Impacts De La Genève Internationale Sur L'économie Et Les Finances

Total Page:16

File Type:pdf, Size:1020Kb

Impacts De La Genève Internationale Sur L'économie Et Les Finances Impacts de la Genève internationale sur l’économie et les finances suisses et du Grand Genève Résultats 2012 Impacts du secteur public international sur l’économie et les finances suisses et du Grand Genève - 2012 2 Cette étude a été réalisée par le Laboratoire d’Economie Appliquée (ILEA) de la Faculté d’Economie et de Management de l’Université de Genève entre novembre 2013 et juin 2014, sur mandat conjoint du Département Fédéral des Affaires Etrangères, du Service de la Genève internationale de l’Etat de Genève (Département Présidentiel) et du Service des Relations extérieures de la Ville de Genève. Version janvier 2015 Auteurs Gianluigi Giacomel, ILEA Antonio Martin Diaz, ILEA Brice Moussong, ILEA Sous la direction du Prof. Michele Pellizzari, directeur de l’ILEA Groupe de suivi Julien Beauvallet, Service de la Genève internationale Olivier Coutau, Délégué à la Genève internationale Franziska Isliker, DFAE, Section Organisations internationales et politique d'accueil Yannick Roulin, DFAE, Section Organisations internationales et politique d'accueil Danielle Werthmüller, DFAE, Section Privilèges & immunités, Mission permanente de la Suisse auprès de l‘ONUG Laurence Wiedmer, Service des relations extérieures, Ville de Genève Remerciements Coralie Apfel, Département des Finances, Etat de Genève Dyai Conde, CREA, HEC, Université de Lausanne Prof. Yves Flückiger, ILEA Vahan Garibian, ILEA Daniel Hodel, Département des Finances, Etat de Genève Mie Inoue, OCSTAT Hervé Montfort, OCSTAT Prof. Delia Nilles, CREA, HEC, Université de Lausanne Impacts du secteur public international sur l’économie et les finances suisses et du Grand Genève - 2012 3 Table des matières SYNTHÈSE ET CHIFFRES-CLÉ ................................................................................................. 6 A. Introduction ................................................................................................................... 9 1. Contexte .......................................................................................................................................... 9 2. Objectifs de recherche ..................................................................................................................... 9 3. Portée de l’étude : définition de la Genève internationale ........................................................... 10 3.1. Organisations prises en considération pour l’évaluation économique et fiscale .................. 10 3.2. Référence géographique de l’évaluation ............................................................................... 12 3.3. Date de référence de l’évaluation ......................................................................................... 13 4. Données de base et éléments méthodologiques .......................................................................... 13 5. Structure du présent document .................................................................................................... 15 B. Secteur public international : impacts économiques directs, indirects et induits .......... 17 1. Emplois .......................................................................................................................................... 17 1.1. Mise en perspective ............................................................................................................... 17 1.2. Situation 2012 ........................................................................................................................ 18 1.3. Importance de la population internationale en 2012 ............................................................ 21 2. Dépenses directes .......................................................................................................................... 22 2.1. Mise en perspective ............................................................................................................... 22 2.2. Situation 2012 ........................................................................................................................ 23 2.3. Distribution spatiale des dépenses ........................................................................................ 24 3. Effets indirects et induits ............................................................................................................... 27 3.1. Emplois indirects et induits .................................................................................................... 27 3.2. Contribution globale au PIB Cantonal et National ................................................................. 29 4. Synthèse ........................................................................................................................................ 30 C. Recettes fiscales du secteur public international ........................................................... 31 1. Catégories de recettes fiscales générées par la Genève internationale ....................................... 31 2. Impôts perçus sur les salaires générés par les dépenses du secteur public international ............ 32 3. Impôts perçus sur les salaires des personnes rétribuées par le secteur public international, non exemptées ..................................................................................................................................... 33 4. Montant des exonérations fiscales des personnes rétribuées par le secteur public international ....................................................................................................................................................... 35 5. Synthèse ........................................................................................................................................ 36 Impacts du secteur public international sur l’économie et les finances suisses et du Grand Genève - 2012 4 D. Dépenses publiques directes liées au secteur public international ............................... 38 1. Catégories de dépenses publiques directes destinées aux organisations de la Genève internationale ................................................................................................................................ 38 2. Dépenses de la Confédération ...................................................................................................... 40 2.1. Dépenses courantes ............................................................................................................... 40 2.2. Dépenses d’investissement ................................................................................................... 40 2.3. Immobilisations ...................................................................................................................... 41 3. Dépenses de l’Etat de Genève ....................................................................................................... 41 3.1. Dépenses courantes ............................................................................................................... 41 3.2. Dépenses d’investissement ................................................................................................... 42 3.3. Immobilisations ...................................................................................................................... 42 4. Dépenses de la Ville de Genève ..................................................................................................... 43 4.1. Dépenses courantes ............................................................................................................... 43 4.2. Dépenses d’investissement ................................................................................................... 43 4.3. Immobilisations ...................................................................................................................... 43 5. Synthèse ........................................................................................................................................ 44 E. Dépenses publiques indirectes : encadrement de la population internationale ............ 46 1. Nature des dépenses publiques indirectes destinées à l’encadrement de la population internationale ................................................................................................................................ 46 2. Dépenses de la Confédération ...................................................................................................... 46 3. Dépenses de l’Etat de Genève ....................................................................................................... 47 4. Dépenses de la Ville de Genève ..................................................................................................... 48 5. Synthèse ........................................................................................................................................ 49 F. Recettes et dépenses publiques : Bilan ......................................................................... 50 1. Bilan Confédération ....................................................................................................................... 51 2. Bilan Etat de Genève ..................................................................................................................... 52 3. Bilan Ville de Genève ..................................................................................................................... 52 G. Sources et références bibliographiques ........................................................................ 53 H. Annexes
Recommended publications
  • Philipp Fluri and Eden Cole ∗
    DCAF’s Activities in Support of Effective and Democratically Transparent Defense Planning Philipp Fluri and Eden Cole ∗ The Geneva Centre for the Democratic Control of Armed Forces (DCAF) focuses on democratic oversight of and guidance for the defense and security sector. Increasing transparency and efficiency in defense planning and spending thus do not generally fall under DCAF’s purview in the strict sense, and are addressed only within the larger context of defense institution building. The defense budgetary process in a given state—from its formulation by the execu- tive, its enactment into law by the legislature, its implementation, and ultimately its au- diting and evaluation—is circumscribed by a number of parameters, and requires that the different actors have competencies in dealing with democratic processes and multi- ple constituencies that are never called upon under authoritarian systems. On the con- trary, the legislature in authoritarian states is often content to “render unto Caesar what is Caesar’s”—that is, to leave the responsibility for things military with the military and/or the security services, as such matters “cannot be understood by lay persons anyway.” In a similar vein, within their ministry itself the defense planners may decide to leave their task essentially in the hands of the “commissars” of the presidential appa- ratus, as this is the place where power is concentrated and monopolized in such sys- tems. As an important consequence, defense planning in transitional states is fraught with problems that are all too familiar: an executive which has first to learn about transparent planning cycles and gain self-confidence in the implementation thereof; a legislative power which needs to learn about guidance and oversight mechanisms; and national media and institutions of civil society which need to change their expectations from commenting on the successes of authoritarian leadership to the assumption of the responsibility for public oversight.
    [Show full text]
  • 03 (15. Februar 2017)
    2017/03 ISSN 1661-8211 | 117. Jahrgang | 15. Februar 2017 Redaktion und Herausgeberin: Schweizerische Nationalbibliothek NB, Hallwylstrasse 15, CH-3003 Bern Erscheinungsweise: halbmonatlich, am 15. und 30. jeden Monats Hinweise unter: http://ead.nb.admin.ch/web/sb-pdf/ ISSN 1661-8211 © Schweizerische Nationalbibliothek NB, CH-3003 Bern. Alle Rechte vorbehalten Inhaltsverzeichnis - Table des matières - Sommario - Cuntegn - Table of contents Inhaltsverzeichnis - Table des matières - 220 Bibel / Bible / Bibbia / Bibla / Bible....................................... 6 Sommario - Cuntegn - Table of contents 230 Christentum, christliche Theologie / Christianisme, théologie chrétienne / Cristianesimo, teologia cristiana / Cristianissem, teologia cristiana / Christianity and Christian theology..................6 000 Allgemeine Werke, Informatik, Informationswissenschaft / Informatique, information, 290 Andere Religionen / Autres religions / Altre religioni / Autras ouvrages de référence / Informatica, scienza religiuns / Other religions............................................................... 9 dell'informazione, generalità / Informatica, infurmaziun e referenzas generalas / Computers, information and general reference........................................................................................ 1 300 Sozialwissenschaften / Sciences sociales / Scienze sociali / Scienzas socialas / Social sciences.......................... 10 000 Allgemeine Werke, Wissen, Systeme / Généralités, savoir, systèmes / Generalità, sapere, sistemi / Generalitads,
    [Show full text]
  • Thematic Evaluation of European Commission Support to Justice and Security System Reform
    Thematic Evaluation of European Commission Support to Justice and Security System Reform Final Report Volume I – Main Report November 2011 Evaluation for the European Commission Framework contract for Multi-country thematic and regional/country-level strategy European Group for evaluation studies and synthesis in the area of external co- Evaluation EEIG Germany operation LOT 2: Multi-country evaluation studies on social/human development issues of EC external co-operation PARTICIP GmbH Germany Ref.: EuropeAid/122888/C/SER/Multi Request for Service: 2010/234349 Aide à la Décision Economique Belgium Thhematic Evaluation of European Commission Support to Justice and Security Italy System Reform Deutsches Institut für Entwicklungspolitik Germany European Centre for Development Policy Management Final Report Belgium Volume I – Main Report Overseas Development Institute, United Kingdom South Research November 2011 Belgium A consortium of EGEVAL II (Particip & ADE) –DRN-DIE– ECDPM-ODI c/o Particip GmbH, leading Thhis evaluation was carried out by company: Headquarters Merzhauser Str. 183 D - 79100 Freiburg / Germany Phone: +49-761-79074-0 Fax: +49-761-79074-90 [email protected] The evaluation has been managed by the Joint Evaluation Unit in DG DEVCO. The author accepts sole responsibility for this report, drawn up on behalf of the Commission of the European Union. The report does not necessarily reflect the views of the Commission. Thematic Evaluation of the European Commission Support to Justice and Security System Reform ADE - EGEVAL II Table of Contents LIST OF ACRONYMS EXECUTIVE SUMMARY 1. INTRODUCTION ................................................................................................... 1 1.1 OVERALL OBJECTIVE, MANDATE AND SCOPE OF THE EVALUATION .......................... 1 1.2 KEY PHASES OF THE EVALUATION .................................................................................
    [Show full text]
  • Building Integrity and Reducing Corruption in Defence
    Building Integrity and Reducing Corruption in Defence A Compendium of Best Practices The publication of this Compendium is supported by NATO and the Swiss Ministry of Defence Building Integrity and Reducing Corruption in Defence: A Compendium of Best Practices Geneva Centre for the Democratic Control of Armed Forces (DCAF) www.dcaf.ch The Geneva Centre for the Democratic Control of Armed Forces is one of the world’s leading institutions in the areas of security sector reform (SSR) and security sector governance (SSG). DCAF provides in-country advisory support and practical assistance programmes, develops and promotes appropriate democratic norms at the international and national levels, advocates good practices and makes policy recommendations to ensure effective democratic governance of the security sector. DCAF’s partners include governments, parliaments, civil society, international organisations and the range of security sector actors such as police, judiciary, intelligence agencies, border security services and the military. 2010 Building Integrity and Reducing Corruption in Defence: A Compendium of Best Practices Geneva, 2010 The following persons participated in the production of the Compendium of Best Practices in Building Integrity and Reducing Corruption in Defence Editorial Board Philipp Fluri (DCAF), Adrian Kendry (NATO), Simon Lunn (DCAF), Mark Pyman (TI-UK) Editor and Lead Author: Todor Tagarev (Bulgaria) Contributors Jean-Jacques de Dardel (Switzerland) – Foreword, Francois Melese (US) – Chapters 2 and 9, Adrian Kendry and Susan Pond (NATO) – Chapter 3, James Greene (US) – Chap- ters 5, 16 and 22, Mark Pyman (UK) – Chapter 8, Aditya Batara (Indonesia) – Chapter 11, George Lucas (US) – Chapter 12, Alxandre Kukhianidze, Tamuna Karosanidze, Nina Khatiskatsi and Alexander Scrivener (Georgia) – Chapter 13, Anne-Christine Wegener and Mark Pyman (TI-UK) – Chapter 14, Leonid Polyakov (Ukraine) and James Greene (US) – Chapter 17, Wim F.
    [Show full text]
  • The Future of EU Security Sector Assistance: Learning from Experience
    ecdpm’s Making policies work DISCUSSION PAPER No. 271 The future of EU security sector assistance: learning from experience By Matthias Deneckere, Ashley Neat and Volker Hauck May 2020 This paper reflects on the future of the EU’s role in working with foreign security actors. It does so in the context of debates on how to better equip EU external action to deal with conflict and instability, including through a European Peace Facility, while also operationalising the linkages between security and development. Our analysis looks at the support to security sector reform (SSR) as an instrument that resides at this nexus and faces various challenges at the strategic and operational level. Such challenges include balancing short- and long-term objectives, reconciling interests and values, ensuring context sensitivity and overcoming bureaucratic and cultural divisions between policy communities. Drawing on practices from the EU and three member states (Germany, France and the Netherlands) in the domain of security sector reform, the paper provides insights on how such challenges can be practically dealt with. First, it argues that a comprehensive SSR policy not only requires a spelled-out strategy, but also a continued dialogue process between security, peace and development communities at the strategic and policy level, involving experts and civil society actors. Second, SSR needs to build on localised approaches that are informed by political context analysis and build on existing reform processes or windows of opportunity to foster change through targeted interventions. Third, cooperation with security actors should consider the risks in doing harm or negatively impacting conflict dynamics. Practical tools exist to manage risks, but negative effects can never be completely controlled.
    [Show full text]
  • Aists Msa 2012 Application Form
    AISTS MSA 2012 APPLICATION FORM The AISTS MSA is a postgraduate programme organised by the International Academy of Sports Science and Technology and co- signed by the Ecole Polytechnique Fédérale de Lausanne (EPFL), the University of Lausanne, the University of Geneva and the Swiss Graduate School of Public Administration (IDHEAP) Please include the following information and documents in your application file: [ ] Application Form, filled (4 pages) Passport Photo Passport Photo (35mm x 45mm) (35mm x 45mm) [ ] Two Passport Photos [ ] Motivation Letter [ ] Curriculum Vitae - Résumé [ ] Two letters of Recommendation [ ] Copies of University Degree(s) and Grades* *Please include both: • A certified copy of the diploma, conforming to the original issued by the institution or, in certain cases, by legal authorities such as embassies or notaries (The original copy of the diploma must be presented at the beginning of your AISTS MSA studies). • An original copy of your transcripts/grades. If these documents are not in English or French, a certified translation, in either English or French, must be provided along with the aforementioned documents. Motivation Letter The Scientific Committee will very carefully consider your motivation letter (2-3 pages). Please include in your letter at least the following points: • What do you consider to be the key problems facing sport today? • What are your motivations for applying to the AISTS MSA? • Where and in which sector of activity do you intend to work after obtaining your Master’s degree? Make note of any sports organisations/companies that you are in close contact with / are planning to work for. • How do you plan to finance your course fees and living costs during the duration of the course? (Note that the course takes place over a full year) Letters of Recommendation Please provide two letters of recommendation in English.
    [Show full text]
  • 2021 Aists Client Team Project Presentations
    2021 AISTS CLIENT TEAM PROJECT PRESENTATIONS Master of Advanced Studies (MAS) in Sport Administration and Technology 28th and 29th June 2021 at Le Synathlon, Lausanne, Switzerland The World’s No.1 Program in Sports Management by Eduniversal since 2015 The AISTS MAS is co-signed by: SCHEDULE MONDAY TUESDAY 28 JUNE 29 JUNE 9:00 - 10:00 9:00 - 10:00 Analysis of the impact of the IOC FEI Sustainability Handbook for Event Athletes’ Commission Strategy on the Organisers 2.0 global network of athletes’ commissions Client: International Federation for and recommendations for the future Equestrian Sports Client: International Olympic Committee THIS PRESENTATION IS CLOSED TO THE PUBLIC. THIS PRESENTATION IS CLOSED TO THE PUBLIC. 10:20 - 11:20 10:20 - 11:20 Lausanne Hockey Club: Academy World Curling Family: A Membership Development Club Feasibility Study Client: Lausanne Hockey Club Client: World Curling Federation 11:40 - 12:40 11:40 - 12:40 Sustainability Regulations for Sporting Athletics Geek Bot Goods Manufacturers Client: World Athletics Client: Scott Sports SA 13:45 - 14:45 All presentation times are in CET (Swiss Time). Building a social value legacy through major events Client: ARUP Follow the livestream on Register to attend AISTS YouTube Channel MONDAY 28 JUNE 09:00 - 10:00 10:20 - 11:20 Analysis of the impact of the IOC Athletes’ Lausanne Hockey Club: Academy Commission Strategy on the global network Development of athletes’ commissions and recommenda- Client: Lausanne Hockey Club tions for the future Client: International Olympic Committee The Lausanne Hockey Club wants to become the European reference in ice hockey.
    [Show full text]
  • Parliamentary Oversight of Security and Intelligence Agencies in the European Union
    DIRECTORATE GENERAL FOR INTERNAL POLICIES POLICY DEPARTMENT C: CITIZENS' RIGHTS AND CONSTITUTIONAL AFFAIRS CIVIL LIBERTIES, JUSTICE AND HOME AFFAIRS PARLIAMENTARY OVERSIGHT OF SECURITY AND INTELLIGENCE AGENCIES IN THE EUROPEAN UNION STUDY Abstract This study evaluates the oversight of national security and intelligence agencies by parliaments and specialised non-parliamentary oversight bodies, with a view to identifying good practices that can inform the European Parliament’s approach to strengthening the oversight of Europol, Eurojust, Frontex and, to a lesser extent, Sitcen. The study puts forward a series of detailed recommendations (including in the field of access to classified information) that are formulated on the basis of in- depth assessments of: (1) the current functions and powers of these four bodies; (2) existing arrangements for the oversight of these bodies by the European Parliament, the Joint Supervisory Bodies and national parliaments; and (3) the legal and institutional frameworks for parliamentary and specialised oversight of security and intelligence agencies in EU Member States and other major democracies. PE 453.207 EN This document was requested by the European Parliament's Committee on Civil Liberties, Justice and Home Affairs. AUTHORS Aidan WILLS, Geneva Centre for the Democratic Control of Armed Forces (DCAF) Mathias VERMEULEN, European University Institute (EUI) Hans BORN, Project Leader, DCAF Martin SCHEININ, Project Leader, EUI Micha WIEBUSCH, Research Assistant, DCAF Ashley THORNTON, Language Consultant RESPONSIBLE ADMINISTRATOR Andreas HARTMANN Policy Department C: Citizens' Rights and Constitutional Affairs European Parliament B-1047 Bruxelles E-mail: [email protected] LINGUISTIC VERSIONS Original: EN ABOUT THE EDITOR To contact the Policy Department or to subscribe to its newsletter please write to: [email protected] Manuscript completed in June 2011.
    [Show full text]
  • Gender Integration in Democracy, Human Rights, and Governance (DRG)
    Gender Integration in Democracy, Human Rights, and Governance (DRG) PROGRAMMING TOOLKIT JUNE 2016 Acknowledgements External consultant Alyson Kozma conducted the initial research and was the lead author of this toolkit. USAID’s Center of Excellence on Democracy, Human Rights, and Governance (DRG Center), specifically its Gender Working Group, comprised of members from the DRG Center’s leadership team and each of its nine divisions, supported the production of this toolkit. The following people contributed comments during an internal review of the publication: Adam Bushey (DRG), Colin Buckley (DRG), Cathy Cozzarelli (PPL), Julie Denham (DRG), Claire Ehmann (DRG), Mark Goldenbaum (DRG), Martin Hayes (DRG), Ajit Joshi (DRG), Bruce Kay (DRG), Mike Keshishian (DRG), Summer Lopez (DRG), Sharon Rogers (DRG), Lauren Seyfried (DRG), Andrew Solomon (DRG), Tamara Shaya (CMM), and Madeline Williams (DRG). The toolkit also draws on inputs from the DRG Cadre, including Foreign Service Officers and Foreign Service Nationals across missions, collected via electronic survey in 2013. This survey was designed to capture the DRG sub-sectoral priorities identified by the DRG Cadre as they relate to program cycle gender integration and program design. DISCLAIMER The author’s views expressed in this publication do not necessarily reflect the views of the United States Agency for International Development or the United States Government. C2 TABLE OF CONTENTS I. Glossary of Acronyms ..................................................................................................................................................................2
    [Show full text]
  • Class of 2018 Master of Advanced Studies in Sport Administration & Technology
    CLASS OF 2018 MASTER OF ADVANCED STUDIES IN SPORT ADMINISTRATION & TECHNOLOGY The No. 1 Ranked Programme in Sports Management Worldwide by Eduniversal (2015/16/17) The AISTS MAS is co-signed by CLASS OF 2018 MASTER OF ADVANCED STUDIES IN SPORT ADMINISTRATION & TECHNOLOGY aists.org/MASinSportAdministration AISTS MAS IN SPORT ADMINISTRATION A UNIQUE PROGRAMME INTHE OLYMPIC CAPITAL Organised by the AISTS (International Academy of Sports Science and Technology), the AISTS MAS in Sport Administration is a unique postgraduate programme in sports management held annually in Lausanne, the Olympic Capital. Over the course of 15 months, participants are trained by experts in sport and academics, in the following multi-disciplinary fields applied directly to sport : • Management & Economics • Technology • Law • Sociology • Medicine 2 THE NO. 1 RANKED PROGRAMME IN SPORTS MANAGEMENT WORLDWIDE The AISTS MAS in Sport Administration degree is co- signed by some of the best academic and technology institutes of Switzerland : EPFL, University of Lausanne and University of Geneva. The AISTS MAS in Sport Administration is designed for sports-minded professionals wishing to achieve a stronger skill set for their existing or desired career in the sports industry. Participants are fluent in English, have an undergraduate degree, a master’s degree and / or work experience, and are interested in developing or strengthening a career in sports management. In addition, they come from a wide range of nationalities and professions, but all have the same goal of Mastering Sport. The AISTS MAS is co-signed by 3 AISTS MAS WORK EXPERIENCE REQUIREMENTS In addition to course requirements, participants must also complete at least the equivalent of eight weeks of full-time work in the sport industry.
    [Show full text]
  • Private Actors and Security Governance
    Private Actors and Security Governance Alan Bryden, and Marina Caparini (editors.) © 2006, LIT & DCAF Contents List of Graphs and Tables ix Preface xi Abbreviations xiii Part I: Introduction 1 Approaching the Privatisation of Security from 3 a Security Governance Perspective Alan Bryden Part II: The International Policy Context 2 Fragile Statehood, Armed Non-State Actors 23 and Security Governance Ulrich Schneckener 3 Private Sector, Public Security 41 Alyson Bailes 4 Insurgencies, Security Governance and 65 the International Community Albrecht Schnabel. 5 Reconstructing the Public Monopoly 87 of Legitimate Force Herbert Wulf Part III: Regional and National Perspectives 6 Bulgaria's Private Security Industry 109 Philip Gounev 7 The Commercialisation of Post-Soviet Private Security 129 Duncan Hiscock 8 Challenges of Security Privatisation in Iraq 149 David Isenberg 9 Implementing South Africa’s Regulation of 167 Foreign Military Assistance Act Raenette Taljaard Part IV: Challenges of Regulation 10 Regulating Military and Security Services 189 in the European Union Elke Krahmann 11 The United Nations and the Dilemma 213 of Outsourcing Peacekeeping Operations Victor-Yves Ghebali 12 Assessing the Relationship between Humanitarian 231 Actors and Private Security Companies Christopher Spearin 13 Private Security Actors, Donors and SSR 247 Peter Wilson Part V: Conclusion 14 Applying a Security Governance Perspective to 263 the Privatisation of Security Marina Caparini Annex International Organisations and the Governance of 285 Private Security
    [Show full text]
  • Global Journal of Human Social Science Relevance to the Career, Tutors Competence and Exacerbated by Shortage of Human Resources for Health
    Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS Integration of Community Health An Assessment of the Terrorism Satisfaction on the Training program Sources of Development of Aviation VOLUME 18 ISSUE 1 VERSION 1.0 Global Journal of Human-Social Science: H Interdisciplinary Global Journal of Human-Social Science: H Interdisciplinary Volume 18 Issue 1 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2018. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Glo bal Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG
    [Show full text]