The Grammaticality and Acceptability of Proverbs in Language Use As a Means of Communication and Instruction in Traditional Anaang Society

Total Page:16

File Type:pdf, Size:1020Kb

The Grammaticality and Acceptability of Proverbs in Language Use As a Means of Communication and Instruction in Traditional Anaang Society African Journal of Educational Research and Development (AJERD), Vol. 11, No. 2, Dec. 2018 THE GRAMMATICALITY AND ACCEPTABILITY OF PROVERBS IN LANGUAGE USE AS A MEANS OF COMMUNICATION AND INSTRUCTION IN TRADITIONAL ANAANG SOCIETY Dr. Edenowo T. Enang Department of English Akwa Ibom State University Obio Akpa Campus [email protected] Abstract This paper analized the grammaticality and acceptability of Proverbs in language use as means of communication and instruction in traditional Anaang society. The paper also exposes a compendium of proverbs in Anaang and carefully sort out what some scholars have said about proverbs and education. To achieve this purpose, a long list of proverbs in Anaang has been sorted out and carefully accounted for while taking cognizance of the communicative roles proverbs play in traditional Anaang communities. There is also examination of the socio-cultural functions of these proverbs as a vehicle for sharpening the instructional patterns of people at individual and communal levels. The theoretical framework employed in this work is Linguistic Trado-culturalism, a theory propounded by the Traditional Culturalists for use as a vehicle for extolling and conveying the values of a people’s rich cultural heritage and the propagation of the philosophical significance of their heritage to generations yet unborn. The conclusion is drawn from the fact that proverbs, no matter the type of functions (communicative or instructional) they play, are inextricably tied to the socio-cultural idiosyncrasies of the society within which they operate. Keywords: Grammaticality and acceptability, Proverbs, language use, communication and instruction, Anaang traditional society. Introduction The Anaang people are known for their proverbs and for their insistence on their apt use. It is an established assertion that an Anaang-man’s reputation as a good speaker or as a successful oral artist, to a large extent, depends on his ability to use ufied (proverb) in his speech acts. Any speech or literary composition that is not punctuated here and there with apt proverbs and idioms is regarded as ifed (naked, the opposite of ufied) that is, it is considered as lacking in that expressive force which makes a listener nod his head either in approval and admiration of what is said or shake his head because he finds it difficult to make a headway on what he said or he does not understand it at all. Any unadorned expression in Anaang is seen as roughly equivalent to a pot of soup that is watery because it lacks the necessary condiments or ingredients. 107 Dr. Edenowo T. Enang The need to acquire the ability to understand and use proverbs in the language cannot be dismissed with a wave of the hand or glossed over. It is for this reason that the Anaang people use the following proverbs or their equivalents to ridicule the ignorant ones: (a) Agwo unana ifiok isikopo usen uwiere ikpe sade ke ekekama ufied ekpe ewiere, ntoon ase anoñ akene mbonagwo alekeda anyoñ ntere ntere, meaning - the unintelligent who attended a gathering for the settlement of a dispute rose to go when he saw others do so but wondered when a decision would be taken because proverbs were used, he failed to understand that the ruling had already been given. (b) Ama top ufied anno agwo silioñho ufied alanyie iguok, ade agwo sili ilioñhoke ase fefehe ufied adok ikot, meaning – if you use a proverb to him who knows, he would know, but a proverb to the uninitiated would make him run into the bush. Literature Overview What some scholars have said about proverbs and education in Anaang and other traditional societies in Africa and in Nigeria will be discussed in this section. In communication for instance, Finnegan (1970:441) cited in (Adeiyongo, 2004) established that in some societies in Africa, such as among the Zande and Nanja, the proverb could be used by an individual as “comments for persuasion” in an esoteric manner so that it could either deliberately convey ambiguity or only a very few people could understand him. Bascom (1965:469) in his monumental research work on African folklore in general and on proverbs in particular has mentioned inter alia that: the proverb plays a major role in the traditional system of education by enforcing conformity to social norms. There is hardly any paraomiographer that has failed to notice or comment on this very important function of proverbs. In the same vein, Essien (1978:36-38), echoing Hull (1922) states that “of all the forms assumed by Oral literature, proverbs contain the greatest educational impact”. Similarly, Loeb (1952:322), in his research among the Kuanyame and in part among the Christians reports that much of the teaching given the young is in the form of proverbs mainly because of their pithy nature as well as their memorability. Such proverbs are in the areas of law, ethics philosophy and religion (Adeiyongo, 2004:253-270). In East African societies, Raum (1940:214) carried out an observational research work and came up with the fact that: From fourteen when a child flies into rage, when he is recalcitrant or violates the code of etiquette, when he makes an ass out of himself, when he is cowardly, he hears his actions commented upon in the words of a proverb. There is no doubt that such a comment is meant to correct such a child so that he would not repeat such a thing the next time as the proverb would have a lasting effect on him (Adeiyongo, 2004:253-270). In West Africa, proverbs also play a major or significant role in the education of the young in almost all the communities. According to Berry (1961:22) cited in Adeiyongo (2004:254). “Children are taught in proverbs and their educational function is nowhere better typified than in the Akan proverbs which says “a wise child is talked to in proverbs”. 108 African Journal of Educational Research and Development (AJERD), Vol. 11, No. 2, Dec. 2018 Bascom (1965:16) is in agreement with Berry after his own research work in which he observed a similar tendency in West Africa in the following words: What often seems to be…is the general educative role of proverbs. Proverbs often imply some general comments on the way people do or should do or should not behave. It is clear that the conveying of a people’s experiences and expectation can be performed in particular effective way through the use of proverbs. But more specifically, proverbs are cited by adults when instructing the children In Nigeria, specifically among the Hausa communities, Tremearne (1913:108) noted that a great knowledge of proverbs by any individual is considered to be a very big asset. It is the same situation among the Igbo of whom Achebe writes that the art of conversation is regarded very highly, and proverbs are the palm oil with which words are eaten (Achebe, 1958:5), while Ugonna (1974), after a comprehensive description of ilu (proverb), sums it up as a kind of mirror which reflects human experience. Nwadika (2009:4) sees proverb as a form of speech which is pregnant with meaning. More often than not, it confounds the unintelligent. In the same vein, the Daystar Press, Ibadan has observed that Yoruba proverbs teach “age-old wisdom” and are lessons in experience (Adekunle, 1985). A look at the Tiv traditional society enables scholars such as Adeiyongo (2000) and Bergsma (1970) to overtly state the role of proverbs in the Tiv Kingdom. For instance, Adeinyongo (2000:192) establishes that the Tiv believe that the most valuable legacy a man can bequeath to a child to enable such a child to steer his way through life is not corporal but is in terms of instructions that are wrapped in proverbs. On his part, Bergsma (1970) stated that: Tiv proverbs generally constitute an effective means of exercising social control and approbation. There are therefore, specific proverbs variously employed by the Tiv to validate, justify, and moderate people’s activities and behavior as well as the application of social pressure on members of the society. In Ibibio traditional society, proverbs play a very significant role in the task of communicative and instructional levels of education. According to Essien (1978), a proverb is a powerful weapon in the lips of an Ibibio elder who intends to distract the attention of members of the community or through into confusion those of them who lead a life that is contrary to the norms of the society, because proverbs are easily detached from the prerogatives of the society within which it functions. Coming to the use of proverbs in Anaang, this research work examines Anaang proverbs which address not only the youth but also teach adults how to bring up the young and make them to conform to Anaang and indeed Nigerian social norms in general. The importance of proverbs in and to a society cannot be overlooked because proverbs are vehicles via which the predominant properties of words or the hidden essence of words are conveyed and they go a long way in enriching a language. Proverbs put a seal of authenticity on speeches in particular and language in general. 109 Dr. Edenowo T. Enang Due to the high premium which the language and its users place on proverbs, it is pertinent to look at Anaang proverbs from the view points of definition, origin and derivation, users, functions and classifications Proverb: A Definition In fact, Umoh (2009:xii) puts forward his stance about proverbs when he defines the proverbs in the following words: they (proverbs) are ancestral rubber stamps. Ancestors used proverbs to synergize the community’s social, political, religious and day-to-day order; to enhance a positive new world structure.
Recommended publications
  • A Constraint-Based Analysis of Obligatory Contour Principle in Anaang Morphological Constructions
    ISSN 1798-4769 Journal of Language Teaching and Research, Vol. 12, No. 3, pp. 466-476, May 2021 DOI: http://dx.doi.org/10.17507/jltr.1203.17 A Constraint-based Analysis of Obligatory Contour Principle in Anaang Morphological Constructions Unwana Akpabio Department of Linguistics, Igbo and Other Nigerian Languages, University of Nigeria, Nsukka, Nigeria Olusanmi Babarinde Department of Linguistics, Igbo and Other Nigerian Languages, University of Nigeria, Nsukka, Nigeria George Iloene Department of Linguistics, Igbo and Other Nigerian Languages, University of Nigeria, Nsukka, Nigeria Abstract—The obligatory contour principle forbids identical consecutive features in the underlying representation. This work undertakes a description of the Anaang tonal structure, the tonal behaviour of compounds and reduplicates in the language, bearing in mind their sensitivity to the OCP and the environments that trigger the adherence. An adapted Ibadan wordlist of 400 Basic Items (Trial) English version was used via interview for data collection from six men and six women within Abak Local Government Area in Akwa Ibom State. The data were analysed using optimality theoretical framework. The analysis shows that Anaang compounds as well as reduplicates exhibit cases of tonal modifications in line with OCP. For compounds, the tone of the second noun changes depending on the tonal sequence. In the HH noun base, the second-high tone of the second noun changes to a low tone, in the LH noun base, the tone of the second noun is raised to a down-stepped high tone, the LL noun base sees the tone of the second noun being raised to a high tone.
    [Show full text]
  • Some Principles of the Use of Macro-Areas Language Dynamics &A
    Online Appendix for Harald Hammarstr¨om& Mark Donohue (2014) Some Principles of the Use of Macro-Areas Language Dynamics & Change Harald Hammarstr¨om& Mark Donohue The following document lists the languages of the world and their as- signment to the macro-areas described in the main body of the paper as well as the WALS macro-area for languages featured in the WALS 2005 edi- tion. 7160 languages are included, which represent all languages for which we had coordinates available1. Every language is given with its ISO-639-3 code (if it has one) for proper identification. The mapping between WALS languages and ISO-codes was done by using the mapping downloadable from the 2011 online WALS edition2 (because a number of errors in the mapping were corrected for the 2011 edition). 38 WALS languages are not given an ISO-code in the 2011 mapping, 36 of these have been assigned their appropri- ate iso-code based on the sources the WALS lists for the respective language. This was not possible for Tasmanian (WALS-code: tsm) because the WALS mixes data from very different Tasmanian languages and for Kualan (WALS- code: kua) because no source is given. 17 WALS-languages were assigned ISO-codes which have subsequently been retired { these have been assigned their appropriate updated ISO-code. In many cases, a WALS-language is mapped to several ISO-codes. As this has no bearing for the assignment to macro-areas, multiple mappings have been retained. 1There are another couple of hundred languages which are attested but for which our database currently lacks coordinates.
    [Show full text]
  • Cassava Farmers' Preferences for Varieties and Seed Dissemination
    Cassava farmers’ preferences for varieties and seed dissemination system in Nigeria: Gender and regional perspectives Jeffrey Bentley, Adetunji Olanrewaju, Tessy Madu, Olamide Olaosebikan, Tahirou Abdoulaye, Tesfamichael Wossen, Victor Manyong, Peter Kulakow, Bamikole Ayedun, Makuachukwu Ojide, Gezahegn Girma, Ismail Rabbi, Godwin Asumugha, and Mark Tokula www.iita.org i ii Cassava farmers’ preferences for varieties and seed dissemination system in Nigeria: Gender and regional perspectives J. Bentley, A. Olanrewaju, T. Madu, O. Olaosebikan, T. Abdoulaye, T. Wossen, V. Manyong, P. Kulakow, B. Ayedun, M. Ojide, G. Girma, I. Rabbi, G. Asumugha, and M. Tokula International Institute of Tropical Agriculture, Ibadan February 2017 IITA Monograph i Published by the International Institute of Tropical Agriculture (IITA) Ibadan, Nigeria. 2017 IITA is a non-profit institution that generates agricultural innovations to meet Africa’s most pressing challenges of hunger, malnutrition, poverty, and natural resource degradation. Working with various partners across sub-Saharan Africa, we improve livelihoods, enhance food and nutrition security, increase employment, and preserve natural resource integrity. It is a member of the CGIAR System Organization, a global research partnership for a food secure future. International address: IITA, Grosvenor House, 125 High Street Croydon CR0 9XP, UK Headquarters: PMB 5320, Oyo Road Ibadan, Oyo State ISBN 978-978-8444-82-4 Correct citation: Bentley, J., A. Olanrewaju, T. Madu, O. Olaosebikan, T. Abdoulaye, T. Wossen, V. Manyong, P. Kulakow, B. Ayedun, M. Ojide, G. Girma, I. Rabbi, G. Asumugha, and M. Tokula. 2017. Cassava farmers’ preferences for varieties and seed dissemination system in Nigeria: Gender and regional perspectives. IITA Monograph, IITA, Ibadan, Nigeria.
    [Show full text]
  • 1 Engaging Appropriate Affixation for English And
    ENGAGING APPROPRIATE AFFIXATION FOR ENGLISH AND ANAANG LANGUAGES: A MORPHO-SYNTACTIC STUDY AT DISTRIBUTIONAL EQUIVALENCE FOR NATIONAL DEVELOPMENT IN NIGERIA BEYOND 2020 Susana T. Udoka (Ph.D) and Edenowo T. Enang Abstract This Study: Engaging Appropriate Affixation System for English and Anaang: Amorpho-Syntactic Study at Distributional Equivalence for Education and Development in Nigeria Beyond 2020 which is the first in the area, takes a look at all the morphological processes which are involved in affixation; as well as the application of these processes on syntax-related rank scales in order to account appropriately for affixation as a very important aspect of morphology. It also aims at revealing the possible universals of the two languages in the field of word-formation.. The theoretical frameworks used in this study are the three-in –one tool; contrastive analysis (CA), error analysis (EA)and needs analysis (NA) which are identifiable by the researchers to be effectively operational in revealing the linguistic universals between the two languages. The general assumption here, is that the aspect of similarities will facilitate learning the second language, especially if a rule in L1 is identical to a rule in L2 and applied to propagate Educational sensitization that will usher in Development in Nigeria in 2020 and beyond. Keywords: Engaging, Appropriate, Affixation, Morpho-Syntax, Distributional equivalence, Education, Development and Beyond. Anaang is a name which marks dual identification: it identifies a people – the Anaang and their language. As a people, the Anaang are claimed to be the second largest ethnic group after the Ibibio in the present day Akwa Ibom State of Nigeria.
    [Show full text]
  • The Use of Proverbial Ideophones in Anaang, Southern Nigeria
    International Journal of Applied Linguistics & English Literature ISSN 2200-3592 (Print), ISSN 2200-3452 (Online) Vol. 3 No. 5; September 2014 Copyright © Australian International Academic Centre, Australia The Use of Proverbial Ideophones in Anaang, Southern Nigeria Itoro Michael Department of Linguistics and Nigerian Languages University of Uyo, Uyo, Nigeria E-mail: [email protected] Received: 18-02-2014 Accepted: 02-05-2014 Published: 01-09-2014 doi:10.7575/aiac.ijalel.v.3n.5p.72 URL: http://dx.doi.org/10.7575/aiac.ijalel.v.3n.5p.72 Abstract This research centres on Anaang1 proverbial ideophones and its relevance in communication in. Data for this work was gathered during several field trips undertaken to the four speech communities of Anaang to collect data on Anaang folklore, for the on-going research on the Lower Cross Languages Development Project (LCLDP) sponsored by the Linguistics Department of the University of Uyo, for the documentation and revitalization of the endangered languages in the Cross River Area. A vast number of data on proverbs were recorded during interview with the people on a folk session. From the recordings, data on proverbial ideophones were elicited and used for this work. This paper adopts the theoretical framework of Speech Acts theory for analysis. It has been observed that Anaang proverbial ideophones are rich in the use of style and language, as well as literal and contextual techniques. The contents as well as the contexts are carefully selected to reflect the socio-cultural background of the people. The application of proverbial ideophone is a special skill in speech, and requires a clear knowledge of the socio-cultural background of the people.
    [Show full text]
  • An Atlas of Nigerian Languages
    AN ATLAS OF NIGERIAN LANGUAGES 3rd. Edition Roger Blench Kay Williamson Educational Foundation 8, Guest Road, Cambridge CB1 2AL United Kingdom Voice/Answerphone 00-44-(0)1223-560687 Mobile 00-44-(0)7967-696804 E-mail [email protected] http://rogerblench.info/RBOP.htm Skype 2.0 identity: roger blench i Introduction The present electronic is a fully revised and amended edition of ‘An Index of Nigerian Languages’ by David Crozier and Roger Blench (1992), which replaced Keir Hansford, John Bendor-Samuel and Ron Stanford (1976), a pioneering attempt to synthesize what was known at the time about the languages of Nigeria and their classification. Definition of a Language The preparation of a listing of Nigerian languages inevitably begs the question of the definition of a language. The terms 'language' and 'dialect' have rather different meanings in informal speech from the more rigorous definitions that must be attempted by linguists. Dialect, in particular, is a somewhat pejorative term suggesting it is merely a local variant of a 'central' language. In linguistic terms, however, dialect is merely a regional, social or occupational variant of another speech-form. There is no presupposition about its importance or otherwise. Because of these problems, the more neutral term 'lect' is coming into increasing use to describe any type of distinctive speech-form. However, the Index inevitably must have head entries and this involves selecting some terms from the thousands of names recorded and using them to cover a particular linguistic nucleus. In general, the choice of a particular lect name as a head-entry should ideally be made solely on linguistic grounds.
    [Show full text]
  • The Ideophones in Anaang Language: from the Syntactic Point of View
    THE IDEOPHONES IN ANAANG LANGUAGE: FROM THE SYNTACTIC POINT OF VIEW Edenowo T. Enang Department of English /Lit Studies, Akwa Ibom State University, Obio Akpa Campus. Akwa Ibom State. Aniekan L. Nyarks Department of English /Lit Studies, Akwa Ibom State University, Obio Akpa Campus. Akwa Ibom State. Iniobong D. Utin Department of English /Lit Studies, Akwa Ibom State University, Obio Akpa Campus. Akwa Ibom State. Sussana T. Udoka, (Ph.D) Department of English /Lit Studies, Akwa Ibom State University, Obio Akpa Campus. Akwa Ibom State. And Maurice E. Udom, (Ph.D) Department of English /Lit Studies, Akwa Ibom State University, Obio Akpa Campus. Akwa Ibom State. Abstract From the standpoint of the modern transformational-generative theory, grammar is an embodiment of morphology, phonology, syntax and semantics of any natural language. This paper focused attention on the African Education Indices, Volume 7 No. 1, August, 2014, ISSN: 2276 – 982X 1 Edenowo T. Enang; Aniekan L. Nyarks; Iniobong D. Utin; Sussana T. Udoka, (Ph.D) and Maurice E. Udom, (Ph.D) system of rules that controls the occurrences and the distribution of ideophones in Anaang. Grammar is used here in the sense of syntax, though some references may be made to other levels, where necessary. By so doing, this work will be more meticulous and exhaustive. As the first detailed research work ever into ideophones in Anaang language, the researchers have made a detailed and painstaking examination and description of these syntactic categories in Anaang language with grammatical implicatins. Ibibio and Anaang languages are mutually intelligible; therefore, the researchers have reviewed the existing literature related to the Ibibio language and ideophones generally but with specific attention on the ideophones in Anaang language.
    [Show full text]
  • Global Journal of Human Social Science : C Sociology Economics & Political Science
    Consumer Buying Behavior An Econometric Modelling Lower Social Classes The Case of Cross River Volume 12 | Issue 13 | Version 1.0 Global Journal of Human Social Science : C Sociology, Economics & Political Science Global Journal of Human Social Sciences :C Sociology , Economics & Political Science Volume 12 Issue 13 (Ver. 1.0) Open Association of Research Society *OREDO-RXUQDORI+XPDQ *OREDO-RXUQDOV,QF Social Sciences. 2012. $'HODZDUH86$,QFRUSRUDWLRQZLWK³*RRG6WDQGLQJ´Reg. Number: 0423089 6SRQVRUV Open Association of Research Society $OOULJKWVUHVHUYHG 2SHQ6FLHQWLILF6WDQGDUGV 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ RI³*OREDO-RXUQDORI+XPDQ6RFLDO 3XEOLVKHU¶V+HDGTXDUWHUVRIILFH 6FLHQFHV´%\*OREDO-RXUQDOV,QF $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG *OREDO-RXUQDOV,QF+HDGTXDUWHUV&RUSRUDWH2IILFH XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ &DPEULGJH2IILFH&HQWHU,,&DQDO3DUN)ORRU1R 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH WKCambridge (Massachusetts)3LQ0$ (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV 8QLWHG6WDWHV RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 86$7ROO)UHH 86$7ROO)UHH)D[ 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV 2IIVHW7\SHVHWWLQJ HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ Open Ass ociation of Research Society , Marsh Road, SHUPLVVLRQ Rainham, Essex, London RM13 8EU 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV United Kingdom. ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG
    [Show full text]
  • Ojionuka Arinze
    University of Nigeria Research Publications AFANGIDEH, Maria Emmanuel Author Author PG/M.ED/Ph.D/00/27802 Interference of Anaan With English Verb Tenses Among Different Categories of Secondary Title School Students. Education Faculty Arts Education Department July, 2005 Date Signature I OF AMMR WITH ENGLISH VERB G DIFFERENT CATEGORIES OF SECONDARY SCHOOL STUDENTS AFANGIDEH, MARIA EMMANUEL PG/M.ED/"Ph.D/00127802 SUBDEPARTMENT OF ARTS EDUCATION UNIVERSITY OF NIGERIA NSUMKA JULY, 2005 TERFERENCE OF ANMN WITH ENGLISH VERB TENSES AMONG DIFFERENT CATEGORIES OF SECONDARY SCHOOL STUDENTS A Doctoral Research Project Presented to the Sub- Department of Arts Education, University of Nigeria, Nsukka, in partial fulfillment of the requirements for the award of the degree of the Doctor of Philosophy (Ph.D) in b Language Education AFANGIDEH, MARIA EMMAMUEL PGIll$rP.EDIPh.D100127802 SUB-DEPARTMENT OF ARTS EDUCATION UNIVERSITY OF NIGERIA NSUKKA JULY, 2005 CERTIFICATION Maria Emmanuel Afangideh, a postgraduate student in the Sub- Department of Arts Education with Registration Number PG/M.ED/Ph.D/00/27802has satisfactorily fulfilled the requirements for the degree of Doctor of Philosophy in Language Education. The work embodied in this thesis is original and has not been submitted in part or in full for any other diploma or degree of this University or any other University. I - F rk- f / ' 1.- - .......................I... ... .%.... ... ................. .. .. .. .. .. -23-& Dr. T. 0. Mgbodile Maria Emmanuel Afangideh Supervisor PG/M. ED/Ph.D/00/27802 iii e APPROVAL PAGE THIS THESIS HAS BEEN APPROVED FOR THE SUB- DEPARTMENT OF ARTS EDUCATION, UNIVERSITY OF NIGERIA, NSUKKA. (Supervisor) b EXTERNA EXAMINER (Co-ordinator) Sub-Department of Arts Education ...............................................
    [Show full text]
  • Print This Article
    International Journal of Applied Linguistics & English Literature ISSN 2200-3592 (Print), ISSN 2200-3452 (Online) Vol. 2 No. 6; November 2013 Copyright © Australian International Academic Centre, Australia Articulatory Analysis of Palatalization in Anaang Mfon Brownson Ekpe English Department, College of Humanities Redeemer’s University, Mowe, Nigeria E-mail: [email protected] Received: 01-08-2013 Accepted: 03-09-2013 Published: 01-11-2013 doi:10.7575/aiac.ijalel.v.2n.6p.155 URL: http://dx.doi.org/10.7575/aiac.ijalel.v.2n.6p.155 Abstract This paper examines the Articulatory features of palatalisation in the phonology of Anaang language. Anaang is a developing language spoken by the Anaang people in Akwa Ibom State of Nigeria. Genetically, Anaang is a Lower Cross Language of the Benue-Congo sub-family of the Niger-Congo Language Phylum. The objectives of the study are to investigate the articulatory features of Anaang and how palatalisation is formed in the language. The population is made of sixteen informants, two from each of the eight local government areas in Anaang speaking areas. Collection of data is based on interviews, participant observation and personal interaction with the informants. In achieving this, fifty items were used from SIL Comparative African Wordlists. Interviews were both formally and informally recorded in a digital midget. Formally, the recordings were done on the knowledge of the informants who were asked to pronounce words in Anaang. Informally, data were recorded unknowingly to the informants in social gatherings. Articulatory Model by Browman & Goldstein (1990) is adopted as the theoretical frame for the analysis. The theory recognizes gestures as abstract, discreet and dynamically defined units which are invariant, but overlap in time due to their internal spatio-temporal organisation.
    [Show full text]
  • The Effect of Interviewer Characteristics on Data Quality in DHS Surveys
    THE EFFECT OF INTERVIEWER CHARACTERIStiCS ON DATA QUALitY IN DHS SURVEYS DHS METHODOLOGICAL REPORTS 24 SEPTEMBER 2018 This publication was produced for review by the United States Agency for International Development. It was prepared by Thomas W. Pullum, Christina Juan, Nizam Khan, and Sarah Staveteig. DHS Methodological Reports No. 24 The Effect of Interviewer Characteristics on Data Quality in DHS Surveys Thomas W. Pullum1,2 Christina Juan1,2 Nizam Khan1 Sarah Staveteig2,3 ICF Rockville, Maryland, USA September 2018 1 ICF 2 The DHS Program 3 Avenir Health Corresponding author: Thomas W. Pullum, International Health and Development, ICF, 530 Gaither Road, Suite 500, Rockville, MD 20850, USA; phone: +1 301-572-0950; fax: +1 301-572-0999; email: [email protected] Acknowledgments: The authors wish to thank Sunita Kishor and survey managers on the DHS staff for valuable insights into the interview process. We thank Yoonjoung Choi for very helpful comments on an earlier draft. Editor: Bryant Robey Document Production: Joan Wardell This study was carried out with support provided by the United States Agency for International Development (USAID) through The DHS Program (#AID-OAA-C-13-00095). The views expressed are those of the authors and do not necessarily reflect the views of USAID or the United States Government. The DHS Program assists countries worldwide in the collection and use of data to monitor and evaluate population, health, and nutrition programs. Additional information about The DHS Program can be obtained from ICF, 530 Gaither Road, Suite 500, Rockville, MD 20850 USA; telephone: +1 301-572-0200, fax: +1 301-572-0999, email: [email protected], internet: www.DHSprogram.com.
    [Show full text]
  • African Journal of Drug & Alcohol Studies, 17(2), 2018
    African Journal of Drug & Alcohol Studies, 17(2), 2018 Copyright © 2018, CRISA Publications COMMUNITY PERSPECTIVES ON CULTURAL PRACTICES AND BELIEF SYSTEMS INFLUENCING ALCOHOL AND DRUG USE: A QUALITATIVE STUDY IN ANAANG COMMUNITY, NIGERIA Nsidibe A. Usoro1, Dorothy N. Ononokpono2, Ursula Ette3, & Nkereuwem N. James4 1,2Department of Sociology and Anthropology, University of Uyo, Uyo, Nigeria; 3Ministry of Health, Akwa Ibom State, Uyo, Nigeria; 4Department of Establishments, Akwa Ibom State, Uyo, Nigeria ABSTRACT Alcohol and drug use are socially sewn into cultural practices and belief systems in societies. This has been the case with Anaang community. This qualitative study examined narratives in a natural setting to gain insights on cultural practices relating to alcohol and drug use in Anaang society. The methods of study were participant observation and in-depth interview with 80 participants. The study found that some cultural activities harbour causal factors to alcohol use. Majority of participants reported using alcohol in conformity with societal norms and values. Participants differed in opinion concerning drug use. Some confessed using drugs out of personal conviction. Conversely, a good proportion of participants believed that cultural practices and belief system have either overtly or covertly lured them into drug use. Participants unanimously identified low literacy rates, ignorance and lack of effective regulatory mechanism as precursors to alcohol and drug use in local communities. This study mediated through Anaang cultural
    [Show full text]