Genome-Wide Profiling of P53-Regulated Enhancer Rnas
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Evidence for Differential Alternative Splicing in Blood of Young Boys With
Stamova et al. Molecular Autism 2013, 4:30 http://www.molecularautism.com/content/4/1/30 RESEARCH Open Access Evidence for differential alternative splicing in blood of young boys with autism spectrum disorders Boryana S Stamova1,2,5*, Yingfang Tian1,2,4, Christine W Nordahl1,3, Mark D Shen1,3, Sally Rogers1,3, David G Amaral1,3 and Frank R Sharp1,2 Abstract Background: Since RNA expression differences have been reported in autism spectrum disorder (ASD) for blood and brain, and differential alternative splicing (DAS) has been reported in ASD brains, we determined if there was DAS in blood mRNA of ASD subjects compared to typically developing (TD) controls, as well as in ASD subgroups related to cerebral volume. Methods: RNA from blood was processed on whole genome exon arrays for 2-4–year-old ASD and TD boys. An ANCOVA with age and batch as covariates was used to predict DAS for ALL ASD (n=30), ASD with normal total cerebral volumes (NTCV), and ASD with large total cerebral volumes (LTCV) compared to TD controls (n=20). Results: A total of 53 genes were predicted to have DAS for ALL ASD versus TD, 169 genes for ASD_NTCV versus TD, 1 gene for ASD_LTCV versus TD, and 27 genes for ASD_LTCV versus ASD_NTCV. These differences were significant at P <0.05 after false discovery rate corrections for multiple comparisons (FDR <5% false positives). A number of the genes predicted to have DAS in ASD are known to regulate DAS (SFPQ, SRPK1, SRSF11, SRSF2IP, FUS, LSM14A). In addition, a number of genes with predicted DAS are involved in pathways implicated in previous ASD studies, such as ROS monocyte/macrophage, Natural Killer Cell, mTOR, and NGF signaling. -
Whole Exome Sequencing in Families at High Risk for Hodgkin Lymphoma: Identification of a Predisposing Mutation in the KDR Gene
Hodgkin Lymphoma SUPPLEMENTARY APPENDIX Whole exome sequencing in families at high risk for Hodgkin lymphoma: identification of a predisposing mutation in the KDR gene Melissa Rotunno, 1 Mary L. McMaster, 1 Joseph Boland, 2 Sara Bass, 2 Xijun Zhang, 2 Laurie Burdett, 2 Belynda Hicks, 2 Sarangan Ravichandran, 3 Brian T. Luke, 3 Meredith Yeager, 2 Laura Fontaine, 4 Paula L. Hyland, 1 Alisa M. Goldstein, 1 NCI DCEG Cancer Sequencing Working Group, NCI DCEG Cancer Genomics Research Laboratory, Stephen J. Chanock, 5 Neil E. Caporaso, 1 Margaret A. Tucker, 6 and Lynn R. Goldin 1 1Genetic Epidemiology Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 2Cancer Genomics Research Laboratory, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 3Ad - vanced Biomedical Computing Center, Leidos Biomedical Research Inc.; Frederick National Laboratory for Cancer Research, Frederick, MD; 4Westat, Inc., Rockville MD; 5Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; and 6Human Genetics Program, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD, USA ©2016 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol.2015.135475 Received: August 19, 2015. Accepted: January 7, 2016. Pre-published: June 13, 2016. Correspondence: [email protected] Supplemental Author Information: NCI DCEG Cancer Sequencing Working Group: Mark H. Greene, Allan Hildesheim, Nan Hu, Maria Theresa Landi, Jennifer Loud, Phuong Mai, Lisa Mirabello, Lindsay Morton, Dilys Parry, Anand Pathak, Douglas R. Stewart, Philip R. Taylor, Geoffrey S. Tobias, Xiaohong R. Yang, Guoqin Yu NCI DCEG Cancer Genomics Research Laboratory: Salma Chowdhury, Michael Cullen, Casey Dagnall, Herbert Higson, Amy A. -
Open Full Page
Author Manuscript Published OnlineFirst on March 9, 2017; DOI: 10.1158/0008-5472.CAN-16-2339 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Title Page Title: Pancreatic cancer progression relies upon mutant p53-induced oncogenic signaling mediated by NOP14 Yongxing Du1,§, Ziwen Liu1, §, Lei You1, Pengjiao Hou2, Xiaoxia Ren1, Tao Jiao2, Wenjing Zhao1, Zongze Li1, Hong Shu1, Changzheng Liu2,*, Yupei Zhao1,* 1 Department of General Surgery, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Peking Union Medical College, Beijing 100730, PR China 2 Department of Biochemistry and Molecular Biology, State Key Laboratory of Medical Molecular Biology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences,School of Basic Medicine, Peking Union Medical College, Beijing 100005, PR China § Authors share co-first authorship. * To whom correspondence should be addressed: Yupei Zhao, E-mail: [email protected], Fax: 86-10-65124875; Changzheng Liu, E-mail: [email protected], Fax: 86-10-65253005. Running Title: NOP14 primes mutp53-driven cancer progression Key words: Pancreatic ductal adenocarcinoma, Mutant p53, NOP14, Cancer metastasis Abbreviations: Mutp53, Mutant p53; PDAC, Pancreatic ductal adenocarcinoma; NOP14, NOP14 nucleolar protein; rRNA, ribosomal RNA; PDGFRb, Platelet-derived 1 Downloaded from cancerres.aacrjournals.org on September 26, 2021. © 2017 American Association for Cancer Research. Author Manuscript Published OnlineFirst on March 9, -
Phylogenetic Analysis of the Haemagglutinin Gene of Canine
Guo et al. Virology Journal 2013, 10:109 http://www.virologyj.com/content/10/1/109 RESEARCH Open Access Phylogenetic analysis of the haemagglutinin gene of canine distemper virus strains detected from giant panda and raccoon dogs in China Ling Guo1, Shao-lin Yang1, Cheng-dong Wang2, Rong Hou3, Shi-jie Chen4, Xiao-nong Yang5, Jie Liu1, Hai-bo Pan1, Zhong-xiang Hao1, Man-li Zhang1, San-jie Cao1 and Qi-gui Yan1,6* Abstract Background: Canine distemper virus (CDV) infects a variety of carnivores, including wild and domestic Canidae. In this study, we sequenced and phylogenetic analyses of the hemagglutinin (H) genes from eight canine distemper virus (CDV) isolates obtained from seven raccoon dogs (Nyctereutes procyonoides) and a giant panda (Ailuropoda melanoleuca) in China. Results: Phylogenetic analysis of the partial hemagglutinin gene sequences showed close clustering for geographic lineages, clearly distinct from vaccine strains and other wild-type foreign CDV strains, all the CDV strains were characterized as Asia-1 genotype and were highly similar to each other (91.5-99.8% nt and 94.4-99.8% aa). The giant panda and raccoon dogs all were 549Y on the HA protein in this study, irrespective of the host species. Conclusions: These findings enhance our knowledge of the genetic characteristics of Chinese CDV isolates, and may facilitate the development of effective strategies for monitoring and controlling CDV for wild canids and non-cainds in China. Keywords: Canine distemper virus, Haemagglutinin (H) gene, Genotype, Phylogenetic analysis Background of specialist traits and increased expression of generalist CD is caused by the canine distemper virus (CDV) which traits, thereby confirming its functional importance [10]. -
Pharmacodynamic Effects of Seliciclib, an Orally Administered
Cancer Therapy: Clinical Pharmacodynamic Effects of Seliciclib, an Orally Administered Cell Cycle Modulator, in Undifferentiated Nasopharyngeal Cancer Wen-Son Hsieh,4 Ross Soo,1Bee-Keow Peh,2 Thomas Loh,4 Difeng Dong,3 Donny Soh,5 Lim-SoonWong,3,5 Simon Green,6 Judy Chiao,6 Chun-Ying Cui,1Yo k e -F o n g L a i , 4 Soo-Chin Lee,1Benjamin Mow,1 Richie Soong,2 Manuel Salto-Tellez,2 and Boon-Cher Goh1, 2 Abstract Purpose: Cell cycle dysregulation resulting in expression of antiapoptotic genes and uncontrolled proliferation is a feature of undifferentiated nasopharyngeal carcinoma. The pharmacodynamic effects of seliciclib, a cyclin-dependent kinase (CDK) inhibitor, were studied in patients with nasopharyngeal carcinoma. Experimental Design: Patients with treatment-naI«ve locally advanced nasopharyngeal carci- noma received seliciclib at 800 mg or 400 mg twice daily on days1 to 3 and 8 to12.Paired tumor samples obtained at baseline and on day 13 were assessed by light microscopy, immunohisto- chemistry, and transcriptionalprofiling using real-time PCR low-density array consisting of apanel of 380 genes related to cell cycle inhibition, apoptosis, signal transduction, and cell proliferation. Results: At 800 mg bd, one patient experienced grade 3 liver toxicity and another had grade 2 vomiting; no significant toxicities were experienced in 13 patients treated at 400 mg bd. Seven of fourteen evaluable patients had clinical evidence of tumor reduction. Some of these responses were associated with increased tumor apoptosis, necrosis, and decreases in plasma EBV DNA posttreatment. Reduced protein expression of Mcl-1, cyclin D1, phosphorylated retinoblastoma protein pRB (T821), and significant transcriptional down-regulation of genes related to cellular proliferation and survival were shown in some patients posttreatment, indicative of cell cycle modulation by seliciclib, more specifically inhibition of cdk2/cyclin E, cdk7/cyclin H, and cdk9/cyclinT. -
Interplay Between P53 and Epigenetic Pathways in Cancer
University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2016 Interplay Between P53 and Epigenetic Pathways in Cancer Jiajun Zhu University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Biology Commons, Cell Biology Commons, and the Molecular Biology Commons Recommended Citation Zhu, Jiajun, "Interplay Between P53 and Epigenetic Pathways in Cancer" (2016). Publicly Accessible Penn Dissertations. 2130. https://repository.upenn.edu/edissertations/2130 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/2130 For more information, please contact [email protected]. Interplay Between P53 and Epigenetic Pathways in Cancer Abstract The human TP53 gene encodes the most potent tumor suppressor protein p53. More than half of all human cancers contain mutations in the TP53 gene, while the majority of the remaining cases involve other mechanisms to inactivate wild-type p53 function. In the first part of my dissertation research, I have explored the mechanism of suppressed wild-type p53 activity in teratocarcinoma. In the teratocarcinoma cell line NTera2, we show that wild-type p53 is mono-methylated at Lysine 370 and Lysine 382. These post-translational modifications contribute ot the compromised tumor suppressive activity of p53 despite a high level of wild-type protein in NTera2 cells. This study provides evidence for an epigenetic mechanism that cancer cells can exploit to inactivate p53 wild-type function. The paradigm provides insight into understanding the modes of p53 regulation, and can likely be applied to other cancer types with wild-type p53 proteins. On the other hand, cancers with TP53 mutations are mostly found to contain missense substitutions of the TP53 gene, resulting in expression of full length, but mutant forms of p53 that confer tumor-promoting “gain-of-function” (GOF) to cancer. -
CDV3 (NM 001134422) Human Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG225254 CDV3 (NM_001134422) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CDV3 (NM_001134422) Human Tagged ORF Clone Tag: TurboGFP Symbol: CDV3 Synonyms: H41 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG225254 representing NM_001134422 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGAGACGGAGGAGCGGAGCCTGGACAACTTCTTTGCCAAGAGGGACAAGAAGAAGAAGAAGGAGC GGAGCAACCGGGCGGCGAGTGCCGCGGGCGCAGCGGGCAGCGCCGGCGGAAGCAGTGGAGCCGCGGGTGC GGCGGGCGGCGGGGCGGGCGCGGGGACCCGGCCGGGTGACGGCGGGACCGCCAGCGCGGGGGCTGCGGGC CCAGGGGCCGCCACCAAGGCTGTGACGAAGGACGAAGATGAATGGAAAGAATTGGAGCAAAAAGAGGTTG ATTACAGCGGCCTCAGGGTTCAGGCAATGCAAATAAGCAGTGAAAAGGAAGAAGACGATAATGAAAAGAG ACAAGATCCAGGTGATAACTGGGAAGAAGGTGGAGGTGGTGGTGGAGGTATGGAAAAATCTTCAGGTCCC TGGAATAAAACAGCTCCAGTACAAGCACCTCCTGCTCCAGTAATTGTTACAGAAACCCCAGAACCAGCGA TGACTAGTGGTGTGTATAGGCCTCCTGGGGCCAGGTTAACCACAACAAGGAAAACACCACAAGGACCACC AGAAATCTACAGTGATACACAGTTCCCATCCCTGCAGTCAACTGCCAAGCATGTAGAAAGCCGGAACAGG TACTTAAAA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG225254 representing NM_001134422 Red=Cloning site Green=Tags(s) MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAG PGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGP -
WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T
(12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T (51) International Patent Classification: David [US/US]; 13539 N . 95th Way, Scottsdale, AZ C12Q 1/68 (2006.01) 85260 (US). (21) International Application Number: (74) Agent: AKHAVAN, Ramin; Caris Science, Inc., 6655 N . PCT/US20 12/0425 19 Macarthur Blvd., Irving, TX 75039 (US). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 14 June 2012 (14.06.2012) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, English (25) Filing Language: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, Publication Language: English DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, (30) Priority Data: KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, 61/497,895 16 June 201 1 (16.06.201 1) US MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, 61/499,138 20 June 201 1 (20.06.201 1) US OM, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SC, SD, 61/501,680 27 June 201 1 (27.06.201 1) u s SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, 61/506,019 8 July 201 1(08.07.201 1) u s TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. -
Gene Expression Analysis of Mevalonate Kinase Deficiency
International Journal of Environmental Research and Public Health Article Gene Expression Analysis of Mevalonate Kinase Deficiency Affected Children Identifies Molecular Signatures Related to Hematopoiesis Simona Pisanti * , Marianna Citro , Mario Abate , Mariella Caputo and Rosanna Martinelli * Department of Medicine, Surgery and Dentistry ‘Scuola Medica Salernitana’, University of Salerno, Via Salvatore Allende, 84081 Baronissi (SA), Italy; [email protected] (M.C.); [email protected] (M.A.); [email protected] (M.C.) * Correspondence: [email protected] (S.P.); [email protected] (R.M.) Abstract: Mevalonate kinase deficiency (MKD) is a rare autoinflammatory genetic disorder charac- terized by recurrent fever attacks and systemic inflammation with potentially severe complications. Although it is recognized that the lack of protein prenylation consequent to mevalonate pathway blockade drives IL1β hypersecretion, and hence autoinflammation, MKD pathogenesis and the molecular mechanisms underlaying most of its clinical manifestations are still largely unknown. In this study, we performed a comprehensive bioinformatic analysis of a microarray dataset of MKD patients, using gene ontology and Ingenuity Pathway Analysis (IPA) tools, in order to identify the most significant differentially expressed genes and infer their predicted relationships into biological processes, pathways, and networks. We found that hematopoiesis linked biological functions and pathways are predominant in the gene ontology of differentially expressed genes in MKD, in line with the observed clinical feature of anemia. We also provided novel information about the molecular Citation: Pisanti, S.; Citro, M.; Abate, M.; Caputo, M.; Martinelli, R. mechanisms at the basis of the hematological abnormalities observed, that are linked to the chronic Gene Expression Analysis of inflammation and to defective prenylation. -
Genomic and Epigenomic EBF1 Alterations Modulate TERT Expression in Gastric Cancer
Genomic and epigenomic EBF1 alterations modulate TERT expression in gastric cancer Manjie Xing, … , Bin Tean Teh, Patrick Tan J Clin Invest. 2020;130(6):3005-3020. https://doi.org/10.1172/JCI126726. Research Article Gastroenterology Oncology Graphical abstract Find the latest version: https://jci.me/126726/pdf The Journal of Clinical Investigation RESEARCH ARTICLE Genomic and epigenomic EBF1 alterations modulate TERT expression in gastric cancer Manjie Xing,1,2,3 Wen Fong Ooi,2 Jing Tan,4,5 Aditi Qamra,2,3 Po-Hsien Lee,6 Zhimei Li,5 Chang Xu,1,6 Nisha Padmanabhan,1 Jing Quan Lim,7 Yu Amanda Guo,8 Xiaosai Yao,9 Mandoli Amit,1 Ley Moy Ng,6 Taotao Sheng,1,10 Jing Wang,1 Kie Kyon Huang,1 Chukwuemeka George Anene-Nzelu,11,12 Shamaine Wei Ting Ho,1,6 Mohana Ray,13 Lijia Ma,13 Gregorio Fazzi,14 Kevin Junliang Lim,1 Giovani Claresta Wijaya,5 Shenli Zhang,1 Tannistha Nandi,2 Tingdong Yan,1 Mei Mei Chang,8 Kakoli Das,1 Zul Fazreen Adam Isa,2 Jeanie Wu,1 Polly Suk Yean Poon,2 Yue Ning Lam,2 Joyce Suling Lin,2 Su Ting Tay,1 Ming Hui Lee,1 Angie Lay Keng Tan,1 Xuewen Ong,1 Kevin White,13,15 Steven George Rozen,1,16 Michael Beer,17,18 Roger Sik Yin Foo,11,12 Heike Irmgard Grabsch,14,19 Anders Jacobsen Skanderup,8 Shang Li,1,20 Bin Tean Teh,1,5,6,9,16,20 and Patrick Tan1,2,6,16,21,22,23 1Cancer and Stem Cell Biology Program, Duke-NUS Medical School, Singapore. -
Transcriptional Recapitulation and Subversion Of
Open Access Research2007KaiseretVolume al. 8, Issue 7, Article R131 Transcriptional recapitulation and subversion of embryonic colon comment development by mouse colon tumor models and human colon cancer Sergio Kaiser¤*, Young-Kyu Park¤†, Jeffrey L Franklin†, Richard B Halberg‡, Ming Yu§, Walter J Jessen*, Johannes Freudenberg*, Xiaodi Chen‡, Kevin Haigis¶, Anil G Jegga*, Sue Kong*, Bhuvaneswari Sakthivel*, Huan Xu*, Timothy Reichling¥, Mohammad Azhar#, Gregory P Boivin**, reviews Reade B Roberts§, Anika C Bissahoyo§, Fausto Gonzales††, Greg C Bloom††, Steven Eschrich††, Scott L Carter‡‡, Jeremy E Aronow*, John Kleimeyer*, Michael Kleimeyer*, Vivek Ramaswamy*, Stephen H Settle†, Braden Boone†, Shawn Levy†, Jonathan M Graff§§, Thomas Doetschman#, Joanna Groden¥, William F Dove‡, David W Threadgill§, Timothy J Yeatman††, reports Robert J Coffey Jr† and Bruce J Aronow* Addresses: *Biomedical Informatics, Cincinnati Children's Hospital Medical Center, Cincinnati, OH 45229, USA. †Departments of Medicine, and Cell and Developmental Biology, Vanderbilt University and Department of Veterans Affairs Medical Center, Nashville, TN 37232, USA. ‡McArdle Laboratory for Cancer Research, University of Wisconsin, Madison, WI 53706, USA. §Department of Genetics and Lineberger Cancer Center, University of North Carolina, Chapel Hill, NC 27599, USA. ¶Molecular Pathology Unit and Center for Cancer Research, Massachusetts deposited research General Hospital, Charlestown, MA 02129, USA. ¥Division of Human Cancer Genetics, The Ohio State University College of Medicine, Columbus, Ohio 43210-2207, USA. #Institute for Collaborative BioResearch, University of Arizona, Tucson, AZ 85721-0036, USA. **University of Cincinnati, Department of Pathology and Laboratory Medicine, Cincinnati, OH 45267, USA. ††H Lee Moffitt Cancer Center and Research Institute, Tampa, FL 33612, USA. ‡‡Children's Hospital Informatics Program at the Harvard-MIT Division of Health Sciences and Technology (CHIP@HST), Harvard Medical School, Boston, Massachusetts 02115, USA. -
Epigenetics Changes in Breast Cancer
ering & B ne io gi m n e e d io i c B a f l Behera P, J Bioengineer & Biomedical Sci 2017, S Journal of o l c a i e n n r 7:2 c u e o J DOI: 10.4172/2155-9538.1000223 ISSN: 2155-9538 Bioengineering & Biomedical Science Review Article Open Access Epigenetics Changes in Breast Cancer: Current Aspects in India Behera P* Department of Biotechnology, Amity University, Lucknow, India *Corresponding author: Behera P, Department of Biotechnology, Amity University, Lucknow, India, Tel: 9703466651; E-mail: [email protected] Received date: March 25, 2017; Accepted date: April 4, 2017; Published date: April 15, 2017 Copyright: © 2017 Behera P. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution and reproduction in any medium, provided the original author and source are credited. Abstract Epigenetics is turning out to be one of the promising studies in cancer research. This review focuses mainly on how genetic and epigenetic factors like DNA methylation, histone modifications and various other genes can assess the promoter region of cancer related genes and provides a tool for cancer diagnosis and research. The objective of the review is to provide an overview of the literature with some recent developments providing insights into the important question of co-evolution of epigenetic changes in breast cancer progression and tumorigenesis. This review also comply study of different genetic changes existing in breast cancer. Further in this review focus on functioning of DNA methylation, including both normal, disruptions or abnormal role in human disease, and changes in DNA methylation during human breast cancer is also noted.