DOCSLIB.ORG

Canine Cone Transducin-Y Gene and Cone Degeneration in the Cd Dog

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Canine Cone Transducin-Y Gene and Cone Degeneration in the Cd Dog Canine Cone Transducin-y Gene and Cone Degeneration in the cd Dog Novrouz B. Akhmedov,1 Natik I. Piriev,1 Sue Pearce-Kelling,5 Gregory M. Acland,5 Gustavo D. Aguirre,5 and Debora B. Farber1'2 PURPOSE. TO characterize the cDNA and the organization of the gene encoding the cone-specific y subunit of transducin (Tyc) and to examine this gene as a candidate for the recessively inherited cone photoreceptor degeneration in the cd dog. METHODS. Canine Tyc cDNA was cloned and sequenced. Polymerase chain reaction (PCR) was used to define the Tyc gene structure, northern blot analysis to examine the level of expression of Tyc mRNA in control and cd-affected retinas, and immunocytochemistry to determine the presence and localization of Tyc in normal and cd retinas. RESULTS. Immunocytochemical results showed Tyc localized to cone photoreceptor outer segments in the normal retina, whereas no Tyc immunoreactivity was observed in the cd retinas. However, the level of transcription and the primary structure of the cloned cDNA coding for the 69 -amino acid protein were identical in retinas from wild-type and affected dogs. CONCLUSIONS. Although Tyc immunoreactivity was specifically absent in the cd dog retina, no differences were detected between normal and cd retinas in the nucleotide sequence of Tyc mRNA or in its synthesis. These results indicate that a mutation in the Tyc gene may not be causally associated with the cd dog disease. These findings suggest that possible abnormalities in posttrans- lational modification of Tyc or defective assembly of the transducin a/3y complex could lead to rapid degradation of Tyc. (Invest Ophthalmol Vis Sci. 1998;39:1775-1781) proteins are signal-transducing guanine nucleotide- transduction cascade. Hydrolysis of GTP to GDP by the binding regulatory proteins that couple activated intrinsic guanosine triphosphatase (GTPase) activity of Ga cell surface receptors and intercellular effectors.1 terminates the cycle. G 2 3 4 14 Most members of this family of proteins are structurally and Seventeen forms of Ga, five of Gj3, and ten of Gy " functionally homologous heterotrimers consisting of a, j3, have been identified by molecular cloning from different mam- and y subunits. In response to a variety of signals, the malian sources. The molecular details of interactions between surface receptors stimulate the exchange of bound G-protein subunits have been extensively studied; however, many questions remain. It has been shown that the N-terminus guanosine diphosphate (GDP) for guanosine triphosphate l5 (GTP) on the G-protein a subunit (Ga). In the inactive state, of G/3 is an essential domain for Gj3y assembly, and that the Ga is bound to GDP (GaGDP) and forms a complex with the 14 -amino acid region (amino acids 36 - 49) of the yl subunit is sufficient for yl to discriminate between the j3 subunits.16 In G/3y dimer; and in the active state, GaGTP dissociates from cross-linking experiments, Bubis and Khorana17 showed that G/3y. GaGTP and Gj3y are capable of regulating the activity cysteines at positions 36 or 37 in the y subunit interact with of downstream components of the corresponding signal the cysteine at position 25 in /3l. Furthermore, with the use of /32//31 chimeras and site-directed mutagenesis, it has been demonstrated that the 56 amino acids from the NH2-terminus From the 'Jules Stein Eye Institute, University of California Los 2 of /32 do not correspond to the portion of the protein neces- Angeles School of Medicine; Molecular Biology Institute, University of 18 California Los Angeles; and 3The James A. Baker Institute for Animal sary for selective interaction with the y subunit and that Health, College of Veterinary Medicine, Cornell University, Ithaca, cysteine residues in j31, y2, and y3 are not needed for /3y 19 New York. dimerization. Studies based on the crystal structure of the The nucleotide sequence data reported in this study have been heterotrimeric Ta/GDP.T/3y20 have shown that interaction be- submitted to GenBank with the accession number AF038862. tween Ta and Tj3y occurs at two distinct interfaces between Supported by Grants EY08285 (DBF) and EY06855 (GMA, GDA) from the National Institutes of Health, Bethesda, Maryland; and by Ta and the amino terminus of T/3. Direct interaction between grants from the George Gund Foundation and The Foundation Fighting Ta and Ty was not observed. However, other studies indicate Blindness, Hunt Valley, Maryland; The Morris Animal Foundation, that a 15 amino acid stretch of the N-terminus of Ty can Englewood, Colorado; The Seeing Eye, Morristown, New Jersey; and directly interact with Ta.2122 In spite of the importance and the American Kennel Club-Canine Health Foundation, Aurora, Ohio. complexity of the G-protein interactions involved in photo- DBF is the recipient of a Research to Prevent Blindness Senior Scientific transduction, only one disease (Nougaret's nyctalopia) has Investigator Award. 23 Submitted for publication January 7, 1998; revised April 3, 1998; been associated with a mutation in a retinal G protein (Ta). accepted April 29, 1998. Proprietary interest category: N. We have recently shown specific absence of immunore- Reprint requests: Debora B. Farber, Jules Stein Eye Institute, UCLA activity against antibodies to cone photoreceptor Tj33 in the cd School of Medicine, 100 Stein Plaza, Los Angeles, CA 90095. dog retina. The cd dog has an inherited cone-specific photore- Investigative Ophthalmology & Visual Science, September 1998, Vol. 39, No. 10 Copyright © Association for Research in Vision and Ophthalmology 1775 Downloaded from iovs.arvojournals.org on 09/27/2021 1776 Akhmedov et al. IOVS, September 1998, Vol. 39, No. 10 ceptor degeneration and is the only animal model for congen- chloroform extraction procedure (TRIzol; Life Technologies, ital achromatopsia in man.24 Based on this observation, we Grand Island, NY) or by guanidinium thiocyanate extraction examined the transcription level of the cone Tj33 gene in and cesium trifluoroacetate separation (CsTFA; Pharmacia, Pis- retinas from normal and affected dogs and cloned the corre- cataway, NJ). (There are no morphologic or electroretinogram sponding cDNA and genes. No differences in T/33 nucleotide differences between the 7.5-week-old normal and 6-week-old sequences and retinal mRNA levels were found between nor- cd dog retinas.) The RNA samples were fractionated on a 1.2% mal and affected dogs.25 Additionally, linkage studies of a agarose gel containing 2.2 M formaldehyde and were blotted Tsp45 I restriction fragment length polymorphism and the overnight onto nylon membranes (Hybond-N+; Amersham, Ar- disease were used to exclude the T/33 gene as a candidate for lington Heights, IL). The membranes were prehybridized and the cd mutation. One of the possible explanations for the lack hybridized in 0.5 M phosphate buffer (pH 7.2), 1 mM EDTA, 7% of agreement between the immunocytochemical studies and sodium dodecyl sulfate, and 1% bovine serum albumin. cDNA the mRNA concentration and nucleotide sequence analyses is probes were labeled by multiprime DNA labeling systems (Am- that there may be problems in the formation of the transducin ersham) in the presence of [a-32P]deoxycytidine triphosphate heterotrimer because of an abnormal transducin-yc (Tyc) sub- (3000 Ci/mmol; Amersham), and oligonucleotides were end unit. To this end, we have now cloned the canine cone-specific labeled with [y-32P]adenosine triphosphate (6000 Ci/mmol; Tyc cDNA and examined its possible involvement in this cone- Amersham) using T4 polynucleotide kinase (Promega, Madi- selective inherited photoreceptor degeneration. son, WI). The blots were washed at a final stringency of 0.2 X SSC and 0.2% sodium dodecyl sulfate and exposed to x-ray film (Hyperfilm-MP; Amersham) at — 80°C, using intensifying MATERIALS AND METHODS screens. The temperatures of hybridization and washing of the Immunocytochemistry blots were calculated based on the nature of the probe. The eyes from light-adapted control and crf-affected dogs were enucleated between 12 PM and 2 PM after intravenous anes- Construction and Screening of cDNA Libraries thesia with sodium pentobarbital, and the dogs were then and Sequence Analysis euthanatized with an overdose of the barbiturate. The retinas Oligo(dT)-primed unidirectional (Notl-Saft) cDNA retinal librar- were fixed in 4% paraformaldehyde in 0.1 M phosphate-buff- ies from normal and crf-affected dogs were constructed in ered saline (PBS) and embedded in diethylene glycol distearate Agt22A using the Super Script Lambda System (Life Technolo- (Polysciences, Warrington, PA), as previously described.2627 gies) and Gigapack III Gold Packaging Extract (Stratagene, La Two-micrometer sections were cut using glass knives, and the Jolla, CA). The libraries were screened using bovine cone- sections were mounted on silane-coated slides. The sections specific Ty cDNA labeled by random priming. Positive plaques were dewaxed with toluene, rehydrated, and immunoreacted were isolated, and the inserts were excised and subcloned with a polyclonal antibody raised in rabbit against an N-termi- into pBluescript II SK (Stratagene). Nucleotide sequence nal peptide (MAQELSEKELLKME) corresponding to residues 1 determinations were performed by the dideoxynucleotide through 14 of bovine Tyc (1:2,500 dilution). As a control for chain termination method vising Sequenase (USB, Cleveland, the presence of cones, the monoclonal antibody COS-1 was OH), [a-35S]deoxyadenosine triphosphate (1000 Ci/mmol; Am- used (1:10,000 dilution). This antibody identifies middle-wave- ersham), or with a Taq DyeDeoxy Terminator Cycle sequenc- sensitive cone opsins. Because this is the predominant class of ing kit (ABI, Foster City, CA). Fragments needed to cover gaps cones in the retina of most mammalian species, including dogs, in the cDNA sequence were obtained using specific internal this antibody was used to determine the presence and integrity sequencing primers. of cones.24'28'29 The immunoreactions were performed using 2.5% bovine serum albumin as a blocking agent and incorpo- rating 0.25% Triton X-100 in all washes and antibody-contain- RESULTS AND DISCUSSION ing solutions.
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • ADP-Ribosylation Factor, a Small GTP-Binding Protein, Is Required for Binding of the Coatomer Protein Fl-COP to Golgi Membranes JULIE G
    Proc. Natl. Acad. Sci. USA Vol. 89, pp. 6408-6412, July 1992 Biochemistry ADP-ribosylation factor, a small GTP-binding protein, is required for binding of the coatomer protein fl-COP to Golgi membranes JULIE G. DONALDSON*, DAN CASSEL*t, RICHARD A. KAHN*, AND RICHARD D. KLAUSNER* *Cell Biology and Metabolism Branch, National Institute of Child Health and Human Development, and tLaboratory of Biological Chemistry, Division of Cancer Treatment, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 Communicated by Marc Kirschner, April 20, 1992 (receivedfor review February 11, 1992) ABSTRACT The coatomer is a cytosolic protein complex localized to the Golgi complex, although their functions have that reversibly associates with Golgi membranes and is Impli- not been defined. Distinct among these proteins is the ADP- cated in modulating Golgi membrane transport. The associa- ribosylation factor (ARF), originally identified as a cofactor tion of 13-COP, a component of coatomer, with Golgi mem- required for in vitro cholera toxin-catalyzed ADP- branes is enhanced by guanosine 5'-[v-thioltriphosphate ribosylation of the a subunit of the trimeric GTP-binding (GTP[yS]), a nonhydrolyzable analogue of GTP, and by a protein G, (G,.) (19). ARF is an abundant cytosolic protein mixture of aluminum and fluoride ions (Al/F). Here we show that reversibly associates with Golgi membranes (20, 21). that the ADP-ribosylation factor (ARF) is required for the ARF has been shown to be present on Golgi coated vesicles binding of (-COP. Thus, 13-COP contained in a coatomer generated in the presence of GTP[yS], but it is not a com- fraction that has been resolved from ARF does not bind to Golgi ponent of the cytosolic coatomer (22).
    [Show full text]
  • G Protein-Coupled Receptors
    G PROTEIN-COUPLED RECEPTORS Overview:- The completion of the Human Genome Project allowed the identification of a large family of proteins with a common motif of seven groups of 20-24 hydrophobic amino acids arranged as α-helices. Approximately 800 of these seven transmembrane (7TM) receptors have been identified of which over 300 are non-olfactory receptors (see Frederikson et al., 2003; Lagerstrom and Schioth, 2008). Subdivision on the basis of sequence homology allows the definition of rhodopsin, secretin, adhesion, glutamate and Frizzled receptor families. NC-IUPHAR recognizes Classes A, B, and C, which equate to the rhodopsin, secretin, and glutamate receptor families. The nomenclature of 7TM receptors is commonly used interchangeably with G protein-coupled receptors (GPCR), although the former nomenclature recognises signalling of 7TM receptors through pathways not involving G proteins. For example, adiponectin and membrane progestin receptors have some sequence homology to 7TM receptors but signal independently of G-proteins and appear to reside in membranes in an inverted fashion compared to conventional GPCR. Additionally, the NPR-C natriuretic peptide receptor has a single transmembrane domain structure, but appears to couple to G proteins to generate cellular responses. The 300+ non-olfactory GPCR are the targets for the majority of drugs in clinical usage (Overington et al., 2006), although only a minority of these receptors are exploited therapeutically. Signalling through GPCR is enacted by the activation of heterotrimeric GTP-binding proteins (G proteins), made up of α, β and γ subunits, where the α and βγ subunits are responsible for signalling. The α subunit (tabulated below) allows definition of one series of signalling cascades and allows grouping of GPCRs to suggest common cellular, tissue and behavioural responses.
    [Show full text]
  • GNGT2 (NM 031498) Human Mass Spec Standard Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH303892 GNGT2 (NM_031498) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: GNGT2 MS Standard C13 and N15-labeled recombinant protein (NP_113686) Species: Human Expression Host: HEK293 Expression cDNA Clone RC203892 or AA Sequence: Predicted MW: 7.7 kDa Protein Sequence: >RC203892 protein sequence Red=Cloning site Green=Tags(s) MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq: NP_113686 RefSeq Size: 1057 RefSeq ORF: 207 Synonyms: G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8 Locus ID: 2793 UniProt ID: O14610 Cytogenetics: 17q21.32 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 GNGT2 (NM_031498) Human Mass Spec Standard – PH303892 Summary: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.
    [Show full text]
  • Multi-Functionality of Proteins Involved in GPCR and G Protein Signaling: Making Sense of Structure–Function Continuum with In
    Cellular and Molecular Life Sciences (2019) 76:4461–4492 https://doi.org/10.1007/s00018-019-03276-1 Cellular andMolecular Life Sciences REVIEW Multi‑functionality of proteins involved in GPCR and G protein signaling: making sense of structure–function continuum with intrinsic disorder‑based proteoforms Alexander V. Fonin1 · April L. Darling2 · Irina M. Kuznetsova1 · Konstantin K. Turoverov1,3 · Vladimir N. Uversky2,4 Received: 5 August 2019 / Revised: 5 August 2019 / Accepted: 12 August 2019 / Published online: 19 August 2019 © Springer Nature Switzerland AG 2019 Abstract GPCR–G protein signaling system recognizes a multitude of extracellular ligands and triggers a variety of intracellular signal- ing cascades in response. In humans, this system includes more than 800 various GPCRs and a large set of heterotrimeric G proteins. Complexity of this system goes far beyond a multitude of pair-wise ligand–GPCR and GPCR–G protein interactions. In fact, one GPCR can recognize more than one extracellular signal and interact with more than one G protein. Furthermore, one ligand can activate more than one GPCR, and multiple GPCRs can couple to the same G protein. This defnes an intricate multifunctionality of this important signaling system. Here, we show that the multifunctionality of GPCR–G protein system represents an illustrative example of the protein structure–function continuum, where structures of the involved proteins represent a complex mosaic of diferently folded regions (foldons, non-foldons, unfoldons, semi-foldons, and inducible foldons). The functionality of resulting highly dynamic conformational ensembles is fne-tuned by various post-translational modifcations and alternative splicing, and such ensembles can undergo dramatic changes at interaction with their specifc partners.
    [Show full text]
  • A System-Level, Molecular Evolutionary Analysis of Mam- Malian Phototransduction (Supplementary Material)
    A system-level, molecular evolutionary analysis of mam- malian phototransduction (supplementary material) Brandon M Invergo1 , Ludovica Montanucci∗1 , Hafid Laayouni1 and Jaume Bertranpetit1 1IBE-Institute of Evolutionary Biology (UPF-CSIC), CEXS-UPF-PRBB, Barcelona, Catalonia, Spain Email: Brandon Invergo - [email protected]; Ludovica Montanucci∗- [email protected]; Hafid Laayouni - hafi[email protected]; Jaume Bertranpetit - [email protected]; ∗Corresponding author Table S1 - Classifications of the genes Genes were assigned classifications according to their photoreceptor cell-type specificity, the process in which the encoded protein is primarily active, and the general function of the encoded protein. (Note: here "enzyme" specifically refers to enzymes involved in retinoid recycling.) 1 gene cell type process function ABCA4 shared retinoid cycle enzyme AIPL1 shared phototransduction other ARR3 cone phototransduction signal regulator ASCL1 rod development transcription regulation CNGA1 rod phototransduction ion channel CNGA3 cone phototransduction ion channel CNGB1 rod phototransduction ion channel CNGB3 cone phototransduction ion channel CRX shared development transcription regulation GNAT1 rod phototransduction G protein GNAT2 cone phototransduction G protein GNB1 rod phototransduction G protein GNB3 cone phototransduction G protein GNB5 shared phototransduction G protein GNGT1 rod phototransduction G protein GNGT2 cone phototransduction G protein GPSM2 shared phototransduction other GRK1 shared phototransduction
    [Show full text]
  • In Vivo Mapping of a GPCR Interactome Using Knockin Mice
    In vivo mapping of a GPCR interactome using knockin mice Jade Degrandmaisona,b,c,d,e,1, Khaled Abdallahb,c,d,1, Véronique Blaisb,c,d, Samuel Géniera,c,d, Marie-Pier Lalumièrea,c,d, Francis Bergeronb,c,d,e, Catherine M. Cahillf,g,h, Jim Boulterf,g,h, Christine L. Lavoieb,c,d,i, Jean-Luc Parenta,c,d,i,2, and Louis Gendronb,c,d,i,j,k,2 aDépartement de Médecine, Université de Sherbrooke, Sherbrooke, QC J1H 5N4, Canada; bDépartement de Pharmacologie–Physiologie, Université de Sherbrooke, Sherbrooke, QC J1H 5N4, Canada; cFaculté de Médecine et des Sciences de la Santé, Université de Sherbrooke, Sherbrooke, QC J1H 5N4, Canada; dCentre de Recherche du Centre Hospitalier Universitaire de Sherbrooke, Sherbrooke, QC J1H 5N4, Canada; eQuebec Network of Junior Pain Investigators, Sherbrooke, QC J1H 5N4, Canada; fDepartment of Psychiatry and Biobehavioral Sciences, University of California, Los Angeles, CA 90095; gSemel Institute for Neuroscience and Human Behavior, University of California, Los Angeles, CA 90095; hShirley and Stefan Hatos Center for Neuropharmacology, University of California, Los Angeles, CA 90095; iInstitut de Pharmacologie de Sherbrooke, Sherbrooke, QC J1H 5N4, Canada; jDépartement d’Anesthésiologie, Université de Sherbrooke, Sherbrooke, QC J1H 5N4, Canada; and kQuebec Pain Research Network, Sherbrooke, QC J1H 5N4, Canada Edited by Brian K. Kobilka, Stanford University School of Medicine, Stanford, CA, and approved April 9, 2020 (received for review October 16, 2019) With over 30% of current medications targeting this family of attenuates pain hypersensitivities in several chronic pain models proteins, G-protein–coupled receptors (GPCRs) remain invaluable including neuropathic, inflammatory, diabetic, and cancer pain therapeutic targets.
    [Show full text]
  • Supporting Information
    Supporting Information Yee et al. 10.1073/pnas.1100495108 SI Materials and Methods Open Biosystems; SUR1 (Abcc8, clone sequence BC141411.1) Reagents. Synthetic oligonucleotides were purchased from Gen- was purchased from imaGenes. Each stock was grown in liquid elink. Kits for plasmid and DNA fragment purification were from medium, and plasmid DNAs were purified using a miniplasmid kit Qiagen. Restriction endonucleases were from New England from Qiagen. Constructs from Open Biosystems were obtained in Biolabs. Dispase and collagenase A were from Roche. the pCMV-SPORT6 vector, and constructs from imaGenes were obtained in the pYX-Asc vector. Plasmid DNA from the above Isolation and RT of Total RNAs. Two adult (2- to 10-mo-old) C57BL/ clones was purified using a Qiagen midiprep kit and sequenced 6 mice were killed by cervical dislocation. Their tongues were by the dye terminator method at the University of Pennsylvania excised and placed in a PBS solution containing 2 mM EGTA, DNA Sequencing Facility using an ABI 96-capillary 3730XL and the epithelium containing CV papillae was peeled off, taking Sequencer (Applied Biosystems). Clone DNAs were digested care to minimize contamination from underlying muscle tissue. with SalI and transcribed by T7 or T3 RNA polymerases for NT lingual epithelium devoid of taste buds was isolated from the antisense probes, or they were digested with Not1 and transcribed ventral surface of the tongue in a similar way. Total RNA was by Sp6 RNA polymerase for sense probes. Probes were generated isolated using the Pure-Link RNA mini kit from Invitrogen with the digoxigenin (DIG) RNA Labeling kit (Roche) and were (catalog no.
    [Show full text]
  • Supplementary Table 2
    Supplementary Table 2. Differentially Expressed Genes following Sham treatment relative to Untreated Controls Fold Change Accession Name Symbol 3 h 12 h NM_013121 CD28 antigen Cd28 12.82 BG665360 FMS-like tyrosine kinase 1 Flt1 9.63 NM_012701 Adrenergic receptor, beta 1 Adrb1 8.24 0.46 U20796 Nuclear receptor subfamily 1, group D, member 2 Nr1d2 7.22 NM_017116 Calpain 2 Capn2 6.41 BE097282 Guanine nucleotide binding protein, alpha 12 Gna12 6.21 NM_053328 Basic helix-loop-helix domain containing, class B2 Bhlhb2 5.79 NM_053831 Guanylate cyclase 2f Gucy2f 5.71 AW251703 Tumor necrosis factor receptor superfamily, member 12a Tnfrsf12a 5.57 NM_021691 Twist homolog 2 (Drosophila) Twist2 5.42 NM_133550 Fc receptor, IgE, low affinity II, alpha polypeptide Fcer2a 4.93 NM_031120 Signal sequence receptor, gamma Ssr3 4.84 NM_053544 Secreted frizzled-related protein 4 Sfrp4 4.73 NM_053910 Pleckstrin homology, Sec7 and coiled/coil domains 1 Pscd1 4.69 BE113233 Suppressor of cytokine signaling 2 Socs2 4.68 NM_053949 Potassium voltage-gated channel, subfamily H (eag- Kcnh2 4.60 related), member 2 NM_017305 Glutamate cysteine ligase, modifier subunit Gclm 4.59 NM_017309 Protein phospatase 3, regulatory subunit B, alpha Ppp3r1 4.54 isoform,type 1 NM_012765 5-hydroxytryptamine (serotonin) receptor 2C Htr2c 4.46 NM_017218 V-erb-b2 erythroblastic leukemia viral oncogene homolog Erbb3 4.42 3 (avian) AW918369 Zinc finger protein 191 Zfp191 4.38 NM_031034 Guanine nucleotide binding protein, alpha 12 Gna12 4.38 NM_017020 Interleukin 6 receptor Il6r 4.37 AJ002942
    [Show full text]
  • Network Pharmacology of JAK Inhibitors
    Network pharmacology of JAK inhibitors Devapregasan Moodleya, Hideyuki Yoshidaa, Sara Mostafavib,c, Natasha Asinovskia, Adriana Ortiz-Lopeza, Peter Symanowiczd, Jean-Baptiste Telliezd, Martin Hegend, James D. Clarkd, Diane Mathisa,1, and Christophe Benoista,1 aDivision of Immunology, Department of Microbiology and Immunobiology, Harvard Medical School, Boston, MA 02115; bDepartment of Statistics, University of British Columbia, Vancouver, BC, Canada V6T 1Z4; cDepartment of Medical Genetics, University of British Columbia, Vancouver, BC, Canada V6T 1Z4; and dInflammation and Immunology, Pfizer, Cambridge, MA 02139 Contributed by Christophe Benoist, June 24, 2016 (sent for review April 27, 2016; reviewed by Tadatsugu Taniguchi and Arthur Weiss) Small-molecule inhibitors of the Janus kinase family (JAKis) are side effects that likely reflect cytokine blockade, such as bacterial clinically efficacious in multiple autoimmune diseases, albeit with and fungal infections, in particular, (re)activation of the varicella increased risk of certain infections. Their precise mechanism of action zoster virus, and at high doses, anemia and thrombocytopenia (2, 3). is unclear, with JAKs being signaling hubs for several cytokines. We A new JAKi generation targets single JAK isoforms, which might assessed the in vivo impact of pan- and isoform-specific JAKi in mice improve adverse events by restricting the range of activity. Efficacy by immunologic and genomic profiling. Effects were broad across has been observed with JAK1-selective compounds (7) and com- the immunogenomic network, with overlap between inhibitors. Nat- pounds of reported specificity for JAK3 (ref. 8, but see ref. 2). ural killer (NK) cell and macrophage homeostasis were most imme- However, the premise of substantially improved in vivo specificity diately perturbed, with network-level analysis revealing a rewiring remains unproven, because the impact of JAKi compounds on the of coregulated modules of NK cell transcripts.
    [Show full text]
  • GTP-Binding Proteins • Heterotrimeric G Proteins
    GTP-binding proteins • Heterotrimeric G proteins • Small GTPases • Large GTP-binding proteins (e.g. dynamin, guanylate binding proteins, SRP- receptor) GTP-binding proteins Heterotrimeric G proteins Subfamily Members Prototypical effect Gs Gs, Golf cAMP Gi/o Gi, Go, Gz cAMP , K+-current Gq Gq, G11, G14, Inositol trisphosphate, G15/16 diacylglycerol G12/13 G12, G13 Cytoskeleton Transducin Gt, Gustducin cGMP - phosphodiesterase Offermanns 2001, Oncogene GTP-binding proteins Small GTPases Family Members Prototypical effect Ras Ras, Rap, Ral Cell proliferation; Cell adhesion Rho Rho, Rac, CDC42 Cell shape change & motility Arf/Sar Arf, Sar, Arl Vesicles: fission and fusion Rab Rab (1-33) Membrane trafficking between organelles Ran Ran Nuclear membrane plasticity Nuclear import/export The RAB activation-inactivation cycle REP Rab escort protein GGT geranylgeranyl-transferase GDI GDP-dissociation inhibitor GDF GDI displacementfactor Lipid e.g. RAS e.g. ARF1 modification RAB, Gi/o of GTP-binding proteins Lipid modification Enzyme Reaction Myristoylation N-myristoyl-transferase myristoylates N-terminal glycin Farnesylation Farnesyl-transferase, Transfers prenyl from prenyl-PPi Geranylgeranylation geranylgeranyltransferase to C-terminal CAAX motif Palmitoylation DHHC protein Cysteine-S-acylation General scheme of coated vesicle formation T. J. Pucadyil et al., Science 325, 1217-1220 (2009) Published by AAAS General model for scission of coated buds T. J. Pucadyil et al., Science 325, 1217-1220 (2009) Published by AAAS Conformational change in Arf1 and Sar1 GTPases, regulators of coated vesicular transport This happens if protein is trapped in the active conformation Membrane tubules formed by GTP- bound Arf1 Membrane tubules formed by GTP-bound Sar1 Published by AAAS T.
    [Show full text]
  • Exocytosis by Networks of Rab Gtpases Decoding the Regulation
    The Journal of Immunology Decoding the Regulation of Mast Cell Exocytosis by Networks of Rab GTPases Nurit P. Azouz,* Takahide Matsui,† Mitsunori Fukuda,† and Ronit Sagi-Eisenberg* Exocytosis is a key event in mast cell functions. By this process, mast cells release inflammatory mediators, contained in secretory granules (SGs), which play important roles in immunity and wound healing but also provoke allergic and inflammatory responses. The mechanisms underlying mast cell exocytosis remained poorly understood. An essential step toward deciphering the mechanisms behind exocytosis is the identification of the cellular components that regulate this process. Because Rab GTPases regulate specific trafficking pathways, we screened 44 Rabs for their functional impacts on exocytosis triggered by the Fc«RI or combination of Ca2+ ionophore and phorbol ester. Because exocytosis involves the continuous reorganization of the actin cytoskeleton, we also repeated our screen in the presence of cytochalasin D that inhibits actin polymerization. In this paper, we report on the identification of 30 Rabs as regulators of mast cell exocytosis, the involvement of 26 of which has heretofore not been recognized. Unexpectedly, these Rabs regulated exocytosis in a stimulus-dependent fashion, unless the actin skeleton was disrupted. Functional clustering of the identified Rabs suggested their classification as Rabs involved in SGs biogenesis or Rabs that control late steps of exocytosis. The latter could be further divided into Rabs that localize to the SGs and Rabs that regulate transport from the endocytic recycling compartment. Taken together, these findings unveil the Rab networks that control mast cell exocytosis and provide novel insights into their mechanisms of action.
    [Show full text]