Supplemental Figure 1. Dissociation (Melting) Curves for All the Genes Were Checked

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Supplemental figure 1. Dissociation (melting) curves for all the genes were checked for the presence of primer dimers or spurious and not specific products. qPCR was performed on 4-fold serial dilutions of pool of zebrafish cDNA (WT and mibhi904; 3dpf) using 100 nM of each Primer, and SybrGreen® PCR Master Mix. Reactions were amplified by 45 cycles of PCR using ABI Prism® 7700 Sequence Detection System (Applied Biosystems). The melting curve analysis was performed by denaturation at 95°C for 15 sec, followed by a standard increasing ramp rate of the instrument from 60°C to 95°C. The X-axis is temperature and the Y-axis is Derivative or Fluorescence. Colored lines indicate template-specific reactions. Black lines indicate no-template controls (NTC). β-act: beta-actin; BDNF: brain derived neurotrophic factor; PYYa: peptide YYa; GAD1: glutamate decarboxylase 1; Gabra1: gamma-aminobutyric acid A receptor, alpha 1. Supplemental figure 2. Gene expression profile in microarray. A. Scattergram analysis (±13,151 array probes selected after elimination of controls and blank); B. Hierarchical clustering analysis of the data set ≤(P 0.05, T -test; GeneSpring GX 7.3.1). Each horizontal strip represents expression of a single gene. The up-regulation is shown in red and the down-regulation in green. Supplemental figure 3. Pictorial representation of significantly up-regulated (A) and down-regulated (B) genes categorized based on known biological functions (Gene Ontology database). Pie charts show % of genes belonging to different biological process: development, transport, immune response/response to a stimulus and cellular process (shown in pink colour). The genes involved in cellular process, has been sub- grouped in other functional categories (pies charts on right side). Supplemental figure 4. Expression pattern of glycine receptor alphaZ4 subunit (GLRA4b) in WT and mibhi904 zebrafish (3 dpf). A. Detection of gene expression in 2% ethidium bromide agarose gel electrophoresis. B. Levels of mRNA, measured by quantitative PCR and normalized to β-act. Error bars indicate ±SEM. Student’s t test; p<0.05. C. Whole-mount in situ hybridization, lateral view. DC, diencephalon; hy, hypothalamus; HB, hindbrain; Tel, telencephalon; TeO, optic tectum. Supplemental table 1 Primer’s sequences, GeneBank accession number and amplicon size for the investigated genes in conventional RT-PCR; primers indicated by asterisks were also used in preparing the probes for In Situ Hybridization DNA (template preparation using PCR amplification). Supplemental table 2. qPCR efficiencies for all genes, slope of the curves, intercept and the correlation coefficient were estimated using the equation E=10[-1/slope] (qCalculator software) using the CT values obtained by the standards serial dilutions assayed in triplicate (4 fold serial dilution). CT: cycle threshold; β-act: beta-actin; BDNF: brain derived neurotrophic factor; PYYa: peptide YYa; Gabra1: gamma-aminobutyric acid A receptor, alpha 1; GAD1: glutamate decarboxylase 1; Calb2: calbindin 2; Pvalb5: parvalbumin isoform 2a; GLRA4b: glycine receptor alphaZ4 subunit. Supplemental table 3. List of up-regulated genes grouped upon their general biological process. *These data were extracted after statistical analysis of microarrays for detection of differentially expressed genes and then from gene ontology analysis for clustering genes by function. GenBank ID, fold changes and P-values are listed. List of down-regulated genes grouped upon their general biological process. *These data were extracted after statistical analysis of microarrays for detection of differentially expressed genes and then from gene ontology analysis for clustering genes by function. GenBank ID, fold changes and P-values are listed. Supplemental video 1. Spontaneous Stage III seizure behaviour recorded in a mind bomb mutant bathing in normal embryo media. Supplemental Table 1 Primers used for amplification, cloning and sequencing Gene name Gene symbol GeneBank Primer sequences Size (bp) beta actin β-act AF057040 F, 5' GGACTCTGGTGATGGTGTGA 3' 569 R, 5' CACCGATCCAGACGGAGTAT 3' F, 5' GCTACAGCTTCACCACCACA 3' 596 R, 5' GGTTGGTCGTTCGTTTGAAT 3' ' ' 18S ribosomal 18S AF021880 F, 5 CGAAAGCATTTGCCAAGAAT 3 467 R, 5' AACGCCACTTGTCCCTCTAA 3' F, 5' TGACTCAACACGGGAAACCT 3' 450 R, 5' TGTACAAAGGGCAGGGACTT 3' elongation factor 1 alpha subunit EF1α NM_131263 F, 5' GCGTGGTATCACCATTGACA 3' 443 R, 5' TCTTCCATCCCTTGAACCAG 3' F, 5' CTGATTGTTGCTGGTGGTGT 3' 548 R, 5' TGGTGCATCTCAACAGACTTG 3' β beta-2-microglobulin 2M BC062841 F, 5' TATGTCGGACACCAAGCAGA 3' 449 R, 5' TCCACACCAAGAACAGGAACT 3' F, 5' CTGGCAGTTTCACCTCACAA 3' 625 R, 5' GAACAGCCAACAAGTGCAGA 3' brain-derived neurotrophic factor bdnf NM_131595 F, 5' TCCTGCTGAATGGTCTCCTT 3' * 577 R, 5' GCTGTCACCCACTGGCTAAT 3' * F, 5' AGGAGTTGCTTGAGGTGGAA 3' 473 R, 5' CCGGCATTGCGAGTTATAGT 3' peptide YYa pyy NM_131016 F, 5' GTCATGCTGAAACCTTGGAC 3' 263 R, 5' CTTGATCTCTGTTTGTGCTCTG 3' BC162428 F, 5' TGTGTCTCGGGACATTTGTG 3' * 329 R, 5' CGGCGACTGGTTCTCATATAGT 3' * calbindin 2 calb2 BC059467 F, 5' TGCTGAAGAAAGCCAACAGA 3' * 483 R, 5' ATGCACACATCGAGAATCCA 3' * F, 5' AGCCTGTCCAGCTCAAAGAA 3' 585 R, 5' CAGTGTTGGCAAATCAGAACA 3' gamma-aminobutyric acid (GABA) gabra1 BC124697 F, 5' TGAGCAGAAGGACAACACCA 3' 502 A receptor, alpha 1 R, 5' TCGAGTCCAAACGTACACCA 3' F, 5' GAAGACTTCCCAATGGATGC 3' * 452 R, 5' TAACAGACGGCAATGAACCA 3' * glutamate decarboxylase 1 gad1 BC047851 F, 5' CAGCACCTTTGTGAGGTGAA 3' * 557 R, 5' CCAGCATCCTGAGGACATTT 3' * F, 5' AGGCCCTTAACTCTGTGCAA 3' 594 R, 5' GACGACCAACCAACAGAACA 3' glial fibrillary acidic protein gfap AF506734 F, 5' GGTCCATGAGGAGGAGATGA 3' 507 R, 5' TCCAGCAGCTTCCTGTAGGT 3' F, 5' AAGCAGGAGGCCAATGACTA 3' 400 R, 5' TTCGCACAACTATGCTCCTC 3' glycine receptor alphaZ4 subunit glra4b AJ308517 F, 5' GCCATTGACATCTGGATGG 3' 472 R, 5' CGTTGAATACGAGGAAGCTG 3' F, 5' CAGTTGGCCTCACAGAATCA 3' * 407 R, 5 TGTTGCACCGCTTCATAGAC 3' * parvalbumin isoform 2a pvalb5 AF467915 F, 5' AAGAACAGCCTCTGCATCGT 3' * 423 R, 5' CCTCGTTCTCATTTCAGCAAG 3' * F, 5' GGAATCCTGAAGCAAGACGA 3' 548 R, 5' AGAAGCCCTTCACTTGGAGA 3' chemokine ligand 12 cxcl AY577011 F, 5' CAGTGCGGATCTCTTCTTCA 3' 422 R, 5' TTAAGTGCTGGGTCAGCAAG 3' F, 5' ACCTGAAGAACGCCATCAAC 3' 479 R, 5' TCGTAGAACCGTCAATGCTG 3' early growth response 1 egr1 NM_131248 F, 5' TCCTCTTCCACGTCTTCCAT 3' 466 R, 5' TTGGCCGGTTAGGATACTTG 3' F, 5' CCAGATCAGAAACCCATCCA 3' 441 R, 5' CCGCATGTGGATCTTAGTGT 3' proteasome 26S subunit, psmd13 AY398402 F, 5' CCGAATACAGCCATCACCTT 3' 586 non-ATPase, 13 R, 5' GCCGAGTGAAAGTCATCTCC 3' F, 5' TTAGGTCTGGCTGGTCTGCT 3' 495 R, 5' TGCCATGTTCTTCACGTCTC 3' * primers used in preparing the probes (template preparation using PCR amplification) Supplemental Table 2 Up-Regulated genes Biological Process Unigene Name Genbank ID Development Homeobox protein DBX1-A NM_131158 Brain-derived neurotrophic factor NM_131595 Zinc finger protein 703 AY026937 Tissue inhibitor of metalloproteinase 2b BQ131818 Fibronectin 1b BI707688 Connective tissue growth factor BE693178 Plexin D1 BI878456 Desmin NM_130963 Selenoprotein N, 1 AY221262 Chemokine (C-X-C motif) ligand 12a BM184127 Transport Endoplasmic oxidoreductin-1-like protein BC053166 Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 BM777179 Npc1 protein BI705721 Immune response & Similar to complement C4-2 BI672168 Response to a stimulus Complement factor B NM_131338 Complement component 6 BI884211 Similar to complement C3-S AI477673 Heat shock protein, alpha-crystallin-related, 1 BI890996 Signal trasduction WD repeat domain 69 BM317335 Chordin NM_130973 Peptide YYa NM_131016 Neuropeptide FF-amide peptide precursor like AY092774 Vessel-specific 1 BM777868 Angiopoietin-like 7 BE202096 Membrane protein, palmitoylated 1 BI885282 DeltaC BG883428 Ral guanine nucleotide dissociation stimulator-like 1 BI890252 Membrane-spanning 4-domains, subfamily A, member 4 AW078034 Ras-related associated with diabetes AW116003 Si:rp71-39b20.7 BI879803 Tumor necrosis factor receptor superfamily, member 1a CA787635 Urotensin 2, alpha AY305004 Urotensin 1 BG306472 EH-domain containing 2 CD605644 Suppressor of cytokine signaling 3b CD283300 Novel protein similar to vertebrate muscle derived protein (MDP77) AI397396 zgc:112145-similar human cAMP-dependent protein kinase, regulatory subunit alpha 1 BM005429 Prepro-urotensin II-related peptide BM532745 Transcription Similar to CCAAT displacement protein (CDP) BI867269 NK3 homeobox 2 NM_178132 Neurogenin 3 NM_131815 No tail a NM_131162 Early growth response 1 NM_131248 V-jun sarcoma virus 17 oncogene homolog (avian) BE605692 Interferon regulatory factor 9 BM095893 Novel protein similar to vertebrate B-cell CLL/lymphoma 6, member B BM183969 Cellular metabolic process Tripartite motif-containing 55b BM531770 Transglutaminase 2b AF242545 V-akt murine thymoma viral oncogene homolog 2 AY056465 Cathepsin L1, a AW154342 Cathepsin B, a BG985497 Cathepsin C BM181679 si:ch211-235e18.3 BI892316 Tuberoinfundibular peptide of 39 amino acids AF486190 Argininosuccinate synthetase 1 AI957843 Cytochrome P450 CYP1C1 BG728978 Glutamic pyruvate transaminase (alanine aminotransferase) 2 BG883222 NK lysin-like protein AY184216 Other cellular process Clusterin AW077466 CASP8 and FADD-like apoptosis regulator AF448261 Novel protein similar to claudin 11 BI672093 Insulin-like growth factor binding protein 1 NM_173283 Cysteine rich protein 61 BI430409 Prickle-like 1 (Drosophila) a AY278986 Keratin-like BI846469 Down-Regulated genes Biological Process Unigene Name Genbank ID Development FEZ family zinc finger 2 NM_131636 Proteolipid
Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • G Protein-Coupled Receptors

    G Protein-Coupled Receptors

    G PROTEIN-COUPLED RECEPTORS Overview:- The completion of the Human Genome Project allowed the identification of a large family of proteins with a common motif of seven groups of 20-24 hydrophobic amino acids arranged as α-helices. Approximately 800 of these seven transmembrane (7TM) receptors have been identified of which over 300 are non-olfactory receptors (see Frederikson et al., 2003; Lagerstrom and Schioth, 2008). Subdivision on the basis of sequence homology allows the definition of rhodopsin, secretin, adhesion, glutamate and Frizzled receptor families. NC-IUPHAR recognizes Classes A, B, and C, which equate to the rhodopsin, secretin, and glutamate receptor families. The nomenclature of 7TM receptors is commonly used interchangeably with G protein-coupled receptors (GPCR), although the former nomenclature recognises signalling of 7TM receptors through pathways not involving G proteins. For example, adiponectin and membrane progestin receptors have some sequence homology to 7TM receptors but signal independently of G-proteins and appear to reside in membranes in an inverted fashion compared to conventional GPCR. Additionally, the NPR-C natriuretic peptide receptor has a single transmembrane domain structure, but appears to couple to G proteins to generate cellular responses. The 300+ non-olfactory GPCR are the targets for the majority of drugs in clinical usage (Overington et al., 2006), although only a minority of these receptors are exploited therapeutically. Signalling through GPCR is enacted by the activation of heterotrimeric GTP-binding proteins (G proteins), made up of α, β and γ subunits, where the α and βγ subunits are responsible for signalling. The α subunit (tabulated below) allows definition of one series of signalling cascades and allows grouping of GPCRs to suggest common cellular, tissue and behavioural responses.
  • GNGT2 (NM 031498) Human Mass Spec Standard Product Data

    GNGT2 (NM 031498) Human Mass Spec Standard Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH303892 GNGT2 (NM_031498) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: GNGT2 MS Standard C13 and N15-labeled recombinant protein (NP_113686) Species: Human Expression Host: HEK293 Expression cDNA Clone RC203892 or AA Sequence: Predicted MW: 7.7 kDa Protein Sequence: >RC203892 protein sequence Red=Cloning site Green=Tags(s) MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq: NP_113686 RefSeq Size: 1057 RefSeq ORF: 207 Synonyms: G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8 Locus ID: 2793 UniProt ID: O14610 Cytogenetics: 17q21.32 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 GNGT2 (NM_031498) Human Mass Spec Standard – PH303892 Summary: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.
  • Multi-Functionality of Proteins Involved in GPCR and G Protein Signaling: Making Sense of Structure–Function Continuum with In

    Multi-Functionality of Proteins Involved in GPCR and G Protein Signaling: Making Sense of Structure–Function Continuum with In

    Cellular and Molecular Life Sciences (2019) 76:4461–4492 https://doi.org/10.1007/s00018-019-03276-1 Cellular andMolecular Life Sciences REVIEW Multi‑functionality of proteins involved in GPCR and G protein signaling: making sense of structure–function continuum with intrinsic disorder‑based proteoforms Alexander V. Fonin1 · April L. Darling2 · Irina M. Kuznetsova1 · Konstantin K. Turoverov1,3 · Vladimir N. Uversky2,4 Received: 5 August 2019 / Revised: 5 August 2019 / Accepted: 12 August 2019 / Published online: 19 August 2019 © Springer Nature Switzerland AG 2019 Abstract GPCR–G protein signaling system recognizes a multitude of extracellular ligands and triggers a variety of intracellular signal- ing cascades in response. In humans, this system includes more than 800 various GPCRs and a large set of heterotrimeric G proteins. Complexity of this system goes far beyond a multitude of pair-wise ligand–GPCR and GPCR–G protein interactions. In fact, one GPCR can recognize more than one extracellular signal and interact with more than one G protein. Furthermore, one ligand can activate more than one GPCR, and multiple GPCRs can couple to the same G protein. This defnes an intricate multifunctionality of this important signaling system. Here, we show that the multifunctionality of GPCR–G protein system represents an illustrative example of the protein structure–function continuum, where structures of the involved proteins represent a complex mosaic of diferently folded regions (foldons, non-foldons, unfoldons, semi-foldons, and inducible foldons). The functionality of resulting highly dynamic conformational ensembles is fne-tuned by various post-translational modifcations and alternative splicing, and such ensembles can undergo dramatic changes at interaction with their specifc partners.
  • A System-Level, Molecular Evolutionary Analysis of Mam- Malian Phototransduction (Supplementary Material)

    A System-Level, Molecular Evolutionary Analysis of Mam- Malian Phototransduction (Supplementary Material)

    A system-level, molecular evolutionary analysis of mam- malian phototransduction (supplementary material) Brandon M Invergo1 , Ludovica Montanucci∗1 , Hafid Laayouni1 and Jaume Bertranpetit1 1IBE-Institute of Evolutionary Biology (UPF-CSIC), CEXS-UPF-PRBB, Barcelona, Catalonia, Spain Email: Brandon Invergo - [email protected]; Ludovica Montanucci∗- [email protected]; Hafid Laayouni - hafi[email protected]; Jaume Bertranpetit - [email protected]; ∗Corresponding author Table S1 - Classifications of the genes Genes were assigned classifications according to their photoreceptor cell-type specificity, the process in which the encoded protein is primarily active, and the general function of the encoded protein. (Note: here "enzyme" specifically refers to enzymes involved in retinoid recycling.) 1 gene cell type process function ABCA4 shared retinoid cycle enzyme AIPL1 shared phototransduction other ARR3 cone phototransduction signal regulator ASCL1 rod development transcription regulation CNGA1 rod phototransduction ion channel CNGA3 cone phototransduction ion channel CNGB1 rod phototransduction ion channel CNGB3 cone phototransduction ion channel CRX shared development transcription regulation GNAT1 rod phototransduction G protein GNAT2 cone phototransduction G protein GNB1 rod phototransduction G protein GNB3 cone phototransduction G protein GNB5 shared phototransduction G protein GNGT1 rod phototransduction G protein GNGT2 cone phototransduction G protein GPSM2 shared phototransduction other GRK1 shared phototransduction
  • Network Pharmacology of JAK Inhibitors

    Network Pharmacology of JAK Inhibitors

    Network pharmacology of JAK inhibitors Devapregasan Moodleya, Hideyuki Yoshidaa, Sara Mostafavib,c, Natasha Asinovskia, Adriana Ortiz-Lopeza, Peter Symanowiczd, Jean-Baptiste Telliezd, Martin Hegend, James D. Clarkd, Diane Mathisa,1, and Christophe Benoista,1 aDivision of Immunology, Department of Microbiology and Immunobiology, Harvard Medical School, Boston, MA 02115; bDepartment of Statistics, University of British Columbia, Vancouver, BC, Canada V6T 1Z4; cDepartment of Medical Genetics, University of British Columbia, Vancouver, BC, Canada V6T 1Z4; and dInflammation and Immunology, Pfizer, Cambridge, MA 02139 Contributed by Christophe Benoist, June 24, 2016 (sent for review April 27, 2016; reviewed by Tadatsugu Taniguchi and Arthur Weiss) Small-molecule inhibitors of the Janus kinase family (JAKis) are side effects that likely reflect cytokine blockade, such as bacterial clinically efficacious in multiple autoimmune diseases, albeit with and fungal infections, in particular, (re)activation of the varicella increased risk of certain infections. Their precise mechanism of action zoster virus, and at high doses, anemia and thrombocytopenia (2, 3). is unclear, with JAKs being signaling hubs for several cytokines. We A new JAKi generation targets single JAK isoforms, which might assessed the in vivo impact of pan- and isoform-specific JAKi in mice improve adverse events by restricting the range of activity. Efficacy by immunologic and genomic profiling. Effects were broad across has been observed with JAK1-selective compounds (7) and com- the immunogenomic network, with overlap between inhibitors. Nat- pounds of reported specificity for JAK3 (ref. 8, but see ref. 2). ural killer (NK) cell and macrophage homeostasis were most imme- However, the premise of substantially improved in vivo specificity diately perturbed, with network-level analysis revealing a rewiring remains unproven, because the impact of JAKi compounds on the of coregulated modules of NK cell transcripts.
  • Anti-GNGT2 Antibody (ARG58880)

    Anti-GNGT2 Antibody (ARG58880)

    Product datasheet [email protected] ARG58880 Package: 100 μl anti-GNGT2 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes GNGT2 Tested Reactivity Ms Tested Application WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name GNGT2 Antigen Species Human Immunogen Recombinant fusion protein corresponding to aa. 1-69 of Human GNGT2 (NP_113686.1). Conjugation Un-conjugated Alternate Names GNG8; GNG9; GNGT8; G-GAMMA-8; G-GAMMA-C; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; G gamma-C; G-gamma-8; G-gamma-9; Guanine nucleotide binding protein gamma transducing activity polypeptide 2 Application Instructions Application table Application Dilution WB 1:500 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 8 kDa Properties Form Liquid Purification Affinity purified. Buffer PBS (pH 7.3), 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/2 Bioinformation Gene Symbol GNGT2 Gene Full Name guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 Background Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins.
  • And Diabetes-Associated Pancreatic Cancer: a GWAS Data Analysis

    And Diabetes-Associated Pancreatic Cancer: a GWAS Data Analysis

    Published OnlineFirst October 17, 2013; DOI: 10.1158/1055-9965.EPI-13-0437-T Cancer Epidemiology, Research Article Biomarkers & Prevention Genes–Environment Interactions in Obesity- and Diabetes-Associated Pancreatic Cancer: A GWAS Data Analysis Hongwei Tang1, Peng Wei3, Eric J. Duell4, Harvey A. Risch5, Sara H. Olson6, H. Bas Bueno-de-Mesquita7, Steven Gallinger9, Elizabeth A. Holly10, Gloria M. Petersen11, Paige M. Bracci10, Robert R. McWilliams11, Mazda Jenab12, Elio Riboli16, Anne Tjønneland18, Marie Christine Boutron-Ruault13,14,15, Rudolf Kaaks19, Dimitrios Trichopoulos20,21,22, Salvatore Panico23, Malin Sund24, Petra H.M. Peeters8,16, Kay-Tee Khaw17, Christopher I. Amos2, and Donghui Li1 Abstract Background: Obesity and diabetes are potentially alterable risk factors for pancreatic cancer. Genetic factors that modify the associations of obesity and diabetes with pancreatic cancer have previously not been examined at the genome-wide level. Methods: Using genome-wide association studies (GWAS) genotype and risk factor data from the Pancreatic Cancer Case Control Consortium, we conducted a discovery study of 2,028 cases and 2,109 controls to examine gene–obesity and gene–diabetes interactions in relation to pancreatic cancer risk by using the likelihood-ratio test nested in logistic regression models and Ingenuity Pathway Analysis (IPA). Results: After adjusting for multiple comparisons, a significant interaction of the chemokine signaling À pathway with obesity (P ¼ 3.29 Â 10 6) and a near significant interaction of calcium signaling pathway with À diabetes (P ¼ 1.57 Â 10 4) in modifying the risk of pancreatic cancer were observed. These findings were supported by results from IPA analysis of the top genes with nominal interactions.
  • Pulmonary Hypertension Remodels the Genomic Fabrics of Major Functional Pathways

    Pulmonary Hypertension Remodels the Genomic Fabrics of Major Functional Pathways

    Preprints (www.preprints.org) | NOT PEER-REVIEWED | Posted: 21 December 2019 doi:10.20944/preprints201912.0280.v1 Peer-reviewed version available at Genes 2020, 11, 126; doi:10.3390/genes11020126 1 Article 2 Pulmonary Hypertension Remodels the Genomic 3 Fabrics of Major Functional Pathways 4 Rajamma Mathew 1,2, Jing Huang 1, Sanda Iacobas 3 and Dumitru A Iacobas 4,* 5 1 Department of Pediatrics, New York Medical College, Valhalla, NY 10595, U.S.A. 6 2 Department of Physiology, New York Medical College, Valhalla, NY 10595, U.S.A. 7 3 Department of Pathology, New York Medical College, Valhalla, NY 10595, U.S.A. 8 4 Personalized Genomics Laboratory, Center for Computational Systems Biology, Roy G Perry College of 9 Engineering, Prairie View A&M University, Prairie View, TX77446, U.S.A. 10 * Correspondence: [email protected]; Tel.: +1(936)261-9926 11 Abstract: Pulmonary hypertension (PH) is a serious disorder with high morbidity and mortality 12 rate. We analyzed the right ventricular systolic pressure (RVSP), right ventricular hypertrophy 13 (RVH), lung histology and transcriptomes of six weeks old male rats with PH induced by: 1) hypoxia 14 (HO), 2) administration of monocrotaline (CM) or 3) administration of monocrotaline and exposure 15 to hypoxia (HM). The results in PH rats were compared to those in control rats (CO). After four 16 weeks exposure, increased RVSP and RVH, pulmonary arterial wall thickening, and alteration of 17 the lung transcriptome were observed in all PH groups. The HM group exhibited the largest 18 alterations and also neointimal lesions and obliteration of lumen in small arteries.
  • Canine Cone Transducin-Y Gene and Cone Degeneration in the Cd Dog

    Canine Cone Transducin-Y Gene and Cone Degeneration in the Cd Dog

    Canine Cone Transducin-y Gene and Cone Degeneration in the cd Dog Novrouz B. Akhmedov,1 Natik I. Piriev,1 Sue Pearce-Kelling,5 Gregory M. Acland,5 Gustavo D. Aguirre,5 and Debora B. Farber1'2 PURPOSE. TO characterize the cDNA and the organization of the gene encoding the cone-specific y subunit of transducin (Tyc) and to examine this gene as a candidate for the recessively inherited cone photoreceptor degeneration in the cd dog. METHODS. Canine Tyc cDNA was cloned and sequenced. Polymerase chain reaction (PCR) was used to define the Tyc gene structure, northern blot analysis to examine the level of expression of Tyc mRNA in control and cd-affected retinas, and immunocytochemistry to determine the presence and localization of Tyc in normal and cd retinas. RESULTS. Immunocytochemical results showed Tyc localized to cone photoreceptor outer segments in the normal retina, whereas no Tyc immunoreactivity was observed in the cd retinas. However, the level of transcription and the primary structure of the cloned cDNA coding for the 69 -amino acid protein were identical in retinas from wild-type and affected dogs. CONCLUSIONS. Although Tyc immunoreactivity was specifically absent in the cd dog retina, no differences were detected between normal and cd retinas in the nucleotide sequence of Tyc mRNA or in its synthesis. These results indicate that a mutation in the Tyc gene may not be causally associated with the cd dog disease. These findings suggest that possible abnormalities in posttrans- lational modification of Tyc or defective assembly of the transducin a/3y complex could lead to rapid degradation of Tyc.
  • Differentially Expressed Genes in Aneurysm Tissue Compared With

    Differentially Expressed Genes in Aneurysm Tissue Compared With

    On-line Table: Differentially expressed genes in aneurysm tissue compared with those in control tissue Fold False Discovery Direction of Gene Entrez Gene Name Function Change P Value Rate (q Value) Expression AADAC Arylacetamide deacetylase Positive regulation of triglyceride 4.46 1.33E-05 2.60E-04 Up-regulated catabolic process ABCA6 ATP-binding cassette, subfamily A (ABC1), Integral component of membrane 3.79 9.15E-14 8.88E-12 Up-regulated member 6 ABCC3 ATP-binding cassette, subfamily C (CFTR/MRP), ATPase activity, coupled to 6.63 1.21E-10 7.33E-09 Up-regulated member 3 transmembrane movement of substances ABI3 ABI family, member 3 Peptidyl-tyrosine phosphorylation 6.47 2.47E-05 4.56E-04 Up-regulated ACKR1 Atypical chemokine receptor 1 (Duffy blood G-protein–coupled receptor signaling 3.80 7.95E-10 4.18E-08 Up-regulated group) pathway ACKR2 Atypical chemokine receptor 2 G-protein–coupled receptor signaling 0.42 3.29E-04 4.41E-03 Down-regulated pathway ACSM1 Acyl-CoA synthetase medium-chain family Energy derivation by oxidation of 9.87 1.70E-08 6.52E-07 Up-regulated member 1 organic compounds ACTC1 Actin, ␣, cardiac muscle 1 Negative regulation of apoptotic 0.30 7.96E-06 1.65E-04 Down-regulated process ACTG2 Actin, ␥2, smooth muscle, enteric Blood microparticle 0.29 1.61E-16 2.36E-14 Down-regulated ADAM33 ADAM domain 33 Integral component of membrane 0.23 9.74E-09 3.95E-07 Down-regulated ADAM8 ADAM domain 8 Positive regulation of tumor necrosis 4.69 2.93E-04 4.01E-03 Up-regulated factor (ligand) superfamily member 11 production ADAMTS18
  • SUPPLEMENTARY APPENDIX Exome Sequencing Reveals Heterogeneous Clonal Dynamics in Donor Cell Myeloid Neoplasms After Stem Cell Transplantation

    SUPPLEMENTARY APPENDIX Exome Sequencing Reveals Heterogeneous Clonal Dynamics in Donor Cell Myeloid Neoplasms After Stem Cell Transplantation

    SUPPLEMENTARY APPENDIX Exome sequencing reveals heterogeneous clonal dynamics in donor cell myeloid neoplasms after stem cell transplantation Julia Suárez-González, 1,2 Juan Carlos Triviño, 3 Guiomar Bautista, 4 José Antonio García-Marco, 4 Ángela Figuera, 5 Antonio Balas, 6 José Luis Vicario, 6 Francisco José Ortuño, 7 Raúl Teruel, 7 José María Álamo, 8 Diego Carbonell, 2,9 Cristina Andrés-Zayas, 1,2 Nieves Dorado, 2,9 Gabriela Rodríguez-Macías, 9 Mi Kwon, 2,9 José Luis Díez-Martín, 2,9,10 Carolina Martínez-Laperche 2,9* and Ismael Buño 1,2,9,11* on behalf of the Spanish Group for Hematopoietic Transplantation (GETH) 1Genomics Unit, Gregorio Marañón General University Hospital, Gregorio Marañón Health Research Institute (IiSGM), Madrid; 2Gregorio Marañón Health Research Institute (IiSGM), Madrid; 3Sistemas Genómicos, Valencia; 4Department of Hematology, Puerta de Hierro General University Hospital, Madrid; 5Department of Hematology, La Princesa University Hospital, Madrid; 6Department of Histocompatibility, Madrid Blood Centre, Madrid; 7Department of Hematology and Medical Oncology Unit, IMIB-Arrixaca, Morales Meseguer General University Hospital, Murcia; 8Centro Inmunológico de Alicante - CIALAB, Alicante; 9Department of Hematology, Gregorio Marañón General University Hospital, Madrid; 10 Department of Medicine, School of Medicine, Com - plutense University of Madrid, Madrid and 11 Department of Cell Biology, School of Medicine, Complutense University of Madrid, Madrid, Spain *CM-L and IB contributed equally as co-senior authors. Correspondence: