DOCSLIB.ORG

Course Rationale

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Course Rationale Grade 12 Global Issues: Citizenship and Sustainability Course Rationale State of the Planet Although the Earth is 4.6 billion years old, modern humans have been round for just a small fraction of that time - about 250,000 years. Since then, somewhere between 60 and 110 billion people are thought to have lived on this planet, civilizations have come and gone, and through all this time the Earth has nourished and sustained life. Until recently we have not paid a great deal of attention to the impact of human activity and civilizations on the state of the planet, nor have we paid adequate attention to the needs of our fellow humans. In recent years, people have watched with increasing concern as significant environmental changes have become more apparent. We are beginning to realize that these changes may be the result of human activity – and, even worse, that our future on Earth is no longer certain. The 20th century has also seen the beginning of global efforts to Millennium Development Goals improve human quality of life by working toward collective social 1. Eradicate extreme poverty and goals. In 1948, the United Nations Declaration of Universal Human Rights marked a significant turning point in concern for the dignity hunger of all human beings, while in the year 2000 the UN established the 2. Achieve universal primary Millennium Development Goals to improve life for people across education the globe. 3. Promote gender equality and empower women Although some progress has been made, if we are to improve the human condition and sustain the Earth for future generations, more 4. Reduce child mortality work must be done. We cannot continue along the path we are on 5. Improve maternal health – we need to change the way we live, reconnect to the natural 6. Combat HIV/AIDS, malaria and world, develop an ethos based on ecological thinking and global other diseases concern, and teach our children to do the same. 7. Ensure environmental Why students should take this course sustainability 8. Develop a Global Partnership for Social studies examines human societies and the complex interactions of human beings living together in a shared world. This Development course provides a lens of ecological literacy through which students http://www.undp.org/mdg/ can study and understand the complex and often critical global issues that societies face today. Through this lens, students apply concepts related to sustainability, learn about the interdependence of environmental, social, political and economic systems, and develop competencies for thinking and acting as ecologically literate citizens committed to social justice. The overall purpose of this study is not to instil fear in the next generation, nor to make students feel guilty for problems which are the cumulative legacy of many generations of mistakes, recklessness, and, in some cases, deliberate neglect or exploitation. Rather, the intent is to help students understand that human societies and institutions can and should be renewed, beginning with matters of personal lifestyle, and extending through to collective, large-scale social change. The role of education in this change is vital, hence the importance of this course both as an instrument of critical understanding – seeking the truth – and as an instrument of hope – seeking to create a better future. The role of education in social change Education plays a crucial role in motivating and informing Education is the point at which we both personal and social change. With this in mind, this decide whether we love the world course is designed to help students acquire a critical enough to assume responsibility for awareness about global issues, to alert them to the need to it and, by the same token save it be vigilant about the consequences of their decisions and from ruin which, except for actions, and to provide them with opportunities to take renewal, except for the coming of action for positive change. the new and young, would be This course consolidates learning across the disciplines and inevitable. And education, too, is helps students develop competencies as citizens who are where we decide whether we love mindful of their place in nature and in society and who are our children enough not to expel willing to work together toward a sustainable future. The them from our world and leave pedagogical approach is based on the principles of active them to their own devices, not to democratic citizenship, ecological literacy, critical media strike from their hands their chance literacy, and ethical decision-making. Throughout the of undertaking something new, course, students examine the social, political, something unforeseen by us, but to environmental, and economic impact of emerging issues on prepare them in advance for the quality of life – locally, nationally and globally. They are task of renewing a common world. provided with opportunities to engage in inquiry, active Hannah Arendt (1968).The crisis in experiential learning, dialogue, collaboration, reflection and education. New York: Penguin Books, decision-making. With a view to transforming life practices, p. 196 this course includes the planning and implementation of a school or community based action-research project. G r a d e 12 G l o b al I s s u e s: C i t i z e n s h i p a n d S u s t a i n a b i l i t y Enduring Understandings Take Action Learning to know 2XUHFRORJLFDOIRRWSULQWLVH[FHHGLQJ(DUWK¶VFDSDFLW\WR 0LQLPL]H\RXUHFRORJLFDOIRRWSULQWDQGOLYHPRUHUHVSRQVLEO\ Learning to be VXVWDLQELRGLYHUVLW\DQGKXPDQOLIH HJXVHIHZHUQRQUHQHZDEOHUHVRXUFHVUHGXFHZDVWHOLPLW Acquire knowledge and understanding, GHSHQGHQFHRQSHWURFKHPLFDOVVHHNVXVWDLQDEOHDQGHWKLFDO Build self-knowledge and be conscious and think critically about our complex IRRGFKRLFHV of connections to nature and society. and changing world. $SSUHFLDWHWKHQDWXUDOZRUOGDQGOLYHE\ 'HYHORSHFRORJLFDOOLWHUDF\WKURXJKDQXQGHU 2XUGHFLVLRQVDQGDFWLRQVPDWWHUWKH\KDYHVRFLDO 5HFRJQL]HWKHFRQVHTXHQFHVRI\RXUGHFLVLRQVDQGWDNHDFWLRQ HFRORJLFDOSULQFLSOHV VWDQGLQJRI WKHLQWHUGHSHQGHQFHRIVRFLHW\ HQYLURQPHQWDOHFRQRPLFDQGSROLWLFDOFRQVHTXHQFHV DVDFLWL]HQIRUDVXVWDLQDEOHDQGMXVWIXWXUHIRUDOO %HZLOOLQJWRFRQWULEXWHWRWKHSUHVHQWDQG WKHHQYLURQPHQWDQGWKHHFRQRP\ IXWXUHZHOOEHLQJRIDOO %HRSHQWRQHZLGHDVDQGGLYHUJHQWWKLQNLQJ ,QGLYLGXDOVJURXSVJRYHUQPHQWVDQGFRUSRUDWLRQV %HDQHWKLFDOGHFLVLRQPDNHUWDNHDVWDQGWRVXSSRUWTXDOLW\ %HLQWURVSHFWLYHUHIOHFWLYHDQGVHOIDZDUH 6HHNNQRZOHGJHIURPGLYHUVHVRXUFHV KDYHWKHSRZHUWRHIIHFWFKDQJHDQGWKHUHVSRQVLELOLW\ RIOLIHIRUDOODQGFKDOOHQJHWKHXQHWKLFDODQGWKH $FTXLUHDVWURQJVHQVHRIVHOINQRZOHGJH DQGSHUVSHFWLYHV WRFRQWULEXWHWRDVXVWDLQDEOHIXWXUH XQVXVWDLQDEOH DQGSHUVRQDOLGHQWLW\ 8VHFUHDWLYHFULWLFDODQGV\VWHPVWKLQNLQJ $FFHSWDQGH[SUHVVPXOWLSOHLGHQWLWLHV WRDGGUHVVFRPSOH[TXHVWLRQV 7KHPHGLDGRQRWSURYLGHQHXWUDOUHIOHFWLRQVRIUHDOLW\ (YDOXDWHWKHSXUSRVHVRIPHGLDFULWLFDOO\TXHVWLRQLQIRUPDWLRQ DOOHJLDQFHVDQGLQIOXHQFHV &RQGXFWIRFXVHGLQGHSWKLQTXLU\ WKH\DIIHFWRXUGHFLVLRQVDQGDFWLRQV VRXUFHVDQGRXUUHVSRQVHVWRPHGLDDQGPDNHGHFLVLRQV .QRZKRZWREHDQGKRZWROLYHZLWKRWKHUV ([SORUHDOWHUQDWLYHDSSURDFKHVWRLVVXHVZLWKRXW DFFRUGLQJO\ LQVKDUHGVSDFHV IHDURIFKDOOHQJLQJWKHVWDWXVTXR (QJDJHLQORQJWHUPWKLQNLQJDQGDUWLFXODWH DYLVLRQIRUDVXVWDLQDEOHIXWXUH $JOREDOHFRQRPLFV\VWHPWKDWGHSHQGVXSRQDQG 0DNHFRQVXPSWLRQGHFLVLRQVWKDWIROORZHFRORJLFDODQGHWKLFDO SHUSHWXDWHVXQUHVWUDLQHGFRQVXPHULVPLVXQVXVWDLQDEOH SULQFLSOHVDQGEHUHVSHFWIXORIQDWXUHVHOIDQGVRFLHW\LQ\RXU DFWLRQV (FRQRPLFDQGWHFKQRORJLFDOGHYHORSPHQWKDVFRQWULEXWHG $VVHVVWKHUHODWLYHYDOXHDQGVXVWDLQDELOLW\RIHFRQRPLF JUHDWO\WRVRFLHW\EXWRIWHQZLWKKDUPIXOKXPDQDQG DQGWHFKQRORJLFDOGHYHORSPHQWVLQRUGHUWRPDNHLQIRUPHG Learning to do HQYLURQPHQWDOFRQVHTXHQFHV GHFLVLRQV Learning to live together Learn to participate effectively in local, ,QGLJHQRXVNQRZOHGJHDQGZRUOGYLHZVRIIHUDOWHUQDWLYHVWR ([SORUHLQGLJHQRXVSHUVSHFWLYHVWRH[WHQGWKHERXQGDULHV Learn to live peacefully with others and to SUHYDLOLQJDVVXPSWLRQVDERXWKRZWROLYHZLWKRQHDQRWKHU RIWKHIDPLOLDUDQGWRFKDOOHQJHDVVXPSWLRQVDQGSUDFWLFHV national, and global communities. care for our common homeland. ZLWKLQWKHHQYLURQPHQW $FWUHVSRQVLEO\WRZDUGVVHOIRWKHUVDQG 5HVSHFW(DUWKDVDVKDUHGFRPPRQVPDGH WKHHQYLURQPHQW XSRIFRPSOH[DQGLQWHUFRQQHFWHGV\VWHPV 3ROLWLFDOV\VWHPVGLVWULEXWHSRZHUSULYLOHJHDQGZHDOWK 6XSSRUWGHPRFUDWLFFLWL]HQVKLSDQGEHYLJLODQWDERXW %HZLOOLQJWROHWJRDQGJLYHEDFNDQGWR 5HFRJQL]HWKHVROLGDULW\RIDOOKXPDQEHLQJV LQGLIIHUHQWZD\VVRPHPRUHMXVWO\WKDQRWKHUV SROLWLFDOGHFLVLRQVWKDWDIIHFWVRFLDOHFRQRPLFDQG PDNHFKDQJHVVRDVWROLYHVXVWDLQDEO\ DQGWKHLUGHSHQGHQFHXSRQWKHSODQHW HQYLURQPHQWDOFRQGLWLRQV %HDQHPSRZHUHGDQGFRPPLWWHGDJHQWRI 5HVSHFWGLYHUVLW\DQGYDOXHHTXLW\ FKDQJHZLOOLQJWRWDNHDVWDQGDQGHQJDJH (QJDJHLQLQWHUFXOWXUDOGLDORJXHDQGFXOWLYDWH LQDFWLRQIRUDVXVWDLQDEOHIXWXUH %HFRPPLWWHGWRXQLYHUVDOKXPDQULJKWVUHJDUGOHVVRI DZLGHQLQJFLUFOHRIHPSDWK\DQGFRQFHUQ &XOWLYDWHDQGVKDUHSHUVRQDOVNLOOVWDOHQWV $MXVWVRFLHW\UHVSHFWVKXPDQGLYHUVLW\DQGUHFRJQL]HV JHQGHUDJHSK\VLFDODELOLW\VH[XDORULHQWDWLRQODQJXDJH 5HVSHFWWKHLQKHUHQWLQDOLHQDEOHDQG DQGJLIWV XQLYHUVDOHTXDODQGLQDOLHQDEOHKXPDQULJKWV FXOWXUHUHOLJLRQSROLWLFDOEHOLHIVHWKQLFLW\QDWLRQDORUVRFLDO XQLYHUVDOQDWXUHRIKXPDQULJKWV 3UDFWLVHKHOSIXOQHVVDQGVKDUHKRSHIXOQHVV RULJLQRUVWDWXV HJSURSHUW\ELUWKHFRQRPLF %HZLOOLQJWRFROODERUDWHOHDGDQGVXSSRUW 'HPRQVWUDWHFDUHDQGUHVSHFWWKURXJK 5HVROYHFRQIOLFWVSHDFHIXOO\ ODQJXDJHDQGDFWLRQV 7KHUHLVQRWKHPRURYHUWKHUHZHDOOEHORQJWRWKH 8SKROGWKHYDOXHRIHYHU\SHUVRQDQGVWULYHWREXLOG $SSO\LQWXLWLYHDQGLQQRYDWLYHWKLQNLQJDQG KXPDQVSHFLHVRXUFRQFHUQVDUHLQWHUGHSHQGHQWDQG FRPPXQLW\DFWLQZD\VWKDWDFNQRZOHGJHKXPDQVROLGDULW\ GHFLVLRQPDNLQJVNLOOV ZHDUHSDUWRIWKHQDWXUDOZRUOG
Load more

Recommended publications
  • Postmodern Visual Dynamics in Amy Heckerling's Clueless
    e Interdisciplinary Journal of Popular Culture and Pedagogy Hyping the Hyperreal: Postmodern Visual Dynamics in Amy Heckerling’s Clueless Andrew Urie York University Toronto, Ontario, Canada [email protected] ABSTRACT An iconic staple of 1990s Hollywood cinema, director-screenwriter Amy Heckerling’s Clueless (1995) is a cult classic. This article examines the film’s postmodern visual dynamics, which parody hyperreal media culture and its connection to feminine teen consumerism amidst the image-saturated society of mid-’90s era Los Angeles. Keywords: Clueless; Amy Heckerling; Jane Austen; Emma; Popular Culture; Visual Culture; Film Studies; Media Studies; Postmodernism; Hyperreal 38 Volume 4, Issue 1 Hyping the Hyperreal A contemporized reworking of Jane Austen’s 1816 novel, Emma, director-screenwriter Amy Heckerling’s Clueless (1995) stands out as a notable cultural artifact of 1990s Hollywood cinema. While an abundance of scholarly articles exist on how Heckerling adapted the key plot dynamics of Austen’s novel for a postmodern audience,1 this article will largely eschew such narrative analysis in favor of focusing on the film’s unique postmodern visual dynamics, which constitute an insightful parody of hyperreal media culture and its particular connection to feminine teen consumerism amidst the image-saturated society of mid-’90s era Los Angeles. Less an adaptation of Emma than a postmodern appropriation, Clueless pays parodic homage to an oft- overlooked thematic element embedded in its source text. Transposing the decadence of Emma’s upper echelon Regency-era society for the nouveau riche decadence of Beverly Hills and its attendant culture of conspicuous consumption, the film focuses on the travails of its affluent sixteen-year-old heroine, Cher Horowitz (Alicia Silverstone), whose narcissistic preoccupations revolve around consumerism and fashion.
    [Show full text]
  • Sequence Iv: Buy Nothing Day
    SEQUENCE IV: BUY NOTHING DAY 1 - Reading comprehension 2 - Pronunciation 3 - Word Building 4 - Grammar 5 – Writing 6 – Final Project Reading Comprehension Read the text below then do the activities: BUY NOTHING DAY On November 29th, thousands of activists and concerned citizens in 65 countries will take a 24- hour consumer detox as part of the annual Buy Nothing Day, a global phenomenon that originated in Vancouver, Canada. From joining marches through malls to organizing credit cardcut-ups, Buy Nothing Day activists aim to challenge themselves, their families and their friends to switch off from shopping for one day. The even is celebrated as a family holiday, as a non-commercial street party, or even as a public protest. Anyone can take part provided they spend a day without spending. Reasons for participating in Buy Nothing Day are varied. Some people want to escape from the marketing mind games. Others use it to complain about the environmental consequences of over-consumption. Two recent disaster warnings outline the sudden urgency of our dilemma. In October, a global warning report predicted that climate change will lead to the most massive market failure the world has ever seen. Soon after, a study published in the journal Science forecast the total collapse of global fisheries within 40 years. Kalle Lasn, co-founder of Adbusters Media Foundation which was responsible for turning Buy Nothing Day into an international annual event, said, “ We must protect our environment from an ecological collapse. Driving hybrid cars and limiting industrial emissions are just band-aid solutions if we don’t address the core problem.
    [Show full text]
  • Banksy at Disneyland: Generic Participation in Culture Jamming Joshua Carlisle Harzman University of the Pacific, [email protected]
    Kaleidoscope: A Graduate Journal of Qualitative Communication Research Volume 14 Article 3 2015 Banksy at Disneyland: Generic Participation in Culture Jamming Joshua Carlisle Harzman University of the Pacific, [email protected] Follow this and additional works at: http://opensiuc.lib.siu.edu/kaleidoscope Recommended Citation Harzman, Joshua Carlisle (2015) "Banksy at Disneyland: Generic Participation in Culture Jamming," Kaleidoscope: A Graduate Journal of Qualitative Communication Research: Vol. 14 , Article 3. Available at: http://opensiuc.lib.siu.edu/kaleidoscope/vol14/iss1/3 This Article is brought to you for free and open access by OpenSIUC. It has been accepted for inclusion in Kaleidoscope: A Graduate Journal of Qualitative Communication Research by an authorized administrator of OpenSIUC. For more information, please contact [email protected]. Banksy at Disneyland: Generic Participation in Culture Jamming Cover Page Footnote Many thanks to all of my colleagues and mentors at the University of the Pacific; special thanks to my fiancé Kelly Marie Lootz. This article is available in Kaleidoscope: A Graduate Journal of Qualitative Communication Research: http://opensiuc.lib.siu.edu/ kaleidoscope/vol14/iss1/3 Banksy at Disneyland: Generic Participation in Culture Jamming Joshua Carlisle Harzman Culture jamming is a profound genre of communication and its proliferation demands further academic scholarship. However, there exists a substantial gap in the literature, specifically regarding a framework for determining participation within the genre of culture jamming. This essay seeks to offer such a foundation and subsequently considers participation of an artifact. First, the three elements of culture jamming genre are established and identified: artifact, distortion, and awareness. Second, the street art installment, Banksy at Disneyland, is analyzed for participation within the genre of culture jamming.
    [Show full text]
  • Pdf at OAPEN Library
    Tweets and the Streets Gerbaudo T02575 00 pre 1 30/08/2012 11:04 Gerbaudo T02575 00 pre 2 30/08/2012 11:04 TWEETS AND THE STREETS Social Media and Contemporary Activism Paolo Gerbaudo Gerbaudo T02575 00 pre 3 30/08/2012 11:04 First published 2012 by Pluto Press 345 Archway Road, London N6 5AA www.plutobooks.com Distributed in the United States of America exclusively by Palgrave Macmillan, a division of St. Martin’s Press LLC, 175 Fifth Avenue, New York, NY 10010 Copyright © Paolo Gerbaudo 2012 The right of Paolo Gerbaudo to be identified as the author of this work has been asserted by him in accordance with the Copyright, Designs and Patents Act 1988. British Library Cataloguing in Publication Data A catalogue record for this book is available from the British Library ISBN 978 0 7453 3249 9 Hardback ISBN 978 0 7453 3248 2 Paperback ISBN 978 1 8496 4800 4 PDF eBook ISBN 978 1 8496 4802 8 Kindle eBook ISBN 978 1 8496 4801 1 EPUB eBook Library of Congress Cataloging in Publication Data applied for This book is printed on paper suitable for recycling and made from fully managed and sustained forest sources. Logging, pulping and manufacturing processes are expected to conform to the environmental standards of the country of origin. 10 9 8 7 6 5 4 3 2 1 Designed and produced for Pluto Press by Chase Publishing Services Ltd Typeset from disk by Stanford DTP Services, Northampton, England Simultaneously printed digitally by CPI Antony Rowe, Chippenham, UK and Edwards Bros in the United States of America Gerbaudo T02575 00 pre 4 30/08/2012 11:04
    [Show full text]
  • Mental Environmentalism: the Rt Ue Goal of the Occupy Wall Street Movement Jay Menees University of South Carolina - Columbia
    University of South Carolina Scholar Commons Senior Theses Honors College Spring 5-10-2014 Mental Environmentalism: The rT ue Goal of the Occupy Wall Street Movement Jay Menees University of South Carolina - Columbia Follow this and additional works at: https://scholarcommons.sc.edu/senior_theses Part of the Politics and Social Change Commons Recommended Citation Menees, Jay, "Mental Environmentalism: The rT ue Goal of the Occupy Wall Street Movement" (2014). Senior Theses. 24. https://scholarcommons.sc.edu/senior_theses/24 This Thesis is brought to you by the Honors College at Scholar Commons. It has been accepted for inclusion in Senior Theses by an authorized administrator of Scholar Commons. For more information, please contact [email protected]. MENTAL ENVIRONMENTALISM: THE TRUE GOAL OF THE OCCUPY WALL STREET MOVEMENT By Jay Colin Menees Submitted in Partial Fulfillment of the Requirements for Graduation with Honors from the South Carolina Honors College May 2014 Approved: Jason Osborne Ph.D. Director of Thesis Christian Price Second Reader Steve Lynn, Dean For South Carolina Honors College Menees 2 Table of Contents Abstract…………………………………………………………………………………..3 Senior Thesis……………………………………………………………………….…….4 Conclusion……………………………………………………………………………….23 Works Cited……………………………………………………………………………..24 Menees 3 Abstract The purpose of this paper is to expose the actual goal behind the Occupy Wall Street Movement. The paper discusses the criticism behind the Occupy Wall Street movement for its apparent lack of goals. It then takes a retrospective look back to the establishment and founding organization, Adbusters, for answers on a “one demand” or goal. From here it will discuss the founding body, Adbusters, and its philosophical and political ideology. After this, the paper will tie facets of the Occupy Wall Street movement back to Adbusters and their philosophy of mental environmentalism in order to show that mental environmentalism was the goal of the movement all along.
    [Show full text]
  • 203046 Omslag
    SUSTAINABILITY AT THE SPEED OF AT LIGHT SUSTAINABILITY Over the last few years, information technology’s This report is a contribution from WWF to the impact on society has become a hot topic. It is clear discussion about ICT in tomorrow’s society. We have that over the next couple of years information and asked some of the best experts in the world to cont- communication technologies (ICT) will affect and ribute with a chapter in which they describe the role reshape most parts of our society. ICT will come to of ICT for Sustainable Development in their respec- radically influence the global economy, and, to an tive fields. The report is an attempt to bridge the gap unknown degree, our culture and the way we percei- between the ICT experts and the policy makers in ve the world, our relationship to it, and our actions. politics and business. It is WWFs firm belief that Although ICT will have an enormous effect these groups, together with the rest of society, need on tomorrow’s society, surprisingly little research to talk more frequently and openly to each other if has been conducted regarding its future environ- we want to create a sustainable framework for the arlstad, Sweden mental consequences. Most of the work that has ICT-development. been done has reached one of two opposing con- clusions: either ICT will bring only good things, from solutions to world hunger and the elimination of all transportation problems to a revitalised democra- cy; or it will bring nothing but problems, accelera- ting resource consumption, introducing new toxic materials and resulting in greater inequity by intro- ducing a digital divide that will worsen the already unequal distribution of wealth and influence.
    [Show full text]
  • Select Any Contemporary Social Movement and Discuss Its Central Issues and Forms of Organisation, and Outline Its Strategy and Tactics
    Select any contemporary social movement and discuss its central issues and forms of organisation, and outline its strategy and tactics The following essay will concentrate on the contemporary anti-consumerist social movement with particular focus on the role of Adbusters, a Vancouver based anti-consumerist and anti-corporate organisation. The essay will discuss the central issues and forms of organisation associated with Adbusters and outline their tactics and strategy. A social movement can be defined in a variety of ways depending on the adopted perspective, although most definitions refer to “collective mobilisations with socio-economic, political and/or cultural dimensions, mobilizing around issues of identity, as well as around more specific rights” Mayo (2005:54). Blumer (1969:99) cited in Mayo (2005), similarly conceptualizes social movements as “collective enterprises” whose aim is to create a new way of life. Della Porta & Diani (1999) define social movements as “fluid phenomena” with blurred boundaries, identifying four social movement ‘themes’ which include “informal, interaction networks based upon shared beliefs and solidarity” p17. Adbusters can be included in this theme as its members consist of a communicative network of culture jammers and other acolytes with a shared ethos and common adversary- mass consumption and corporate power. Collectively these networks focus on struggles and conflicts surrounding contemporary culture, often incorporating the use of protest (ibid). Theories of New Social Movements (NSMs) emerged in the 1970s and 1980s and were mostly developed in reaction to the 1968 student riots in France and other related protests in Europe. The strengths to come out of the new research include a refocusing on the deep underlying and wide-ranging socio- Jennifer McIntyre 386984 economic and political questions associated with social movements.
    [Show full text]
  • Portrait of the Activist As a Yes Man: Examining Culture Jamming and Its Actors Through the Circuit of Culture Derrick Shannon
    Florida State University Libraries Electronic Theses, Treatises and Dissertations The Graduate School 2011 A Portrait of the Activist as a Yes Man: Examining Culture Jamming and Its Actors Through the Circuit of Culture Derrick Shannon Follow this and additional works at the FSU Digital Library. For more information, please contact [email protected] THE FLORIDA STATE UNIVERSITY COLLEGE OF COMMUNICATION AND INFORMATION A PORTRAIT OF THE ACTIVIST AS A YES MAN: EXAMINING CULTURE JAMMING AND ITS ACTORS THROUGH THE CIRCUIT OF CULTURE By DERRICK SHANNON A Thesis submitted to the School of Communication and Information in partial fulfillment of the requirements for the degree of Master of Science Degree Awarded: Spring Semester, 2011 The members of the Committee approve the thesis of Derrick Shannon on April 01, 2011. ______________________________ Andrew Opel Professor Directing Thesis ______________________________ Donna Marie Nudd Committee Member ______________________________ Jennifer Proffitt Committee Member Approved: _______________________________________ Steve McDowell, Chair, Department of Communication _______________________________________ Larry Dennis, Dean, College of Communication The Graduate School has verified and approved the above named committee members. ii For Dad iii ACKNOWLEDGEMENTS The author would like to primarily thank Dr. Andy Opel, Dr. Bill Lawson, and my father Sam Shannon for supporting me through this project, and for pushing me to finish. Without their encouragement and generosity I would not have been able to see this to an end. I would also like to thank Dr. Nudd and Dr. Proffitt for taking part in this and lending their time. Finally, I would like to thank my mother, Ginger Shannon, who is the kindest most inspiring person I know.
    [Show full text]
  • Deconstructing the Politics of Culture Jamming: True Cost Economics
    DECONSTRUCTING THE POLITICS OF CULTURE JAMMING: TRUE COST ECONOMICS by Jana Seidl A Thesis Submitted to the Faculty of The Wilkes Honors College in Partial Fulfillment of the Requirements for the Degree of Bachelor of Arts in Liberal Arts and Sciences with Concentrations in Economics and Anthropology Wilkes Honors College of Florida Atlantic University Jupiter, Florida May 2008 DECONSTRUCTING THE POLITICS OF CULTURE JAMMING: TRUE COST ECONOMICS by Jana Seidl This thesis was prepared under the direction of the candidate‘s thesis advisors, Dr. Keith Jakee and Dr. Jacqueline Fewkes, and has been approved by the members of her/his supervisory committee. It was submitted to the faculty of The Honors College and was accepted in partial fulfillment of the requirements for the degree of Bachelor of Arts in Liberal Arts and Sciences. SUPERVISORY COMMITTEE: _____________________________________________ Dr. Keith Jakee _____________________________________________ Dr. Jacqueline Fewkes _____________________________________________ Dr. Daniel White _____________________________________________ Dean, Wilkes Honors College _____________________________________________ Date ii ACKNOWLEDGEMENTS Thank you to the entire faculty at the Harriet L. Wilkes Honors College; without your support and without your challenges I would not have grown to be who I am today. Thank you, especially, To Dr. Jacqueline Fewkes, for believing in me and her continued support and patience, To Dr. Keith Jakee, for providing the inspiration for my thesis, for his continued advice and for pushing me to excel, and, To Dr. Daniel White, for his support throughout the past four years as a mentor and for his continued friendship. All of you have allowed me to see that I can aim higher and reach my goals.
    [Show full text]
  • Anti-Consumption and Consumer Wellbeing
    International Centre for Anti-consumption Research (ICAR) ANTI-CONSUMPTION AND CONSUMER WELLBEING July 4-5, 2014 Kiel, Germany ICAR Proceedings Organisers: Michael SW Lee, Stefan Hoffmann Published by Kiel University Christian-Albrechts-Platz 4, 24118 Kiel, Germany ISBN: 978-0-473-28933-1 Table of Contents Anti-Consumption in the Sailing City ....................................................................................................... 2 The History of Boycott Movements in Germany: Restrictions and Promotion of Consumer Well-being............................................................................. 4 The Multi-Facets of Sustainable Consumption, Anti-Consumption, Emotional Attachment and Consumer Well-Being: The Case of the Egyptian Food Industry ........................................................... 10 Applying Rhetorical Analysis to Investigating Counter-Ideological Resistance to Environmentalism .. 15 The Curious Case of Innovators Who Simultaneously Resist Giving Up Paper Bills .............................. 21 Navigating Between Folk Models of Consumer Well-Being: The Nutella Palm Oil Case ..................... 26 The Informational and Psychological Challenges of Converting to a Frugal Life .................................. 31 Motivations, Values, and Feelings behind Resistance to Consumption and Veganism ........................ 37 Shelving a Dominating Myth: A Study on Social Nudism and Material Absence ................................. 42 Education for Sustainable (Non-) Consumption through Mindfulness Training?
    [Show full text]
  • Ecovillages and the Transformation of Values
    2 0 1 0 STATE O F TH E WO R LD Transforming Cultures From Consumerism to Sustainability THE WORLDWATCH INSTITUTE SCIENCE/ENVIRONMENT 2010 STATE OF TH E WOR LD Transforming Cultures From Consumerism to Sustainability Advance Praise for State of the World 2010: “If we continue to think of ourselves mostly as consumers, it’s going to be very hard to bring our environmental troubles under control. But it’s also going to be very hard to live the rounded and joyful lives that could be ours. This is a subversive volume in all the best ways!” —Bill McKibben, author of Deep Economy and full image The End of Nature “Worldwatch has taken on an ambitious agenda in this volume. No generation in history has achieved a cultural transformation as sweeping as the one called for here…it is hard not to be impressed with the book’s boldness.” —Muhammad Yunus, founder of the Grameen Bank extreme close-up “This year’s State of the World report is a cultural Several million pounds of plastic mindbomb exploding with devastating force. I hope enter the world’s oceans every hour, portrayed on the cover by the 2.4 it wakes a few people up.” million bits of plastic that make up —Kalle Lasn, Editor of Adbusters magazine Gyre, Chris Jordan’s 8- by 11-foot reincarnation of the famous 1820s Like a tsunami, consumerism has engulfed human woodblock print, The Great Wave cultures and Earth’s ecosystems. Left unaddressed, we Off Kanagawa, by the Japanese artist risk global disaster. But if we channel this wave, intention- Katsushika Hokusai.
    [Show full text]
  • 'Black Friday'
    BLACK FRIDAY E-LESSON INSPIRATION Internet source: https://www.youtube.com/watch?v=1oPfVmkFgko Overview: CNN interviews co-founder and editor-in-chief of Adbusters, Kalle Lasn. The interview offers an alternative perspective on our consumerist society. Topics: Black Friday, consumerism, dissenting voices Level / Context: upper-intermediate to advanced Duration: 5.15 min PRE-VIEWING ACTIVITIES Set the Scene Ask your students if they have heard about ‘Black Friday’. If not, give them some background: Black Friday is the Friday following Thanksgiving Day in the United States (the fourth Thursday of November), often regarded as the beginning of the Christmas shopping season. It is one of the busiest shopping days of the year when discounts and special deals are offered. Tell them that as a response to Black Friday, an artist called Ted Dave invented BND. Invite them to come up with ideas about what the letters might stand for. (Buy Nothing Day) ‘Consequence’ collocations Write ‘consequence’ on the board, and ask your students to brainstorm words which can stand in front of it. E.g. political -, immediate -, short-term -, long-term -, psychological -, ecological -, unintended -, far-reaching -, environmental -, adverse -, unpleasant -. You can also elicit by putting up the initials and giving some clues. Posing a Group Challenge can boost energy levels: e.g. ‘Can you come up with 7 common collocations in one minute?’ Then tell them that ‘consequence’ will be a key word in the clip and ask them to listen for the context it comes up in. Group Presentations Give your students some background information on Buy Nothing Day.
    [Show full text]