catalogue goes out in the shadow of the global CO-VID 19 pandemic. As I write we are continuing to process and send out orders as normal, although postage, particularly to the European mainland, may be subject to delays. However, I must stress that we may be overtaken by events; we are monitoring the situation closely and will keep you updated with any changes to our normal trading during this uncertain period. Please check our website for the latest information – it will remain up and running. Please do keep in touch through our social media channels. With best wishes in this difficult time Cover Image: Excavations at the Early Neolithic site of Bestansur, Shahrizor Plain, Sulaimani province, Kurdistan Region, Iraq Photo: Roger Matthews, University of Reading From: The Early Neolithic of the Eastern Fertile Crescent (Oxbow Books 2020) Published by Oxbow Books, The Old Music Hall, 106–108 Cowley Road, Oxford OX4 1JE Tel (order enquiries): +44 (0)1226 734350 | Tel (general enquiries): +44 (0)1865 241249 E-mail: [email protected] | www.oxbowbooks.com /oxbowbooks @oxbowbooks ARCHAEOLOGICAL METHODPREHISTORY & THEORY A Taste for Green A Global Perspective on Ancient Jade, Turquoise and Variscite Exchange Edited by Carlos Rodríguez-Rellán, Ben A. Nelson & Ramón Fábregas Valcarce A Taste for Green addresses the latest research into the acquisition of jade, turquoise or variscite, all of which share a characteristic greenish colour and an engaging appearance once they are polished in the shape of axes or assorted adornments. Papers explore how, in addition to constituting economic transactions, the transfer of these materials were also statements of social liaisons, personal capacities, and relation to places or to unseen forces. The volume centres on two study areas, Western Europe and México/ Southwest US. Oxbow Books • 2020 • 9781789252743 • £45.00 • Hardback • 192 pages b/w and col illustrations The Competition of Fibres Early Textile Production in Western Asia, Southeast and Central Europe (10,000–500 BC) Edited by Wolfram Schier & Susan Pollock The central issues discussed in this new collection are the relationships between fibre resources and availability on the one hand and the ways those resources were exploited to produce textiles on the other. Technological and economic practices – for example, the strategies by which raw materials were acquired and prepared – in the production of textiles play a major role. Contributions investigate the beginnings of wool use in western Asia and southeastern Europe in the context of a consideration of other fibres, both plant and animal. Oxbow Books • April 2020 • 9781789254297 • £38.00 • Paperback • 240 pages FORTHCOMING, ONLY col illustrations £30.40 UNTIL PUBLICATION In the Footsteps of Honor Frost The Life and Legacy of a Pioneer in Maritime Archaeology Edited by Lucy Blue Maritime archaeologist Honor Frost (1917-2010) was a pioneer in her field. She left a rich legacy through her innovative research conducted in the eastern Mediterranean on the remains of ports and harbours, sea-level change, shipwrecks and ship construction, and ancient anchors. This volume provides an appreciation of Frost’s work and assesses current projects in the region that draw on her legacy, providing insight into the development of the discipline of maritime archaeology in the region from its infancy to the present day. Sidestone Press • 2020 • 9789088908309 • £60.00 • Paperback • 300 pages b/w and col illustrations 1 www.oxbowbooks.com | [email protected] | +44 (0)1226 734350 ARCHAEOLOGICAL METHOD & THEORY Art in the Archaeological Imagination Edited by Dragos Gheorghiu This book discusses the creative mental processes of prehistoric and contemporary artists, as well as of archaeologists studying them from the perspective of cognition and art. Its intention is to highlight the artistic thinking within the imagination of the archaeologist, as well as to discuss the concepts of imagination and art in current scientific research. From this perspective the book suggests a type of research closer to the complexity of the human nature and human thinking. Oxbow Books • 2020 • 9781789253528 • £36.00 • Paperback • 144 pages b/w illustrations Dead or Alive Edited by Maria Fabricius Hansen, Rosanna Tindbæk & Gundhild Ravn Borggreen The image is an ontological paradox; it is made of dead matter, yet simultaneously appears to be alive. Covering a wide range of image practices, such as early palaeolithic stone engravings, medieval tomb sculpture, renaissance death masks and baroque painting to modern fashion and park design these twelve chapters demonstrate that the ontological paradox of the image is not limited to a specific historical period or certain types of images, but can be seen throughout the history of images across different cultures. Aarhus University Press • 2020 • 9788771843514 • £55.00 • Hardback 304 pages Gender Transformations in Prehistoric and Archaic Societies Edited by Julia Katharina Koch & Wiebke Kirleis In which chronological, spatial, and social contexts is gender a relevant social category that is noticeable in the archaeological material? How can transformations in social gender relations and identity be recognized archaeologically? Is the identity of prehistoric people defined by gender? If so, what is the accompanying cultural context? What about gender equality among the scientists working in archaeology? In what degree are research teams, as well as their scientific approaches, biased today? These and other burning questions are intensively discussed in this volume. Sidestone Press • 2020 • 9789088908217 • £65.00 • Paperback • 500 pages 2 www.oxbowbooks.com | [email protected] | +44 (0)1226 734350 ARCHAEOLOGICAL METHOD & THEORY Osteoarchaeology in Historical Context Cemetery Research from the Low Countries Edited by Roos van Oosten, Rachel Schats & Kerry Fast While osteoarchaeological research is common in the Low Countries, many of the studies done on the excellent skeletal collections remain unpublished and therefore unavailable to a larger audience. This volume contributes to the dissemination of cemetery research in the Low Countries. Several important skeletal collections are examined in their historical contexts to better understand past living and dying. Osteoarchaeological data are combined with information on burial location, orientation, and grave goods. Sidestone Press • 2020 • 9789088908330 • £35.00 • Paperback • 206 pages b/w and col illustrations Death and Changing Rituals Function and Meaning in Ancient Funerary Practices Edited by Håkon Roland, Marina Prusac & J. Rasmus Brandt In most societies the disposal of the corpse is accompanied by some form of celebration or ritual. The contributions presented here are focused not on the examination of such different funerary practices, their function and meaning, but on the changes of such rituals, how and when they occurred, and how they may be explained. A range of key themes are examined concerning belief and ritual, body and deposition, place, performance and commemoration, exploring a complex web of practices. Oxbow Books • 2020 • 9781789253818 • £35.00 • Paperback • 480 pages NEW IN PAPERBACK, b/w and col illustrations Dying to Eat Cross-Cultural Perspectives on Food, Death, and the Afterlife Edited by Candi K. Cann, Emily Wu, Jung Eun Sophia Park, Joshua Graham & Lacy K. Crocker Dying to Eat is the first interdisciplinary book to examine the role of food in death, bereavement, and the afterlife. The contributors explore the phenomenon across cultures and religions, investigating topics including tombstone rituals in Buddhism, Catholicism, and Shamanism; the role of death in the Moroccan approach to food; and the role of funeral casseroles and church cookbooks in the Southern United States. Illuminating how cooking and corpses both transform and construct social rituals, Dying to Eat serves as a fascinating exploration of the foodways of death and bereavement. University Press of Kentucky • 2019 • 9780813178516 • £26.50 • Paperback 208 pages • b/w illustrations 3 www.oxbowbooks.com | [email protected] | +44 (0)1226 734350 ARCHAEOLOGICAL METHOD & THEORY Debasement Manipulation
Recommended publications
  • Our Complete Catalogue Can Be Found At

    Our Complete Catalogue Can Be Found At

    Company History James Clarke & Co was founded in London in 1859. It published the highly infl uential religious magazine Christian World, which at its peak sold over 100,000 copies a week. Thanks to this success, the company began to publish books, initially focusing in imports from the United States. James Clarke & Co now publishes academic, scholarly and reference works, specialising in theology, history, literature and related subjects. Its publications include two major series, the Library of Theological Translations and the Library of Ecclesiastical History. Although theology is a small academic discipline, and theological publishing a small sector, James Clarke & Co is recognised worldwide as one of the leading names in the fi eld. Inspection copies are available to suitable academic and educational institutions, subject to terms and conditions. Please contact us for further information. Our complete catalogue can be found at: www.jamesclarke.co Contact Details: Trade Customers: For all editorial matters, contact us at: You can apply for an account with us or Tel.: +44 (0)1223 350 865 order through your preferred wholesaler. Fax: +44 (0)1223 366 951 UK: Gardners, Bertram [email protected] Our US distributor is: James Clarke & Co., David Brown Book Company, P.O. Box 60, www.oxbowbooks.com Cambridge CB1 2NT, United Kingdom C Sales and Distribution For all sales enquiries, including individual orders, please contact Tel.: +44 (0)1223 350865 Fax: +44 (0)1223 366951 [email protected] Recent and Forthcoming Titles Biblical Studies W. Gordon Campbell Reading Revelation: A Thematic Approach Gordon Campbell presents a fresh approach to the Book of Revelation by moving away from recent scholarship to consider the text as the best interpreter of itself.
  • Mating Analysis West Coast

    Mating Analysis West Coast

    MATING ANALYSIS You may submit your mare online at lanesend.com or call 859-873-7300 to discuss your matings with CHANCE TIMM, [email protected], JILL MCCULLY, [email protected] or LEVANA CAPRIA, [email protected]. WEST COAST Flatter – Caressing by Honour and Glory 2014 Bay l 16.2 Hands “An Eclipse Award winning champion, West Coast is by an outstanding sire son of A.P. Indy, out of a ChampionTwo-Year-Old Filly. West Coast earned a title as Champion Three-Year-Old Colt with five consecutive victories, four in stakes events, and ran 1-2-3 in six consecutive grade one events, including when capturing the Travers Stakes (G1) and Pennsylvania Derby (G1). He is by Flatter, a leading stallion son of A.P. Indy, and sire of more than 50 stakes winners, and out of Caressing, Champion and Breeders’ Cup (G1) winner at two.“ The offspring of West Coast will be free of Northern Dancer at four generations on their sire’s side, and Flatter has crossed well with a wide variety of broodmare sires from that line. The cross with mares from the Danzig branch of Northern Dancer has been particulary productive with seven stakes winners, including graded stakes winners Classic Point and Mad Flatter out of mares by Langfuhr and Honor Grades (who gives inbreeding to the dam of A.P. Indy), and there are also stakes winners out of mares by War Front – who appears particularly interesting here, giving inbreeding to Relaunch and a full-sister – Danzig Connection, Ghazi and Military (who would be intriguing here).
  • New Dates for the Late Neolithic Corded Ware Culture Burials and Early Husbandry in the East Baltic Region

    New Dates for the Late Neolithic Corded Ware Culture Burials and Early Husbandry in the East Baltic Region

    Archaeofauna 16 (2007): 21-31 New dates for the Late Neolithic Corded Ware Culture burials and early husbandry in the East Baltic region LEMBI LÕUGAS1, AIVAR KRIISKA2 & LIINA MALDRE3 1 Institute of History, Tallinn University, Rüütli 6, EE10130 Tallinn, Estonia. e-mail: [email protected] 2 Department of History, Tartu University, Ülikooli 18, EE50090 Tartu, Estonia. 3 Institute of History, Tallinn University, Rüütli 6, EE10130 Tallinn, Estonia. (Received December 18, 2006; Revised April 10, 2007; Accepted April 16, 2007) ABSTRACT: The appearance of the Corded Ware Culture in the eastern Baltic area has been associated with the beginning of animal husbandry in this region. The culture is quite well re- presented by artefacts around the Baltic Sea basin, whereas its animal bone material seems to have been partly mixed with either that of the Combed Ware Culture, whose economy was based on hunting, fishing and gathering, or with later material. Radiocarbon dates have placed the beginning of the Corded Ware Culture in the eastern Baltic region in the time interval 3000- 2700 cal BC. New dates from Estonia confirm that the phenomenon appeared here at that time. The beginning of animal husbandry in the East Baltic is discussed on the basis of the new dates and the animal bone finds from Corded Ware Culture settlement sites and burials. Important fac- tors in the spreading of early farming in addition to climate, were geographical and environ- mental conditions. KEYWORDS: EAST BALTIC, ESTONIA, LATE NEOLITHIC, CORDED WARE CUL- TURE, DOMESTIC ANIMALS RESUMEN: La cultura de las cerámicas cordadas en el Báltico oriental se asocia con el inicio de la ganadería en la zona.
  • Neolithic Farmers in Poland - a Study of Stable Isotopes in Human Bones and Teeth from Kichary Nowe in the South of Poland

    Neolithic Farmers in Poland - a Study of Stable Isotopes in Human Bones and Teeth from Kichary Nowe in the South of Poland

    Neolithic farmers in Poland - A study of stable isotopes in human bones and teeth from Kichary Nowe in the south of Poland Master thesis in archaeological science Archaeological Research Laboratory Stockholm University Supervisors: Kerstin Lidén and Gunilla Eriksson Author: Staffan Lundmark Cover photo: Mandible from the Kichary Nowe site, photo taken by the author Abstract: The diet of the Stone Age cultures is a strong indicator to the social group, thus farmers and hunters can be distinguished through their diet. There is well-preserved and well excavated Polish skeletal material available for such a study but the material has not previously been subject to stable isotopes analyses and therefore the questions of diets has not been answered. This study aims to contribute to the understanding of the cultures in the Kichary Nowe 2 area in the Lesser Poland district in southern Poland. Through analysis of the stable isotopes of Carbon, Nitrogen and Sulphur in the collagen of teeth and skeletal bones from the humans in the Kichary Nowe 2 grave-field and from bones from the fauna, coeval and from the same area, the study will establish whether there were any sharp changes of diets. The material from the grave-field comes from cultures with an established agricultural economy, where their cultural belonging has been anticipated from the burial context. The results from my study of stable isotopes from the bone material will be grouped by various parameters, culture, attribution to sex and age. The groups will then be compared to each other to investigate patterns within and between the groups.
  • Exaggerator Storms to Haskell Win (Cont

    Exaggerator Storms to Haskell Win (Cont

    MONDAY, AUGUST 1, 2016 LORD NELSON FLIES TO BING CROSBY WIN EXAGGERATOR STORMS Spendthrift Farm=s Lord Nelson (Pulpit) doubled up on Grade I TO HASKELL WIN tallies with a scorching victory in the GI Bing Crosby S. Sunday at Del Mar. The 4-year-old completed the Crosby=s six furlongs in 1:07.65, just .05 seconds off the track=s 43-year-old record for the distance. Off as the even-money choice, Lord Nelson sat third, two to three lengths off a blazing :21.16 quarter-mile set by joint leaders Justin Squared (Zensational) and Subtle Indian (Indian Charlie). Moving to tackle the leaders under Flavien Prat on the latter half of the turn, Lord Nelson opened clear in the straightaway and bounded home by four lengths, nearly matching the track record of King of Cricket (Coursing), set back in 1973. Lord Nelson's time established a stakes record for the Crosby, eclipsing the 54-year-old record of 1:07.80 set by Crazy Kid, which at the time was a world's record. AHe=s become a serious sprinter,@ said winning trainer Bob Baffert. AHe=s getting better and better. He was pretty close to those fast splits and he still had a kick left. So that was really impressive.@ Cont. p8 Exaggerator | Sarah K Andrew IN TDN EUROPE TODAY Exaggerator (Curlin), who has made a habit of impressive wins over off tracks, skipped over the sloppy going at Monmouth Park ROTHSCHILD GLORY FOR QEMAH Sunday in a powerful last-to-first victory in the GI Betfair.com Al Shaqab Racing’s Qemah (Ire) (Danehill Dancer {Ire}) found Haskell Invitational S.
  • Studies in Early Mediterranean Poetics and Cosmology

    Studies in Early Mediterranean Poetics and Cosmology

    The Ruins of Paradise: Studies in Early Mediterranean Poetics and Cosmology by Matthew M. Newman A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Classical Studies) in the University of Michigan 2015 Doctoral Committee: Professor Richard Janko, Chair Professor Sara L. Ahbel-Rappe Professor Gary M. Beckman Associate Professor Benjamin W. Fortson Professor Ruth S. Scodel Bind us in time, O Seasons clear, and awe. O minstrel galleons of Carib fire, Bequeath us to no earthly shore until Is answered in the vortex of our grave The seal’s wide spindrift gaze toward paradise. (from Hart Crane’s Voyages, II) For Mom and Dad ii Acknowledgments I fear that what follows this preface will appear quite like one of the disorderly monsters it investigates. But should you find anything in this work compelling on account of its being lucid, know that I am not responsible. Not long ago, you see, I was brought up on charges of obscurantisme, although the only “terroristic” aspects of it were self- directed—“Vous avez mal compris; vous êtes idiot.”1 But I’ve been rehabilitated, or perhaps, like Aphrodite in Iliad 5 (if you buy my reading), habilitated for the first time, to the joys of clearer prose. My committee is responsible for this, especially my chair Richard Janko and he who first intervened, Benjamin Fortson. I thank them. If something in here should appear refined, again this is likely owing to the good taste of my committee. And if something should appear peculiarly sensitive, empathic even, then it was the humanity of my committee that enabled, or at least amplified, this, too.
  • The Genomic Ancestry of the Scandinavian Battle Axe Culture People and Their Relation to the Broader Corded Ware Horizon

    The Genomic Ancestry of the Scandinavian Battle Axe Culture People and Their Relation to the Broader Corded Ware Horizon

    Malmström, H., Günther, T., Svensson, E. M., Juras, A., Fraser, M., Munters, A. R., Pospieszny, Ł., Tõrv, M., Lindström, J., Götherström, A., Storå, J., & Jakobsson, M. (2019). The genomic ancestry of the Scandinavian Battle Axe Culture people and their relation to the broader Corded Ware horizon. Proceedings of the Royal Society B: Biological Sciences, 286(1912), [20191528]. https://doi.org/10.1098/rspb.2019.1528 Publisher's PDF, also known as Version of record License (if available): CC BY Link to published version (if available): 10.1098/rspb.2019.1528 Link to publication record in Explore Bristol Research PDF-document This is the final published version of the article (version of record). It first appeared online via The Royal Society at https://doi.org/10.1098/rspb.2019.1528 . Please refer to any applicable terms of use of the publisher. University of Bristol - Explore Bristol Research General rights This document is made available in accordance with publisher policies. Please cite only the published version using the reference above. Full terms of use are available: http://www.bristol.ac.uk/red/research-policy/pure/user-guides/ebr-terms/ The genomic ancestry of the Scandinavian royalsocietypublishing.org/journal/rspb Battle Axe Culture people and their relation to the broader Corded Ware horizon Research Helena Malmström1,2,†, Torsten Günther1,†, Emma M. Svensson1, Anna Juras3, Cite this article: Malmström H et al. 2019 Magdalena Fraser1,4, Arielle R. Munters1, Łukasz Pospieszny5,6, Mari Tõrv7, The genomic ancestry of the Scandinavian 8 9 10 Battle Axe Culture people and their relation to Jonathan Lindström , Anders Götherström , Jan Storå the broader Corded Ware horizon.
  • Oxbow Confirmed for Belmont Attack In

    Oxbow Confirmed for Belmont Attack In

    MONDAY, MAY 20, 2013 732-747-8060 $ TDN Home Page Click Here OXBOW CONFIRMED FOR BELMONT F-T MIDLANTIC SALE STARTS TODAY Trainer D. Wayne Lukas headed back to Churchill The juvenile sales have been setting records all Downs early Sunday season long and the show moves to Maryland Monday morning with his nine-horse when the two-day Fasig-Tipton Midlantic Two-Year- contingent that included Olds in Training Sale kicks off at 10 a.m. in Timonium. GI Preakness S. winner AI am very optimistic that we=ll have a very good Oxbow (Awesome Again), marketplace,@ commented Fasig-Tipton President Boyd who will train at Churchill Browning, Jr. AThe market has been very strong all for the next few weeks spring and all indications from pre-sale activity, in terms before vanning up to of the breeze show and the crowd here [at the barns] contest the looking at horses the last three days, have all been Oxbow and D. Wayne Lukas GI Belmont S. June 8. AI positive.@ Jim McCue was trying to be politically The Midlantic sale sits on a geographic crossroads that makes it an ideal location to attract horsemen from correct all week, but I several racing districts, many of them with regional thought [Oxbow] was the toughest horse,@ the Hall of programs bolstered by slots-infused purses. Famer said of the 15-1 shot=s run in the Classic. AI AWithin a four-hour drive from Timonium, Maryland, thought if there was some adversity or something went you feed a number of racing jurisdictions and the wrong, he had the best chance to overcome.@ Cont.
  • Owners, Kentucky Derby (1875-2017)

    Owners, Kentucky Derby (1875-2017)

    OWNERS, KENTUCKY DERBY (1875-2017) Most Wins Owner Derby Span Sts. 1st 2nd 3rd Kentucky Derby Wins Calumet Farm 1935-2017 25 8 4 1 Whirlaway (1941), Pensive (’44), Citation (’48), Ponder (’49), Hill Gail (’52), Iron Liege (’57), Tim Tam (’58) & Forward Pass (’68) Col. E.R. Bradley 1920-1945 28 4 4 1 Behave Yourself (1921), Bubbling Over (’26), Burgoo King (’32) & Brokers Tip (’33) Belair Stud 1930-1955 8 3 1 0 Gallant Fox (1930), Omaha (’35) & Johnstown (’39) Bashford Manor Stable 1891-1912 11 2 2 1 Azra (1892) & Sir Huon (1906) Harry Payne Whitney 1915-1927 19 2 1 1 Regret (1915) & Whiskery (’27) Greentree Stable 1922-1981 19 2 2 1 Twenty Grand (1931) & Shut Out (’42) Mrs. John D. Hertz 1923-1943 3 2 0 0 Reigh Count (1928) & Count Fleet (’43) King Ranch 1941-1951 5 2 0 0 Assault (1946) & Middleground (’50) Darby Dan Farm 1963-1985 7 2 0 1 Chateaugay (1963) & Proud Clarion (’67) Meadow Stable 1950-1973 4 2 1 1 Riva Ridge (1972) & Secretariat (’73) Arthur B. Hancock III 1981-1999 6 2 2 0 Gato Del Sol (1982) & Sunday Silence (’89) William J. “Bill” Condren 1991-1995 4 2 0 0 Strike the Gold (1991) & Go for Gin (’94) Joseph M. “Joe” Cornacchia 1991-1996 3 2 0 0 Strike the Gold (1991) & Go for Gin (’94) Robert & Beverly Lewis 1995-2006 9 2 0 1 Silver Charm (1997) & Charismatic (’99) J. Paul Reddam 2003-2017 7 2 0 0 I’ll Have Another (2012) & Nyquist (’16) Most Starts Owner Derby Span Sts.
  • From Content to Context: a Food Residue Study of Ceramics of the Fourth Millennium BC in the Upper and Middle Thames Valley, UK

    From Content to Context: a Food Residue Study of Ceramics of the Fourth Millennium BC in the Upper and Middle Thames Valley, UK

    University of Southampton Research Repository ePrints Soton Copyright © and Moral Rights for this thesis are retained by the author and/or other copyright owners. A copy can be downloaded for personal non-commercial research or study, without prior permission or charge. This thesis cannot be reproduced or quoted extensively from without first obtaining permission in writing from the copyright holder/s. The content must not be changed in any way or sold commercially in any format or medium without the formal permission of the copyright holders. When referring to this work, full bibliographic details including the author, title, awarding institution and date of the thesis must be given e.g. AUTHOR (year of submission) "Full thesis title", University of Southampton, name of the University School or Department, PhD Thesis, pagination http://eprints.soton.ac.uk UNIVERSITY OF SOUTHAMPTON FACULTY OF HUMANITIES Archaeology From content to context: A food residue study of ceramics of the fourth millennium BC in the Upper and Middle Thames Valley, UK by Emilie Sibbesson Thesis for the degree of Doctor of Philosophy August 2014 UNIVERSITY OF SOUTHAMPTON ABSTRACT FACULTY OF HUMANITIES Archaeology Doctor of Philosophy FROM CONTENT TO CONTEXT: A FOOD RESIDUE STUDY OF CERAMICS OF THE FOURTH MILLENNIUM BC IN THE UPPER AND MIDDLE THAMES VALLEY, UK by Emilie Sibbesson This research explores the extent to which food residues from ceramics can contribute to archaeological understanding of the fourth millennium BC. Known archaeologically as the Early and Middle Neolithic, this prehistoric period is disputed among archaeologists and food-related evidence is especially contested. This research explores food-related evidence from new angles in that traditional approaches to diet are abandoned in favour of smaller- scale study of cookery practices.
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
  • American Pharoah Is World=S Best Cont

    American Pharoah Is World=S Best Cont

    WEDNESDAY, 20 JANUARY 2016 >HAPPY= ON HONG KONG TRAIL AMERICAN PHAROAH IS Triple Group 1 winner Happy Trails (Aus) (Good Journey) could WORLD=S BEST get his first shot at racing overseas at age eight after trainer Paul Beshara told Racing.com Sha Tin=s G1 QEII Cup Apr. 24 is a target. "This year we thought, >he's eight years of age, he's not going to have much longer [racing],=@ Beshara told Racing.com's RSN. AThey really love him in Hong Kong.@ Happy Trails has yet to win at a Sydney autumn carnival, where notorious wet weather can cause track conditions to play against his liking. "We thought we could go to Sydney every year, but we just get flooded out,@ Beshara added. AHe can't run on the wet track, so we're really considering Hong Kong." Happy Trails is set to have a jump-out next Monday and a trial before resuming in the G1 CF Orr S. Feb. 13. He was last seen Team >Pharoah= with Longines= Juan-Carlos Capelli and IFHA=s Louis finishing eighth in the G1 Mackinnon S. on Halloween. Romanet at the Longines World=s Best Racehorse ceremony | IFHA By Emma Berry Following a unanimous vote to be named Eclipse Horse of the Year in his home country, American Pharoah (Pioneerof the Nile) gained worldwide recognition on Tuesday when named Longines World=s Best Racehorse for 2015 at a ceremony in BILL OPPENHEIM: FIRST FOALS 2009-2012 central London. Columnist Bill Oppenheim continues his examination of 2015 As the name suggests, the rankings are a truly global affair and APEX figures.