DOCSLIB.ORG

1 Supplementary Table 1

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
1 Supplementary Table 1 Supplementary Table 1: Reference Reference Sample MSI Test / Study ID 829 gene 192 gene Type status Training classifier classifier Giacomin et al CRC cell line NCI-H508 MSS Training Y Y Giacomini et al CRC cell line LS-180 MSI Training Y Y Giacomini et al CRC cell line LS-174T MSI Training Y Y Giacomini et al CRC cell line SW-403 MSS Training Y Y Giacomini et al CRC cell line HCT116 MSI Training Y Y Giacomini et al CRC cell line LS411 MSI Test Giacomini et al CRC cell line T84 MSS Test Giacomini et al CRC cell line SW-480 MSS Training Y Y Giacomini et al CRC cell line COLO741 MSS Test Giacomini et al CRC cell line COLO320 MSS Test Giacomini et al CRC cell line DLD-1 MSI Training Y Y Giacomini et al CRC cell line COLO205 MSS Test Giacomini et al CRC cell line HT-29 MSS Training Y Y Giacomini et al CRC cell line SW620 MSS Training Y Y Giacomini et al CRC cell line LIM2412 MSI Test Giacomini et al CRC cell line SW-1116 MSS Training Y Y Giacomini et al CRC cell line LIM1215 MSI Test Giacomini et al CRC cell line RKO MSI Training Y Y Giacomini et al CRC cell line HCT15 MSI Training Y Y Giacomini et al CRC cell line GP5D MSI Training Y Y Giacomini et al CRC cell line SW48 MSI Training Y Y Giacomini et al CRC cell line SK-CO-1 MSS Training Y Y Giacomini et al CRC cell line HCA7 MSI Test Giacomini et al CRC cell line SNUC2B MSI Test Giacomini et al CRC cell line SW1417 MSS Test Giacomini et al CRC cell line SW948 MSS Test Giacomini et al CRC cell line GP2D MSI Training Y Y Giacomini et al CRC cell line LOVO MSI Training Y Y Giacomini et al CRC cell line SW-837 MSS Training Y Y Giacomini et al CRC cell line NCI-H747 MSS Training Y Y Giacomini et al CRC cell line CACO-2 MSS Training Y Y Koinuma et al Primary CRC 225 MSI Training Y Y Koinuma et al Primary CRC 263 MSI Training Y Y Koinuma et al Primary CRC 280 MSI Training Y Y Koinuma et al Primary CRC 305 MSI Training Y Y Koinuma et al Primary CRC 318 MSI Training Y Y Koinuma et al Primary CRC 336 MSI Training Y Y Koinuma et al Primary CRC 413 MSI Training Y Y Koinuma et al Primary CRC 416 MSI Training Y Y Koinuma et al Primary CRC 433 MSI Training Y Y Koinuma et al Primary CRC 479 MSI Training Y Y Koinuma et al Primary CRC 238 MSS Training Y Y Koinuma et al Primary CRC 249 MSS Training Y Y Koinuma et al Primary CRC 278 MSS Training Y Y 1 Koinuma et al Primary CRC 295 MSS Training Y Y Koinuma et al Primary CRC 298 MSS Training Y Y Koinuma et al Primary CRC 307 MSS Training Y Y Koinuma et al Primary CRC 308 MSS Training Y Y Koinuma et al Primary CRC 319 MSS Training Y Y Koinuma et al Primary CRC 419 MSS Training Y Y Koinuma et al Primary CRC 426 MSS Training Y Y Watanabe et al Primary CRC Patient_01 MSS Training Y Y Watanabe et al Primary CRC Patient_02 MSS Training Y Y Watanabe et al Primary CRC Patient_03 MSI Test Watanabe et al Primary CRC Patient_04 MSS Training Y Y Watanabe et al Primary CRC Patient_05 MSI Test Watanabe et al Primary CRC Patient_06 MSS Training Watanabe et al Primary CRC Patient_07 MSS Test Watanabe et al Primary CRC Patient_08 MSS Training Y Y Watanabe et al Primary CRC Patient_09 MSS Training Watanabe et al Primary CRC Patient_10 MSS Test Watanabe et al Primary CRC Patient_11 MSS Test Watanabe et al Primary CRC Patient_12 MSS Training Y Y Watanabe et al Primary CRC Patient_13 MSS Training Y Y Watanabe et al Primary CRC Patient_14 MSS Training Watanabe et al Primary CRC Patient_15 MSI Test Watanabe et al Primary CRC Patient_16 MSI Training Y Y Watanabe et al Primary CRC Patient_17 MSS Test Watanabe et al Primary CRC Patient_18 MSS Training Y Y Watanabe et al Primary CRC Patient_19 MSI Training Y Y Watanabe et al Primary CRC Patient_20 MSI Training Y Y Watanabe et al Primary CRC Patient_21 MSS Test Watanabe et al Primary CRC Patient_22 MSI Training Y Y Watanabe et al Primary CRC Patient_23 MSS Test Watanabe et al Primary CRC Patient_24 MSS Training Y Y Watanabe et al Primary CRC Patient_25 MSS Test Watanabe et al Primary CRC Patient_26 MSS Training Y Y Watanabe et al Primary CRC Patient_27 MSS Test Watanabe et al Primary CRC Patient_28 MSS Test Watanabe et al Primary CRC Patient_29 MSS Training Y Y Watanabe et al Primary CRC Patient_30 MSS Training Y Y Watanabe et al Primary CRC Patient_31 MSS Training Y Y Watanabe et al Primary CRC Patient_32 MSS Test Watanabe et al Primary CRC Patient_33 MSS Training Y Y Watanabe et al Primary CRC Patient_34 MSS Training Y Y Watanabe et al Primary CRC Patient_35 MSS Training Y Y Watanabe et al Primary CRC Patient_36 MSS Training Y Y Watanabe et al Primary CRC Patient_37 MSS Training Y Y Watanabe et al Primary CRC Patient_38 MSS Training Y Y Watanabe et al Primary CRC Patient_39 MSS Training Y Y Watanabe et al Primary CRC Patient_40 MSS Test Watanabe et al Primary CRC Patient_41 MSS Training Y Y 2 Watanabe et al Primary CRC Patient_42 MSS Training Y Y Watanabe et al Primary CRC Patient_43 MSS Training Y Y Watanabe et al Primary CRC Patient_44 MSS Test Watanabe et al Primary CRC Patient_45 MSS Training Y Y Watanabe et al Primary CRC Patient_46 MSS Training Y Y Watanabe et al Primary CRC Patient_47 MSI Training Y Y Watanabe et al Primary CRC Patient_48 MSI Training Y Y Watanabe et al Primary CRC Patient_49 MSS Training Y Y Watanabe et al Primary CRC Patient_50 MSS Training Y Y Watanabe et al Primary CRC Patient_51 MSS Training Y Y Watanabe et al Primary CRC Patient_52 MSS Training Y Y Watanabe et al Primary CRC Patient_53 MSS Test Watanabe et al Primary CRC Patient_54 MSI Test Watanabe et al Primary CRC Patient_55 MSS Training Watanabe et al Primary CRC Patient_56 MSS Training Y Y Watanabe et al Primary CRC Patient_57 MSS Training Watanabe et al Primary CRC Patient_58 MSS Training Y Y Watanabe et al Primary CRC Patient_59 MSS Training Y Y Watanabe et al Primary CRC Patient_60 MSI Training Y Y Watanabe et al Primary CRC Patient_61 MSI Training Y Y Watanabe et al Primary CRC Patient_62 MSI Test Watanabe et al Primary CRC Patient_63 MSI Training Y Y Watanabe et al Primary CRC Patient_64 MSI Training Y Y Watanabe et al Primary CRC Patient_65 MSI Training Y Y Watanabe et al Primary CRC Patient_66 MSI Training Y Y Watanabe et al Primary CRC Patient_67 MSI Training Y Y Watanabe et al Primary CRC Patient_68 MSI Training Y Y Watanabe et al Primary CRC Patient_69 MSI Training Y Y Watanabe et al Primary CRC Patient_70 MSI Training Y Y Watanabe et al Primary CRC Patient_71 MSI Training Y Y Watanabe et al Primary CRC Patient_72 MSI Test Watanabe et al Primary CRC Patient_73 MSI Test Watanabe et al Primary CRC Patient_74 MSI Training Y Y Watanabe et al Primary CRC Patient_75 MSI Training Y Y Watanabe et al Primary CRC Patient_76 MSI Test Watanabe et al Primary CRC Patient_77 MSI Training Y Y Watanabe et al Primary CRC Patient_78 MSI Training Y Y Watanabe et al Primary CRC Patient_79 MSI Test Watanabe et al Primary CRC Patient_80 MSI Training Watanabe et al Primary CRC Patient_81 MSI Training Y Y Watanabe et al Primary CRC Patient_82 MSI Training Y Y Watanabe et al Primary CRC Patient_83 MSS Test Watanabe et al Primary CRC Patient_84 MSS Test Aarhus University Hospital Primary CRC R001 MSS Training Y Y Aarhus University Hospital Primary CRC R002 MSI Training Y Y Aarhus University Hospital Primary CRC R003 MSS Test Aarhus University Hospital Primary CRC R004 MSS Training Y Y Aarhus University Hospital Primary CRC R005 MSS Training Y Y 3 Aarhus University Hospital Primary CRC R006 MSS Training Y Y Aarhus University Hospital Primary CRC R007 MSS Training Y Y Aarhus University Hospital Primary CRC R008 MSS Test Aarhus University Hospital Primary CRC R009 MSI Test Aarhus University Hospital Primary CRC R010 MSI Training Y Y Aarhus University Hospital Primary CRC R011 MSS Training Y Y Aarhus University Hospital Primary CRC R012 MSS Test Aarhus University Hospital Primary CRC R013 MSS Training Y Aarhus University Hospital Primary CRC R014 MSS Test Aarhus University Hospital Primary CRC R015 MSS Test Aarhus University Hospital Primary CRC R016 MSI Training Y Y Aarhus University Hospital Primary CRC R017 MSS Test Aarhus University Hospital Primary CRC R018 MSI Training Y Y Aarhus University Hospital Primary CRC R019 MSS Training Y Y Aarhus University Hospital Primary CRC R020 MSI Training Y Y Aarhus University Hospital Primary CRC R021 MSI Training Y Y Aarhus University Hospital Primary CRC R022 MSS Training Y Y Aarhus University Hospital Primary CRC R023 MSI Training Y Y Aarhus University Hospital Primary CRC R024 MSS Training Y Y Aarhus University Hospital Primary CRC R025 MSS Training Y Y Aarhus University Hospital Primary CRC R026 MSS Training Y Y Aarhus University Hospital Primary CRC R027 MSS Training Y Y Aarhus University Hospital Primary CRC R028 MSS Training Y Y Aarhus University Hospital Primary CRC R029 MSS Test Aarhus University Hospital Primary CRC R030 MSS Training Y Y Aarhus University Hospital Primary CRC R031 MSS Test Aarhus University Hospital Primary CRC R035 MSI Test Aarhus University Hospital Primary CRC R040 MSI Test Aarhus University Hospital Primary CRC R056 MSI Test Aarhus University Hospital Primary CRC R059 MSI Training Y Y Aarhus University Hospital Primary CRC R073 MSI Training Y Y Aarhus University Hospital Primary CRC R077 MSI Test Aarhus University Hospital Primary CRC R088 MSS Test Aarhus University Hospital Primary CRC R089 MSS Test Aarhus University Hospital Primary CRC R090 MSS Training Y Y Aarhus University Hospital Primary CRC R091 MSS Training Y Y Aarhus University Hospital Primary CRC R092 MSI Training Y Y Aarhus University Hospital Primary CRC R093 MSS Training Y Y Aarhus University Hospital Primary CRC R094
Load more

Recommended publications
  • Supporting Information for Proteomics DOI 10.1002/Pmic.200400896
    Supporting Information for Proteomics DOI 10.1002/pmic.200400896 Odette Prat, Frdric Berenguer, Vronique Malard, Emmanuelle Tavan, Nicole Sage, Grard Steinmetz and Eric Quemeneur Transcriptomic and proteomic responses of human renal HEK293 cells to uranium toxicity ª 2004 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim www.proteomics-journal.de Table 1 : Differentially expressed genes in HEK293 cells treated with uranium at CI50 , CI30 and CI20. GENE ID GENE DESCRIPTION CI50 CI30 CI20 AANAT arylalkylamine N-acetyltransferase 1.66 AASDHPPT aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase -1.73 ABCC8 ATP-binding cassette, sub-family C (CFTR/MRP), member 8 2.96 2.9 ABCF2 ATP-binding cassette, sub-family F (GCN20), member 2 1.86 ACAT2 acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase) -2.47 ACTB actin, beta -2.12 ACTR2 ARP2 actin-related protein 2 homolog (yeast) -1.94 ADAR adenosine deaminase, RNA-specific 1.87 1.92 ADNP activity-dependent neuroprotector -1.03 ADPRTL1 ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 1 1.48 2.31 2.1 AKAP1 A kinase (PRKA) anchor protein 1 1.59 AKR1C3 aldo-keto reductase family 1, member C3 -1.37 (3-alpha hydroxysteroid dehydrogenase, type II) ALS2CR3 amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 3 -1.21 APBB1 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) 4.41 APC adenomatosis polyposis coli -1.66 APP amyloid beta (A4) precursor protein (protease nexin-II, Alzheimer disease) -1.32 APPBP1 amyloid beta precursor
    [Show full text]
  • The Reticulons: a Family of Proteins with Diverse Functions Yvonne S Yang and Stephen M Strittmatter
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by PubMed Central Protein family review The reticulons: a family of proteins with diverse functions Yvonne S Yang and Stephen M Strittmatter Address: Program in Cellular Neuroscience, Neurodegeneration and Repair, Department of Neurology, Yale University School of Medicine, New Haven, CT 06536, USA. Correspondence: Stephen M Strittmatter. Email: [email protected] Published: 28 December 2007 Genome Biology 2007, 8:234 (doi:10.1186/gb-2007-8-12-234) The electronic version of this article is the complete one and can be found online at http://genomebiology.com/2007/8/12/234 © 2007 BioMed Central Ltd Summary The reticulon family is a large and diverse group of membrane-associated proteins found throughout the eukaryotic kingdom. All of its members contain a carboxy-terminal reticulon homology domain that consists of two hydrophobic regions flanking a hydrophilic loop of 60-70 amino acids, but reticulon amino-terminal domains display little or no similarity to each other. Reticulons principally localize to the endoplasmic reticulum, and there is evidence that they influence endoplasmic reticulum-Golgi trafficking, vesicle formation and membrane morphogenesis. However, mammalian reticulons have also been found on the cell surface and mammalian reticulon 4 expressed on the surface of oligodendrocytes is an inhibitor of axon growth both in culture and in vivo. There is also growing evidence that reticulons may be important in neurodegenerative diseases such as Alzheimer’s disease and amyotrophic lateral sclerosis. The diversity of structure, topology, localization and expression patterns of reticulons is reflected in their multiple, diverse functions in the cell.
    [Show full text]
  • The Atypical Guanine-Nucleotide Exchange Factor, Dock7, Negatively Regulates Schwann Cell Differentiation and Myelination
    The Journal of Neuroscience, August 31, 2011 • 31(35):12579–12592 • 12579 Cellular/Molecular The Atypical Guanine-Nucleotide Exchange Factor, Dock7, Negatively Regulates Schwann Cell Differentiation and Myelination Junji Yamauchi,1,3,5 Yuki Miyamoto,1 Hajime Hamasaki,1,3 Atsushi Sanbe,1 Shinji Kusakawa,1 Akane Nakamura,2 Hideki Tsumura,2 Masahiro Maeda,4 Noriko Nemoto,6 Katsumasa Kawahara,5 Tomohiro Torii,1 and Akito Tanoue1 1Department of Pharmacology and 2Laboratory Animal Resource Facility, National Research Institute for Child Health and Development, Setagaya, Tokyo 157-8535, Japan, 3Department of Biological Sciences, Tokyo Institute of Technology, Midori, Yokohama 226-8501, Japan, 4IBL, Ltd., Fujioka, Gumma 375-0005, Japan, and 5Department of Physiology and 6Bioimaging Research Center, Kitasato University School of Medicine, Sagamihara, Kanagawa 252-0374, Japan In development of the peripheral nervous system, Schwann cells proliferate, migrate, and ultimately differentiate to form myelin sheath. In all of the myelination stages, Schwann cells continuously undergo morphological changes; however, little is known about their underlying molecular mechanisms. We previously cloned the dock7 gene encoding the atypical Rho family guanine-nucleotide exchange factor (GEF) and reported the positive role of Dock7, the target Rho GTPases Rac/Cdc42, and the downstream c-Jun N-terminal kinase in Schwann cell migration (Yamauchi et al., 2008). We investigated the role of Dock7 in Schwann cell differentiation and myelination. Knockdown of Dock7 by the specific small interfering (si)RNA in primary Schwann cells promotes dibutyryl cAMP-induced morpholog- ical differentiation, indicating the negative role of Dock7 in Schwann cell differentiation. It also results in a shorter duration of activation of Rac/Cdc42 and JNK, which is the negative regulator of myelination, and the earlier activation of Rho and Rho-kinase, which is the positive regulator of myelination.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Related Malignant Phenotypes in the Nf1-Deficient MPNST
    Published OnlineFirst February 19, 2013; DOI: 10.1158/1541-7786.MCR-12-0593 Molecular Cancer Genomics Research RAS/MEK–Independent Gene Expression Reveals BMP2- Related Malignant Phenotypes in the Nf1-Deficient MPNST Daochun Sun1, Ramsi Haddad2,3, Janice M. Kraniak2, Steven D. Horne1, and Michael A. Tainsky1,2 Abstract Malignant peripheral nerve sheath tumor (MPNST) is a type of soft tissue sarcoma that occurs in carriers of germline mutations in Nf1 gene as well as sporadically. Neurofibromin, encoded by the Nf1 gene, functions as a GTPase-activating protein (GAP) whose mutation leads to activation of wt-RAS and mitogen-activated protein kinase (MAPK) signaling in neurofibromatosis type I (NF1) patients' tumors. However, therapeutic targeting of RAS and MAPK have had limited success in this disease. In this study, we modulated NRAS, mitogen-activated protein/extracellular signal–regulated kinase (MEK)1/2, and neurofibromin levels in MPNST cells and determined gene expression changes to evaluate the regulation of signaling pathways in MPNST cells. Gene expression changes due to neurofibromin modulation but independent of NRAS and MEK1/2 regulation in MPNST cells indicated bone morphogenetic protein 2 (Bmp2) signaling as a key pathway. The BMP2-SMAD1/5/8 pathway was activated in NF1-associated MPNST cells and inhibition of BMP2 signaling by LDN-193189 or short hairpin RNA (shRNA) to BMP2 decreased the motility and invasion of NF1-associated MPNST cells. The pathway-specific gene changes provide a greater understanding of the complex role of neurofibromin in MPNST pathology and novel targets for drug discovery. Mol Cancer Res; 11(6); 616–27.
    [Show full text]
  • Androgen Receptor Interacting Proteins and Coregulators Table
    ANDROGEN RECEPTOR INTERACTING PROTEINS AND COREGULATORS TABLE Compiled by: Lenore K. Beitel, Ph.D. Lady Davis Institute for Medical Research 3755 Cote Ste Catherine Rd, Montreal, Quebec H3T 1E2 Canada Telephone: 514-340-8260 Fax: 514-340-7502 E-Mail: [email protected] Internet: http://androgendb.mcgill.ca Date of this version: 2010-08-03 (includes articles published as of 2009-12-31) Table Legend: Gene: Official symbol with hyperlink to NCBI Entrez Gene entry Protein: Protein name Preferred Name: NCBI Entrez Gene preferred name and alternate names Function: General protein function, categorized as in Heemers HV and Tindall DJ. Endocrine Reviews 28: 778-808, 2007. Coregulator: CoA, coactivator; coR, corepressor; -, not reported/no effect Interactn: Type of interaction. Direct, interacts directly with androgen receptor (AR); indirect, indirect interaction; -, not reported Domain: Interacts with specified AR domain. FL-AR, full-length AR; NTD, N-terminal domain; DBD, DNA-binding domain; h, hinge; LBD, ligand-binding domain; C-term, C-terminal; -, not reported References: Selected references with hyperlink to PubMed abstract. Note: Due to space limitations, all references for each AR-interacting protein/coregulator could not be cited. The reader is advised to consult PubMed for additional references. Also known as: Alternate gene names Gene Protein Preferred Name Function Coregulator Interactn Domain References Also known as AATF AATF/Che-1 apoptosis cell cycle coA direct FL-AR Leister P et al. Signal Transduction 3:17-25, 2003 DED; CHE1; antagonizing regulator Burgdorf S et al. J Biol Chem 279:17524-17534, 2004 CHE-1; AATF transcription factor ACTB actin, beta actin, cytoplasmic 1; cytoskeletal coA - - Ting HJ et al.
    [Show full text]
  • A Rac/Cdc42 Exchange Factor Complex Promotes Formation of Lateral filopodia and Blood Vessel Lumen Morphogenesis
    ARTICLE Received 1 Oct 2014 | Accepted 26 Apr 2015 | Published 1 Jul 2015 DOI: 10.1038/ncomms8286 OPEN A Rac/Cdc42 exchange factor complex promotes formation of lateral filopodia and blood vessel lumen morphogenesis Sabu Abraham1,w,*, Margherita Scarcia2,w,*, Richard D. Bagshaw3,w,*, Kathryn McMahon2,w, Gary Grant2, Tracey Harvey2,w, Maggie Yeo1, Filomena O.G. Esteves2, Helene H. Thygesen2,w, Pamela F. Jones4, Valerie Speirs2, Andrew M. Hanby2, Peter J. Selby2, Mihaela Lorger2, T. Neil Dear4,w, Tony Pawson3,z, Christopher J. Marshall1 & Georgia Mavria2 During angiogenesis, Rho-GTPases influence endothelial cell migration and cell–cell adhesion; however it is not known whether they control formation of vessel lumens, which are essential for blood flow. Here, using an organotypic system that recapitulates distinct stages of VEGF-dependent angiogenesis, we show that lumen formation requires early cytoskeletal remodelling and lateral cell–cell contacts, mediated through the RAC1 guanine nucleotide exchange factor (GEF) DOCK4 (dedicator of cytokinesis 4). DOCK4 signalling is necessary for lateral filopodial protrusions and tubule remodelling prior to lumen formation, whereas proximal, tip filopodia persist in the absence of DOCK4. VEGF-dependent Rac activation via DOCK4 is necessary for CDC42 activation to signal filopodia formation and depends on the activation of RHOG through the RHOG GEF, SGEF. VEGF promotes interaction of DOCK4 with the CDC42 GEF DOCK9. These studies identify a novel Rho-family GTPase activation cascade for the formation of endothelial cell filopodial protrusions necessary for tubule remodelling, thereby influencing subsequent stages of lumen morphogenesis. 1 Institute of Cancer Research, Division of Cancer Biology, 237 Fulham Road, London SW3 6JB, UK.
    [Show full text]
  • Genome-Wide Analysis of Androgen Receptor Binding and Gene Regulation in Two CWR22-Derived Prostate Cancer Cell Lines
    Endocrine-Related Cancer (2010) 17 857–873 Genome-wide analysis of androgen receptor binding and gene regulation in two CWR22-derived prostate cancer cell lines Honglin Chen1, Stephen J Libertini1,4, Michael George1, Satya Dandekar1, Clifford G Tepper 2, Bushra Al-Bataina1, Hsing-Jien Kung2,3, Paramita M Ghosh2,3 and Maria Mudryj1,4 1Department of Medical Microbiology and Immunology, University of California Davis, 3147 Tupper Hall, Davis, California 95616, USA 2Division of Basic Sciences, Department of Biochemistry and Molecular Medicine, Cancer Center and 3Department of Urology, University of California Davis, Sacramento, California 95817, USA 4Veterans Affairs Northern California Health Care System, Mather, California 95655, USA (Correspondence should be addressed to M Mudryj at Department of Medical Microbiology and Immunology, University of California, Davis; Email: [email protected]) Abstract Prostate carcinoma (CaP) is a heterogeneous multifocal disease where gene expression and regulation are altered not only with disease progression but also between metastatic lesions. The androgen receptor (AR) regulates the growth of metastatic CaPs; however, sensitivity to androgen ablation is short lived, yielding to emergence of castrate-resistant CaP (CRCaP). CRCaP prostate cancers continue to express the AR, a pivotal prostate regulator, but it is not known whether the AR targets similar or different genes in different castrate-resistant cells. In this study, we investigated AR binding and AR-dependent transcription in two related castrate-resistant cell lines derived from androgen-dependent CWR22-relapsed tumors: CWR22Rv1 (Rv1) and CWR-R1 (R1). Expression microarray analysis revealed that R1 and Rv1 cells had significantly different gene expression profiles individually and in response to androgen.
    [Show full text]
  • Anti-CRK Monoclonal Antibody, Clone 4H22D2 (DCABH-1226) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-CRK monoclonal antibody, clone 4H22D2 (DCABH-1226) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview Mouse monoclonal to Crk p38 Antigen Description The Crk-I and Crk-II forms differ in their biological activities. Crk-II has less transforming activity than Crk-I. Crk-II mediates attachment-induced MAPK8 activation, membrane ruffling and cell motility in a Rac-dependent manner. Involved in phagocytosis of apoptotic cells and cell motility via its interaction with DOCK1 and DOCK4. Immunogen Purified recombinant fragment of Human Crk p38 expressed in E. Coli. Isotype IgG2b Source/Host Mouse Species Reactivity Mouse, Human Clone 4H22D2 Purity Ascites Conjugate Unconjugated Applications WB, ELISA, IHC-P, Flow Cyt, ICC/IF Positive Control Recombinant Crk p38 protein; Crk p38-hIgGFc transfected HEK293 cell lysate; Human rectum cancer and bladder cancer tissues; MCF7 and 3T3 L1 cells. Format Liquid Size 100 μl Buffer Preservative: 0.03% Sodium azide; Constituent: 99% Ascites Preservative 0.03% Sodium Azide Storage Store at 4°C or at -20°C for long term storage. GENE INFORMATION 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Gene Name CRK v-crk sarcoma virus CT10 oncogene homolog (avian) [ Homo sapiens ] Official Symbol CRK Synonyms CRK; v-crk sarcoma virus CT10 oncogene homolog (avian); v crk avian sarcoma virus CT10 oncogene homolog; adapter molecule crk; proto-oncogene
    [Show full text]
  • A Rhog-Mediated Signaling Pathway That Modulates Invadopodia Dynamics in Breast Cancer Cells Silvia M
    © 2017. Published by The Company of Biologists Ltd | Journal of Cell Science (2017) 130, 1064-1077 doi:10.1242/jcs.195552 RESEARCH ARTICLE A RhoG-mediated signaling pathway that modulates invadopodia dynamics in breast cancer cells Silvia M. Goicoechea, Ashtyn Zinn, Sahezeel S. Awadia, Kyle Snyder and Rafael Garcia-Mata* ABSTRACT micropinocytosis, bacterial uptake, phagocytosis and leukocyte One of the hallmarks of cancer is the ability of tumor cells to invade trans-endothelial migration (deBakker et al., 2004; Ellerbroek et al., surrounding tissues and metastasize. During metastasis, cancer cells 2004; Jackson et al., 2015; Katoh et al., 2006, 2000; van Buul et al., degrade the extracellular matrix, which acts as a physical barrier, by 2007). Recent studies have revealed that RhoG plays a role in tumor developing specialized actin-rich membrane protrusion structures cell invasion and may contribute to the formation of invadopodia called invadopodia. The formation of invadopodia is regulated by Rho (Hiramoto-Yamaki et al., 2010; Kwiatkowska et al., 2012). GTPases, a family of proteins that regulates the actin cytoskeleton. Invadopodia are actin-rich adhesive structures that form in the Here, we describe a novel role for RhoG in the regulation of ventral surface of cancer cells and allow them to degrade the invadopodia disassembly in human breast cancer cells. Our results extracellular matrix (ECM) (Gimona et al., 2008). Formation of show that RhoG and Rac1 have independent and opposite roles invadopodia involves a series of steps that include the disassembly in the regulation of invadopodia dynamics. We also show that SGEF of focal adhesions and stress fibers, and the relocalization of several (also known as ARHGEF26) is the exchange factor responsible of their components into the newly formed invadopodia (Hoshino for the activation of RhoG during invadopodia disassembly.
    [Show full text]
  • Snf2h-Mediated Chromatin Organization and Histone H1 Dynamics Govern Cerebellar Morphogenesis and Neural Maturation
    ARTICLE Received 12 Feb 2014 | Accepted 15 May 2014 | Published 20 Jun 2014 DOI: 10.1038/ncomms5181 OPEN Snf2h-mediated chromatin organization and histone H1 dynamics govern cerebellar morphogenesis and neural maturation Matı´as Alvarez-Saavedra1,2, Yves De Repentigny1, Pamela S. Lagali1, Edupuganti V.S. Raghu Ram3, Keqin Yan1, Emile Hashem1,2, Danton Ivanochko1,4, Michael S. Huh1, Doo Yang4,5, Alan J. Mears6, Matthew A.M. Todd1,4, Chelsea P. Corcoran1, Erin A. Bassett4, Nicholas J.A. Tokarew4, Juraj Kokavec7, Romit Majumder8, Ilya Ioshikhes4,5, Valerie A. Wallace4,6, Rashmi Kothary1,2, Eran Meshorer3, Tomas Stopka7, Arthur I. Skoultchi8 & David J. Picketts1,2,4 Chromatin compaction mediates progenitor to post-mitotic cell transitions and modulates gene expression programs, yet the mechanisms are poorly defined. Snf2h and Snf2l are ATP-dependent chromatin remodelling proteins that assemble, reposition and space nucleosomes, and are robustly expressed in the brain. Here we show that mice conditionally inactivated for Snf2h in neural progenitors have reduced levels of histone H1 and H2A variants that compromise chromatin fluidity and transcriptional programs within the developing cerebellum. Disorganized chromatin limits Purkinje and granule neuron progenitor expansion, resulting in abnormal post-natal foliation, while deregulated transcriptional programs contribute to altered neural maturation, motor dysfunction and death. However, mice survive to young adulthood, in part from Snf2l compensation that restores Engrailed-1 expression. Similarly, Purkinje-specific Snf2h ablation affects chromatin ultrastructure and dendritic arborization, but alters cognitive skills rather than motor control. Our studies reveal that Snf2h controls chromatin organization and histone H1 dynamics for the establishment of gene expression programs underlying cerebellar morphogenesis and neural maturation.
    [Show full text]
  • PRODUCT SPECIFICATION Product Datasheet
    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST K1841 Mass Spectrometry Protein Standard Product Number QPrEST29029 Protein Name Uncharacterized protein KIAA1841 Uniprot ID Q6NSI8 Gene KIAA1841 Product Description Stable isotope-labeled standard for absolute protein quantification of Uncharacterized protein KIAA1841. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding EQCIQYCHKNMNAIVATPCNMNCINANLLTRIADLFSHNEVDDLKDKKDK fusion tag) FKSKLFCKKIERLFDPEYLNPDSRSNAA Theoretical MW 26883 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
    [Show full text]