Tese Priscila Cirilo Corrigida

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Universidade Estadual Paulista “Júlio de Mesquita Filho” Instituto de Biociências PRISCILA DANIELE RAMOS CIRILO ALTERAÇÕES GENÔMICAS E PERFIL DE EXPRESSÃO GÊNICA GLOBAL EM LEIOMIOMAS UTERINOS Tese apresentada ao Instituto de Biociências de Botucatu, Universidade Estadual Paulista “Júlio de Mesquita Filho” – UNESP, como requisito á obtenção do título de Doutor em Ciências Biológicas – Área de concentração: Genética. Orientadora: Profa. Dra. Silvia Regina Rogatto Botucatu 2011 Dedico este trabalho, Ao meu Deus, que sempre cuidou de mim em todas as etapas da minha vida. Obrigada Senhor, por mais esta conquista. “Porque dele e por ele, e para ele, são todas as coisas.” Romanos 11:36 AGRADECIMENTOS À minha orientadora Profa. Dra. Silvia Regina Rogatto, Obrigada pela oportunidade de trabalhar em sua equipe, pelo carinho, confiança e ensinamentos que me acompanharão por toda a vida. Sempre serei grata por toda a atenção e tempo dedicados a mim para realização deste trabalho. Muito Obrigada! À Dra. Anaglória Pontes, À Dra. Maria Aparecida Custódio Domingues, À Dra. Cláudia Aparecida Rainho, Agradeço todas vocês pelas colaborações essenciais neste trabalho. À Biblioteca e Pós-graduação - IBB, UNESP, Botucatu, Obrigada por toda ajuda e atenção durante estes anos. À todos do Centro Internacional de Pesquisa e Ensino (CIPE), Obrigada por nos receber e pela contribuição necessária para execução deste trabalho. À FAPESP, CAPES e CNPq pelo apoio financeiro. À todos integrantes e ex-integrantes do Laboratório NeoGene, Ana, Anderson, André, Ariane, Carlos, Carol, Cássia, Deborah, Eliane, Eloísa, Fábio, Fabíola, Fernanda, Francine, Georgia, Graziela, Gustavo, Haydée, Hellen, Juan, Julia, Lívia, Luciana, Márcia, Mateus, Miriam, Renata Bueno, Renata Canevari, Renée, Rodrigo, Rogério, Sabrina, Sandra, Sandra Regina e Sara. e do CIPE – Hospital A. C. Camargo, Alex, Carol, Eloísa, Felipe, Gustavo, Rodrigo, Nair, Vera e Yukie. Cada um, de alguma forma, marcou a minha vida. Obrigada pelos momentos felizes, tristes, pelas ajudas nos experimentos, correções de relatório, tese e etc….enfim, pela história construída durante este tempo. Obrigada! “E amigos são prá sempre como eterno é nosso Deus. Como amigos nós diremos até breve, nunca adeus.” Á minha família, meus pais Jair e Gumercinda e minha irmã Rafaela, pelo amor, carinho e por sempre acreditarem nos meus sonhos. Vocês sabem que não foi fácil, mas com vocês ao meu lado, tudo se tornou mais simples. Amo vocês. Obrigada. À minha avó Cida, mesmo com diagnóstico de Mal de Alzheimer há sete anos, sou muito grata por ainda se lembrar de mim. Saiba que todas ás vezes que eu ouço da sra “A vó sempre ora pedindo prá Deus te guardar lá em São Paulo” isso me dá forças prá continuar. Ao Marcelo, por sua paciência e compreensão durante a realização deste trabalho. Sua presença, amor, carinho e senso de humor peculiar me ajudaram muito! Te amo! Aos meus amigos Fábio, Lucas e Virginei, por todas as vezes que eu volto para Araçatuba e me fazerem sentir como se eu nunca tivesse saído de lá! Mesmo longe, obrigada por existirem em minha vida. Á minha amiga Bruna, por sempre me fazer acreditar que a vida “é mais do que isso”. Obrigada pelas risadas e pelos conselhos! À todos da Igreja Metodista em Araçatuba e Botucatu pelas orações e amizade construída durante todo este tempo. Deus abençõe vocês! RESUMO Os Leiomiomas Uterinos (LU) são os tumores benignos mais comuns do trato genital feminino afetando entre 25-30% das mulheres em idade reprodutiva. Embora com etiologia pouca conhecida, estes tumores constituem um importante problema de saúde pública, sendo a principal indicação para histerectomia. Aproximadamente 40- 50% dos LU apresentam anormalidades citogenéticas não randômicas, portanto, a outra metade pode conter alterações submicroscópicas, como as alterações no número de cópias de DNA (CNVs). Estudos de expressão gênica globais têm revelado o envolvimento de genes que participam das vias de proliferação e ciclo celular, do ácido retinóico, sinalização TGF-beta e IGF-1 em resposta ao estrógeno e a progesterona. Entretanto, poucos genes mapeados em regiões de CNVs foram diretamente associados com o desenvolvimento dos LU. O objetivo deste estudo foi investigar alterações no número de cópias de DNA em pacientes com LU múltiplos e únicos. Utilizando a técnica de CGH array, foram avaliadas 80 amostras de LU obtidas de 56 pacientes. O perfil de expressão gênica global foi investigado em 51 amostras com o objetivo de identificar genes diferencialmente expressos em relação ao miométrio adjacente (MM). Posteriormente, os dados genômicos e transcriptômicos foram integrados com o objetivo de identificar CNVs funcionais que possam estar associadas ao fenótipo tumoral, sendo esta análise importante para a descrição de novos marcadores moleculares e possíveis alvos terapêuticos. Amostras de DNA e RNA foram obtidas dos LU e MM de pacientes nas fases proliferativa e secretora do ciclo menstrual. As 80 amostras de DNA tumoral e DNA referência universal foram digeridas, marcadas e hibridadas em lâminas Agilent Human 4x44K CGH Microarrays . Os dados foram analisados pelo programa Nexus v5.0 com o algoritmo Rank Segmentation e limiar de significância de 1,00E-4. A classificação de CNVs não casuais ( P≤0,05) foi baseada na presença em mais de10% dos casos e exclusão de CNVs presentes em mais de 5% da população controle. Cinquenta e uma amostras de RNA foram convertidas em cRNA marcados e foram hibridados em lâminas Agilent Whole Human Genome 4x44K . Foram aplicados os testes SAM, FDR<5%, 1000 permutações e agrupamento hierárquico não- supervisionado (HCL - correlação de Pearson ) pelo programa TMeV v.4.5, para identificar os genes diferencialmente expressos em relação ao MM. A classificação dos genes com aumento ou diminuição de expressão foi baseada em valores de fold-change com cut-off de 1.5. A integração dos dados foi realizada pelo algoritmo CONEXIC, com utilização da análise de enriquecimento de genes (GSEA) para a classificação de genes moduladores. Foram identificadas 45 CNVs significativas em 77/80 amostras (96%), sendo 25% dos casos com CNVs não casuais; 29 CNVs (64%) ainda não haviam sido descritas. Os ganhos genômicos mais frequentes foram em 2q35, 6p21.32, 7q22.1 e 11q12.3-q13.2 e perdas em 4q28.3, 7q22.1-q22.2 e 7q31.33. A análise de agrupamento hierárquico (teste exato de Fisher) revelou uma tendência de separação de dois grupos de amostras com tumores múltiplos (Grupo 1) e não múltiplos (Grupo 2). Foram observados ganhos em 2q35, 7q22.1, 19p13.12-p13.11 e 19q13.32-q13.33 ( P<0,01, tumores múltiplos) e perdas em 7q22.1-q22.2 ( P<0,01, tumores não-múltiplos). A análise funcional de redes e vias dos genes mapeados nas regiões significativas realizadas pelo sistema Ingenuity Pathway Analysis (IPA) revelou funções associadas i com proliferação celular, processos fibróides e expressão gênica. A análise funcional revelou que genes do Grupo 1 (ganhos) foram associados com processos de transcrição e proliferação celular e genes do Grupo 2 (perdas), com processos de organização e ciclo celular. A análise de expressão gênica global revelou 206 genes diferencialmente expressos em relação ao MM, no qual 34% apresentaram expressão aumentada (incluindo COL3A1, COL4A1, COL17A1, IGF1 ) e 66% diminuída (incluindo CDKN2A , JUN , FOS , PCNA ). Genes com expressão aumentada atuam principalmente na proliferação e matriz extracelular e genes com expressão diminuída participam dos processos de recombinação cromossômica e reparo a danos no DNA. A análise integrada dos dados revelou 75 genes moduladores, entre os quais 26 tiveram correlação positiva e 3 correlação negativa. Trinta e um genes com correlação inversa apresentaram regulação por miRNAs. A análise GSEA revelou 32/75 genes associados a módulos de genes de câncer. Entre estes genes, FGFR1, DBN1, NUPR1, COL3A1, AOC3, IFITM1, CALCRL, NOVA2, MVP, MFAP5, DIP2C apresentaram correlação positiva e CENPF , RHOH e BICD1 apresentaram correlação negativa. A análise funcional dos 75 genes moduladores revelou que eles atuam principalmente no ciclo celular e proliferação e crescimento celular, confirmando os achados independentes de CGH array e microarrays de expressão. Os genes FGFR1 e IGFBP5 foram associados com vias de proliferação e crescimento celular, enquanto que o COL3A1 foi associado com organização celular. Estes genes estavam localizados na periferia das redes e ligados indiretamente á fatores de transcrição, indicando que podem atuar indiretamente na transcrição de genes alvos. Em adição, os genes COL3A1 , IGFBP5 e FGFR1 foram associados à via canônica de proliferação da fibrose hepática e podem ser potenciais alvos terapêuticos. Os achados deste estudo permitiram descrever novas regiões de CNVs, além de confirmar o envolvimento de outras já descritas em LU. Estas CNVs envolvem genes associados principalmente com mecanismos transcricionais e ciclo celular. A análise de expressão gênica global revelou a diminuição da atividade de genes que controlam os processos de recombinação cromossômica e reparo a danos no DNA e genes com atividade aumentada associados com estímulos de proliferação e acúmulo da matriz extracelular. A nova estratégia de integração dos dados genômicos e transcriptômicos revelou novos marcadores moleculares com uso potencial para o tratamento do Leiomiomas Uterinos, uma doença frequente e com etiologia pouco conhecida. ii ABSTRACT Uterine leiomyomas (UL) are the most common benign tumors affecting between 25- 30% of women in reproductive age. Although little is known about its etiology, these tumors represent a major problem in public health being the main indication for hysterectomy. About 40-50% have nonrandom cytogenetic abnormalities, thus half of these tumors may have submicroscopic alterations, as well as copy number variations (CNVs). Global gene expression studies have shown genes that act in proliferation and cell cycle process, retinoic acid, TGF-beta and IGF-1 signaling in response to estrogen and progesterone. However, few genes mapped at CNVs regions were directly associated with the UL development. The aim of this study was to investigate DNA copy number alterations in patients with multiple and unique UL.
Recommended publications
  • Viewed Under 23 (B) Or 203 (C) fi M M Male Cko Mice, and Largely Unaffected Magni Cation; Scale Bars, 500 M (B) and 50 M (C)

    Viewed Under 23 (B) Or 203 (C) fi M M Male Cko Mice, and Largely Unaffected Magni Cation; Scale Bars, 500 M (B) and 50 M (C)

    BRIEF COMMUNICATION www.jasn.org Renal Fanconi Syndrome and Hypophosphatemic Rickets in the Absence of Xenotropic and Polytropic Retroviral Receptor in the Nephron Camille Ansermet,* Matthias B. Moor,* Gabriel Centeno,* Muriel Auberson,* † † ‡ Dorothy Zhang Hu, Roland Baron, Svetlana Nikolaeva,* Barbara Haenzi,* | Natalya Katanaeva,* Ivan Gautschi,* Vladimir Katanaev,*§ Samuel Rotman, Robert Koesters,¶ †† Laurent Schild,* Sylvain Pradervand,** Olivier Bonny,* and Dmitri Firsov* BRIEF COMMUNICATION *Department of Pharmacology and Toxicology and **Genomic Technologies Facility, University of Lausanne, Lausanne, Switzerland; †Department of Oral Medicine, Infection, and Immunity, Harvard School of Dental Medicine, Boston, Massachusetts; ‡Institute of Evolutionary Physiology and Biochemistry, St. Petersburg, Russia; §School of Biomedicine, Far Eastern Federal University, Vladivostok, Russia; |Services of Pathology and ††Nephrology, Department of Medicine, University Hospital of Lausanne, Lausanne, Switzerland; and ¶Université Pierre et Marie Curie, Paris, France ABSTRACT Tight control of extracellular and intracellular inorganic phosphate (Pi) levels is crit- leaves.4 Most recently, Legati et al. have ical to most biochemical and physiologic processes. Urinary Pi is freely filtered at the shown an association between genetic kidney glomerulus and is reabsorbed in the renal tubule by the action of the apical polymorphisms in Xpr1 and primary fa- sodium-dependent phosphate transporters, NaPi-IIa/NaPi-IIc/Pit2. However, the milial brain calcification disorder.5 How- molecular identity of the protein(s) participating in the basolateral Pi efflux remains ever, the role of XPR1 in the maintenance unknown. Evidence has suggested that xenotropic and polytropic retroviral recep- of Pi homeostasis remains unknown. Here, tor 1 (XPR1) might be involved in this process. Here, we show that conditional in- we addressed this issue in mice deficient for activation of Xpr1 in the renal tubule in mice resulted in impaired renal Pi Xpr1 in the nephron.
  • CCDC109B (MCUB) (NM 017918) Human Untagged Clone Product Data

    CCDC109B (MCUB) (NM 017918) Human Untagged Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC327798 CCDC109B (MCUB) (NM_017918) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: CCDC109B (MCUB) (NM_017918) Human Untagged Clone Tag: Tag Free Symbol: MCUB Synonyms: CCDC109B Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin Fully Sequenced ORF: >OriGene SC327798 ORF sequence for NM_017918, the custom clone sequence may differ by one or more nucleotides ATGTTGTCAACAGTTGGTTCATTCCTTCAGGACCTACAAAATGAAGATAAGGGTATCAAAACTGCAGCCA TCTTCACAGCAGATGGCAACATGATTTCAGCTTCTACCTTGATGGATATTTTGCTAATGAATGATTTTAA ACTTGTCATTAATAAAATAGCATATGATGTGCAGTGTCCAAAGAGAGAAAAACCAAGTAATGAGCACACT GCTGAGATGGAACACATGAAATCCTTGGTTCACAGACTATTTACAATCTTGCATTTAGAAGAGTCTCAGA AAAAGAGAGAGCACCATTTACTGGAGAAAATTGACCACCTGAAGGAACAGCTGCAGCCCCTTGAACAGGT GAAAGCTGGAATAGAAGCTCATTCGGAAGCCAAAACCAGTGGACTCCTGTGGGCTGGATTGGCACTGCTG TCCATTCAGGGTGGGGCACTGGCCTGGCTCACGTGGTGGGTGTACTCCTGGGATATCATGGAGCCAGTTA CATACTTCATCACATTTGCAAATTCTATGGTCTTTTTTGCATACTTTATAGTCACTCGACAGGATTATAC TTACTCAGCTGTTAAGAGTAGGCAATTTCTTCAGTTCTTCCACAAGAAATCAAAGCAACAGCACTTTGAT GTGCAGCAATACAACAAGTTAAAAGAAGACCTTGCTAAGGCTAAAGAATCCCTGAAACAGGCGCGTCATT CTCTCTGTTTGCAAATGCAAGTAGAAGAACTCAATGAAAAGAATTAA Restriction Sites: SgfI-MluI ACCN: NM_017918 OTI Disclaimer: Our molecular clone sequence data has been matched to the reference identifier above as a point
  • No Evidence of Association Between Complement Factor I Genetic Variant

    No Evidence of Association Between Complement Factor I Genetic Variant

    European Journal of Human Genetics (2012) 20, 1–3 & 2012 Macmillan Publishers Limited All rights reserved 1018-4813/12 www.nature.com/ejhg LETTERS US-based sample of around 1200 cases with advanced AMD and No evidence of association 800 controls. The association signal extended over a region of about 175 kb, the most associated variant (Po10À7)beingtheSNP rs10033900 near the complement factor I (CFI) gene. Two replication between complement studies2,3 published also in this journal provided some additional support for an AMD susceptibility locus in this region. In the course factor I genetic variant of candidate gene studies of AMD, we had previously investigated SNPs spanning CFI including rs10033900 in a UK case–control rs10033900 and sample, which shows the expected associations with the well- established AMD-susceptibility loci CFH, ARMS2, CFB and C3.No age-related macular evidence of association with the CFI variants was observed. Following publication of the reports cited above we have typed rs10033900 degeneration in additional cases and controls in two independent samples from England and Scotland to investigate this further. Full details of the phenotyping criteria have been reported pre- viously.4 The English sample comprised of 859 cases with predomi- European Journal of Human Genetics (2012) 20, 1–2; nantly advanced AMD, either geographic atrophy (GA) or choroidal doi:10.1038/ejhg.2011.118; published online 12 October 2011 neovascularisation (CNV) and 423 examined controls. The Scottish sample consisted of 505 cases with either intermediate disease (age-related maculopathy, ARM) or advanced AMD, and 351 exam- In 2008, an association between age-related macular degeneration ined controls.
  • Stelios Pavlidis3, Matthew Loza3, Fred Baribaud3, Anthony

    Stelios Pavlidis3, Matthew Loza3, Fred Baribaud3, Anthony

    Supplementary Data Th2 and non-Th2 molecular phenotypes of asthma using sputum transcriptomics in UBIOPRED Chih-Hsi Scott Kuo1.2, Stelios Pavlidis3, Matthew Loza3, Fred Baribaud3, Anthony Rowe3, Iaonnis Pandis2, Ana Sousa4, Julie Corfield5, Ratko Djukanovic6, Rene 7 7 8 2 1† Lutter , Peter J. Sterk , Charles Auffray , Yike Guo , Ian M. Adcock & Kian Fan 1†* # Chung on behalf of the U-BIOPRED consortium project team 1Airways Disease, National Heart & Lung Institute, Imperial College London, & Biomedical Research Unit, Biomedical Research Unit, Royal Brompton & Harefield NHS Trust, London, United Kingdom; 2Department of Computing & Data Science Institute, Imperial College London, United Kingdom; 3Janssen Research and Development, High Wycombe, Buckinghamshire, United Kingdom; 4Respiratory Therapeutic Unit, GSK, Stockley Park, United Kingdom; 5AstraZeneca R&D Molndal, Sweden and Areteva R&D, Nottingham, United Kingdom; 6Faculty of Medicine, Southampton University, Southampton, United Kingdom; 7Faculty of Medicine, University of Amsterdam, Amsterdam, Netherlands; 8European Institute for Systems Biology and Medicine, CNRS-ENS-UCBL, Université de Lyon, France. †Contributed equally #Consortium project team members are listed under Supplementary 1 Materials *To whom correspondence should be addressed: [email protected] 2 List of the U-BIOPRED Consortium project team members Uruj Hoda & Christos Rossios, Airways Disease, National Heart & Lung Institute, Imperial College London, UK & Biomedical Research Unit, Biomedical Research Unit, Royal
  • Primate Specific Retrotransposons, Svas, in the Evolution of Networks That Alter Brain Function

    Primate Specific Retrotransposons, Svas, in the Evolution of Networks That Alter Brain Function

    Title: Primate specific retrotransposons, SVAs, in the evolution of networks that alter brain function. Olga Vasieva1*, Sultan Cetiner1, Abigail Savage2, Gerald G. Schumann3, Vivien J Bubb2, John P Quinn2*, 1 Institute of Integrative Biology, University of Liverpool, Liverpool, L69 7ZB, U.K 2 Department of Molecular and Clinical Pharmacology, Institute of Translational Medicine, The University of Liverpool, Liverpool L69 3BX, UK 3 Division of Medical Biotechnology, Paul-Ehrlich-Institut, Langen, D-63225 Germany *. Corresponding author Olga Vasieva: Institute of Integrative Biology, Department of Comparative genomics, University of Liverpool, Liverpool, L69 7ZB, [email protected] ; Tel: (+44) 151 795 4456; FAX:(+44) 151 795 4406 John Quinn: Department of Molecular and Clinical Pharmacology, Institute of Translational Medicine, The University of Liverpool, Liverpool L69 3BX, UK, [email protected]; Tel: (+44) 151 794 5498. Key words: SVA, trans-mobilisation, behaviour, brain, evolution, psychiatric disorders 1 Abstract The hominid-specific non-LTR retrotransposon termed SINE–VNTR–Alu (SVA) is the youngest of the transposable elements in the human genome. The propagation of the most ancient SVA type A took place about 13.5 Myrs ago, and the youngest SVA types appeared in the human genome after the chimpanzee divergence. Functional enrichment analysis of genes associated with SVA insertions demonstrated their strong link to multiple ontological categories attributed to brain function and the disorders. SVA types that expanded their presence in the human genome at different stages of hominoid life history were also associated with progressively evolving behavioural features that indicated a potential impact of SVA propagation on a cognitive ability of a modern human.
  • Bud13 Promotes a Type I Interferon Response by Countering Intron

    Bud13 Promotes a Type I Interferon Response by Countering Intron

    bioRxiv preprint doi: https://doi.org/10.1101/443820; this version posted October 15, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 2 3 4 5 6 7 8 9 Bud13 Promotes a Type I Interferon Response by 10 Countering Intron Retention in Irf7 11 12 13 Luke S. Frankiw1,2, Devdoot Majumdar1,2, Christian Burns1, Logan Vlach1, Annie Moradian1, 14 Michael J. Sweredoski1, David Baltimore1,3* 15 16 1Division of Biology and Biological Engineering, California Institute of Technology, Pasadena, CA 91125, 17 USA 18 2These authors contributed equally 19 3Lead Contact 20 *Correspondence: [email protected] 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 bioRxiv preprint doi: https://doi.org/10.1101/443820; this version posted October 15, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 53 SUMMARY 54 55 Intron retention (IR) has emerged as an important mechanism of gene expression control. Despite 56 this, the factors that control IR events remain poorly understood. We observed consistent IR in one 57 intron of the Irf7 gene and identified Bud13 as an RNA-binding protein that acts at this intron to 58 increase the amount of successful splicing. Deficiency in Bud13 led to increased IR, decreased 59 mature Irf7 transcript and protein levels, and consequently to a dampened type I interferon 60 response.
  • Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation

    Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation

    BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
  • CCDC109B CRISPR/Cas9 KO Plasmid (M): Sc-426204

    CCDC109B CRISPR/Cas9 KO Plasmid (M): Sc-426204

    SAN TA C RUZ BI OTEC HNOL OG Y, INC . CCDC109B CRISPR/Cas9 KO Plasmid (m): sc-426204 BACKGROUND APPLICATIONS The Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and CCDC109B CRISPR/Cas9 KO Plasmid (m) is recommended for the disruption CRISPR-associated protein (Cas9) system is an adaptive immune response of gene expression in mouse cells. defense mechanism used by archea and bacteria for the degradation of foreign genetic material (4,6). This mechanism can be repurposed for other 20 nt non-coding RNA sequence: guides Cas9 functions, including genomic engineering for mammalian systems, such as to a specific target location in the genomic DNA gene knockout (KO) (1,2,3,5). CRISPR/Cas9 KO Plasmid products enable the U6 promoter: drives gRNA scaffold: helps Cas9 identification and cleavage of specific genes by utilizing guide RNA (gRNA) expression of gRNA bind to target DNA sequences derived from the Genome-scale CRISPR Knock-Out (GeCKO) v2 library developed in the Zhang Laboratory at the Broad Institute (3,5). Termination signal Green Fluorescent Protein: to visually REFERENCES verify transfection CRISPR/Cas9 Knockout Plasmid CBh (chicken β-Actin 1. Cong, L., et al. 2013. Multiplex genome engineering using CRISPR/Cas hybrid) promoter: drives expression of Cas9 systems. Science 339: 819-823. 2A peptide: allows production of both Cas9 and GFP from the 2. Mali, P., et al. 2013. RNA-guided human genome engineering via Cas9. same CBh promoter Science 339: 823-826. Nuclear localization signal 3. Ran, F.A., et al. 2013. Genome engineering using the CRISPR-Cas9 system . Nuclear localization signal SpCas9 ribonuclease Nat.
  • Identification of Expression Qtls Targeting Candidate Genes For

    Identification of Expression Qtls Targeting Candidate Genes For

    ISSN: 2378-3648 Salleh et al. J Genet Genome Res 2018, 5:035 DOI: 10.23937/2378-3648/1410035 Volume 5 | Issue 1 Journal of Open Access Genetics and Genome Research RESEARCH ARTICLE Identification of Expression QTLs Targeting Candidate Genes for Residual Feed Intake in Dairy Cattle Using Systems Genomics Salleh MS1,2, Mazzoni G2, Nielsen MO1, Løvendahl P3 and Kadarmideen HN2,4* 1Department of Veterinary and Animal Sciences, Faculty of Health and Medical Sciences, University of Copenhagen, Denmark Check for 2Department of Bio and Health Informatics, Technical University of Denmark, Lyngby, Denmark updates 3Department of Molecular Biology and Genetics-Center for Quantitative Genetics and Genomics, Aarhus University, AU Foulum, Tjele, Denmark 4Department of Applied Mathematics and Computer Science, Technical University of Denmark, Lyngby, Denmark *Corresponding author: Kadarmideen HN, Department of Applied Mathematics and Computer Science, Technical University of Denmark, DK-2800, Kgs. Lyngby, Denmark, E-mail: [email protected] Abstract body weight gain and net merit). The eQTLs and biological pathways identified in this study improve our understanding Background: Residual feed intake (RFI) is the difference of the complex biological and genetic mechanisms that de- between actual and predicted feed intake and an important termine FE traits in dairy cattle. The identified eQTLs/genet- factor determining feed efficiency (FE). Recently, 170 can- ic variants can potentially be used in new genomic selection didate genes were associated with RFI, but no expression methods that include biological/functional information on quantitative trait loci (eQTL) mapping has hitherto been per- SNPs. formed on FE related genes in dairy cows. In this study, an integrative systems genetics approach was applied to map Keywords eQTLs in Holstein and Jersey cows fed two different diets to eQTL, RNA-seq, Genotype, Data integration, Systems improve identification of candidate genes for FE.
  • PRODUCT SPECIFICATION Product Datasheet

    PRODUCT SPECIFICATION Product Datasheet

    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST MCUB Mass Spectrometry Protein Standard Product Number QPrEST37525 Protein Name Mitochondrial calcium uniporter regulatory subunit MCUb Uniprot ID Q9NWR8 Gene CCDC109B Product Description Stable isotope-labeled standard for absolute protein quantification of Mitochondrial calcium uniporter regulatory subunit MCUb. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding ERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISASTLMDIL fusion tag) LMNDFKLVINKIAYDVQCPKRE Theoretical MW 25882 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
  • Expression of Mrna Encoding Mcu and Other Mitochondrial Calcium Regulatory Genes Depends on Cell Type, Neuronal

    Expression of Mrna Encoding Mcu and Other Mitochondrial Calcium Regulatory Genes Depends on Cell Type, Neuronal

    Edinburgh Research Explorer Expression of mRNA Encoding Mcu and Other Mitochondrial Calcium Regulatory Genes Depends on Cell Type, Neuronal Subtype, and Ca2+ Signaling Citation for published version: Work enabled by Edinburgh Genomics 2016, 'Expression of mRNA Encoding Mcu and Other Mitochondrial Calcium Regulatory Genes Depends on Cell Type, Neuronal Subtype, and Ca2+ Signaling', PLoS ONE, vol. 11, no. 2, 0148164. https://doi.org/10.1371/journal.pone.0148164 Digital Object Identifier (DOI): 10.1371/journal.pone.0148164 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: PLoS ONE Publisher Rights Statement: Copyright: © 2016 Márkus et al. This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 04. Oct. 2021 RESEARCH ARTICLE Expression of mRNA Encoding Mcu and Other Mitochondrial Calcium Regulatory Genes Depends on Cell Type, Neuronal Subtype, and Ca2+ Signaling Nóra M.
  • CCDC109B (MCUB) (NM 017918) Human Tagged ORF Clone Product Data

    CCDC109B (MCUB) (NM 017918) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC229163L1 CCDC109B (MCUB) (NM_017918) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CCDC109B (MCUB) (NM_017918) Human Tagged ORF Clone Tag: Myc-DDK Symbol: MCUB Synonyms: CCDC109B Vector: pLenti-C-Myc-DDK (PS100064) E. coli Selection: Chloramphenicol (34 ug/mL) Cell Selection: None ORF Nucleotide The ORF insert of this clone is exactly the same as(RC229163). Sequence: Restriction Sites: SgfI-MluI Cloning Scheme: ACCN: NM_017918 ORF Size: 744 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 CCDC109B (MCUB) (NM_017918) Human Tagged ORF Clone – RC229163L1 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_017918.4, NP_060388.1 RefSeq Size: 1298 bp RefSeq ORF: 1011 bp Locus ID: 55013 UniProt ID: Q9NWR8 Domains: DUF607 Protein Families: Transmembrane MW: 28.8 kDa Gene Summary: Negatively regulates the activity of MCU, the mitochondrial inner membrane calcium uniporter, and thereby modulates calcium uptake into the mitochondrion.