Defence Attachés 07/2007
Total Page:16
File Type:pdf, Size:1020Kb
Load more
										Recommended publications
									
								- 
												  Military Diplomacy and Its Role in the Foreign Policy of NepalCalhoun: The NPS Institutional Archive DSpace Repository Theses and Dissertations 1. Thesis and Dissertation Collection, all items 2019-12 MILITARY DIPLOMACY AND ITS ROLE IN THE FOREIGN POLICY OF NEPAL Rawal, Pankaj Monterey, CA; Naval Postgraduate School http://hdl.handle.net/10945/64054 Downloaded from NPS Archive: Calhoun NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS MILITARY DIPLOMACY AND ITS ROLE IN THE FOREIGN POLICY OF NEPAL by Pankaj Rawal December 2019 Thesis Advisor: Anshu N. Chatterjee Second Reader: Carolyn C. Halladay Approved for public release. Distribution is unlimited. THIS PAGE INTENTIONALLY LEFT BLANK Form Approved OMB REPORT DOCUMENTATION PAGE No. 0704-0188 Public reporting burden for this collection of information is estimated to average 1 hour per response, including the time for reviewing instruction, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Washington headquarters Services, Directorate for Information Operations and Reports, 1215 Jefferson Davis Highway, Suite 1204, Arlington, VA 22202-4302, and to the Office of Management and Budget, Paperwork Reduction Project (0704-0188) Washington, DC 20503. 1. AGENCY USE ONLY 2. REPORT DATE 3. REPORT TYPE AND DATES COVERED (Leave blank) December 2019 Master’s thesis 4. TITLE AND SUBTITLE 5. FUNDING NUMBERS MILITARY DIPLOMACY AND ITS ROLE IN THE FOREIGN POLICY OF NEPAL 6. AUTHOR(S) Pankaj Rawal 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING Naval Postgraduate School ORGANIZATION REPORT Monterey, CA 93943-5000 NUMBER 9.
- 
												  Philipp Fluri and Eden Cole ∗DCAF’s Activities in Support of Effective and Democratically Transparent Defense Planning Philipp Fluri and Eden Cole ∗ The Geneva Centre for the Democratic Control of Armed Forces (DCAF) focuses on democratic oversight of and guidance for the defense and security sector. Increasing transparency and efficiency in defense planning and spending thus do not generally fall under DCAF’s purview in the strict sense, and are addressed only within the larger context of defense institution building. The defense budgetary process in a given state—from its formulation by the execu- tive, its enactment into law by the legislature, its implementation, and ultimately its au- diting and evaluation—is circumscribed by a number of parameters, and requires that the different actors have competencies in dealing with democratic processes and multi- ple constituencies that are never called upon under authoritarian systems. On the con- trary, the legislature in authoritarian states is often content to “render unto Caesar what is Caesar’s”—that is, to leave the responsibility for things military with the military and/or the security services, as such matters “cannot be understood by lay persons anyway.” In a similar vein, within their ministry itself the defense planners may decide to leave their task essentially in the hands of the “commissars” of the presidential appa- ratus, as this is the place where power is concentrated and monopolized in such sys- tems. As an important consequence, defense planning in transitional states is fraught with problems that are all too familiar: an executive which has first to learn about transparent planning cycles and gain self-confidence in the implementation thereof; a legislative power which needs to learn about guidance and oversight mechanisms; and national media and institutions of civil society which need to change their expectations from commenting on the successes of authoritarian leadership to the assumption of the responsibility for public oversight.
- 
												  03 (15. Februar 2017)2017/03 ISSN 1661-8211 | 117. Jahrgang | 15. Februar 2017 Redaktion und Herausgeberin: Schweizerische Nationalbibliothek NB, Hallwylstrasse 15, CH-3003 Bern Erscheinungsweise: halbmonatlich, am 15. und 30. jeden Monats Hinweise unter: http://ead.nb.admin.ch/web/sb-pdf/ ISSN 1661-8211 © Schweizerische Nationalbibliothek NB, CH-3003 Bern. Alle Rechte vorbehalten Inhaltsverzeichnis - Table des matières - Sommario - Cuntegn - Table of contents Inhaltsverzeichnis - Table des matières - 220 Bibel / Bible / Bibbia / Bibla / Bible....................................... 6 Sommario - Cuntegn - Table of contents 230 Christentum, christliche Theologie / Christianisme, théologie chrétienne / Cristianesimo, teologia cristiana / Cristianissem, teologia cristiana / Christianity and Christian theology..................6 000 Allgemeine Werke, Informatik, Informationswissenschaft / Informatique, information, 290 Andere Religionen / Autres religions / Altre religioni / Autras ouvrages de référence / Informatica, scienza religiuns / Other religions............................................................... 9 dell'informazione, generalità / Informatica, infurmaziun e referenzas generalas / Computers, information and general reference........................................................................................ 1 300 Sozialwissenschaften / Sciences sociales / Scienze sociali / Scienzas socialas / Social sciences.......................... 10 000 Allgemeine Werke, Wissen, Systeme / Généralités, savoir, systèmes / Generalità, sapere, sistemi / Generalitads,
- 
												  Thematic Evaluation of European Commission Support to Justice and Security System ReformThematic Evaluation of European Commission Support to Justice and Security System Reform Final Report Volume I – Main Report November 2011 Evaluation for the European Commission Framework contract for Multi-country thematic and regional/country-level strategy European Group for evaluation studies and synthesis in the area of external co- Evaluation EEIG Germany operation LOT 2: Multi-country evaluation studies on social/human development issues of EC external co-operation PARTICIP GmbH Germany Ref.: EuropeAid/122888/C/SER/Multi Request for Service: 2010/234349 Aide à la Décision Economique Belgium Thhematic Evaluation of European Commission Support to Justice and Security Italy System Reform Deutsches Institut für Entwicklungspolitik Germany European Centre for Development Policy Management Final Report Belgium Volume I – Main Report Overseas Development Institute, United Kingdom South Research November 2011 Belgium A consortium of EGEVAL II (Particip & ADE) –DRN-DIE– ECDPM-ODI c/o Particip GmbH, leading Thhis evaluation was carried out by company: Headquarters Merzhauser Str. 183 D - 79100 Freiburg / Germany Phone: +49-761-79074-0 Fax: +49-761-79074-90 [email protected] The evaluation has been managed by the Joint Evaluation Unit in DG DEVCO. The author accepts sole responsibility for this report, drawn up on behalf of the Commission of the European Union. The report does not necessarily reflect the views of the Commission. Thematic Evaluation of the European Commission Support to Justice and Security System Reform ADE - EGEVAL II Table of Contents LIST OF ACRONYMS EXECUTIVE SUMMARY 1. INTRODUCTION ................................................................................................... 1 1.1 OVERALL OBJECTIVE, MANDATE AND SCOPE OF THE EVALUATION .......................... 1 1.2 KEY PHASES OF THE EVALUATION .................................................................................
- 
												  Building Integrity and Reducing Corruption in DefenceBuilding Integrity and Reducing Corruption in Defence A Compendium of Best Practices The publication of this Compendium is supported by NATO and the Swiss Ministry of Defence Building Integrity and Reducing Corruption in Defence: A Compendium of Best Practices Geneva Centre for the Democratic Control of Armed Forces (DCAF) www.dcaf.ch The Geneva Centre for the Democratic Control of Armed Forces is one of the world’s leading institutions in the areas of security sector reform (SSR) and security sector governance (SSG). DCAF provides in-country advisory support and practical assistance programmes, develops and promotes appropriate democratic norms at the international and national levels, advocates good practices and makes policy recommendations to ensure effective democratic governance of the security sector. DCAF’s partners include governments, parliaments, civil society, international organisations and the range of security sector actors such as police, judiciary, intelligence agencies, border security services and the military. 2010 Building Integrity and Reducing Corruption in Defence: A Compendium of Best Practices Geneva, 2010 The following persons participated in the production of the Compendium of Best Practices in Building Integrity and Reducing Corruption in Defence Editorial Board Philipp Fluri (DCAF), Adrian Kendry (NATO), Simon Lunn (DCAF), Mark Pyman (TI-UK) Editor and Lead Author: Todor Tagarev (Bulgaria) Contributors Jean-Jacques de Dardel (Switzerland) – Foreword, Francois Melese (US) – Chapters 2 and 9, Adrian Kendry and Susan Pond (NATO) – Chapter 3, James Greene (US) – Chap- ters 5, 16 and 22, Mark Pyman (UK) – Chapter 8, Aditya Batara (Indonesia) – Chapter 11, George Lucas (US) – Chapter 12, Alxandre Kukhianidze, Tamuna Karosanidze, Nina Khatiskatsi and Alexander Scrivener (Georgia) – Chapter 13, Anne-Christine Wegener and Mark Pyman (TI-UK) – Chapter 14, Leonid Polyakov (Ukraine) and James Greene (US) – Chapter 17, Wim F.
- 
												  The Future of EU Security Sector Assistance: Learning from Experienceecdpm’s Making policies work DISCUSSION PAPER No. 271 The future of EU security sector assistance: learning from experience By Matthias Deneckere, Ashley Neat and Volker Hauck May 2020 This paper reflects on the future of the EU’s role in working with foreign security actors. It does so in the context of debates on how to better equip EU external action to deal with conflict and instability, including through a European Peace Facility, while also operationalising the linkages between security and development. Our analysis looks at the support to security sector reform (SSR) as an instrument that resides at this nexus and faces various challenges at the strategic and operational level. Such challenges include balancing short- and long-term objectives, reconciling interests and values, ensuring context sensitivity and overcoming bureaucratic and cultural divisions between policy communities. Drawing on practices from the EU and three member states (Germany, France and the Netherlands) in the domain of security sector reform, the paper provides insights on how such challenges can be practically dealt with. First, it argues that a comprehensive SSR policy not only requires a spelled-out strategy, but also a continued dialogue process between security, peace and development communities at the strategic and policy level, involving experts and civil society actors. Second, SSR needs to build on localised approaches that are informed by political context analysis and build on existing reform processes or windows of opportunity to foster change through targeted interventions. Third, cooperation with security actors should consider the risks in doing harm or negatively impacting conflict dynamics. Practical tools exist to manage risks, but negative effects can never be completely controlled.
- 
												  Japan's Defense Diplomacy in South East AsiaISSN 2464-9929, Global Politics Review 5, no. 1-2 (2019): 6-49. Japan’s Defense Diplomacy in South East Asia Daniel Foulkes Leon* Abstract: Through an empirical case study analysis, this article analyses Japan’s defense diplomacy in the South East Asian nations of Indonesia, the Philippines and Vietnam during the period from 2006 to 2016. Defense diplomacy is an element of statecraft that uses a nation’s military and security institutions in a non-coercive, peaceful manner to enhance military cooperation and to seek military reform with another nation. This article traces the evolution of Japan’s defense diplomacy in its evolving security environment and identifies its character based on See Seng Tang and Bhubhindar Singh’s typology of “pragmatic” or “transformative” defense diplomacy, contributing important elements in the study of Japan’s defense diplomacy strategy and engagement in South East Asia. Keywords: Defense Diplomacy, Japan, South East Asia, Indonesia, Vietnam, Philippines. Received: April 5, 2019. Accepted: May 10, 2019. Published: May 19, 2019. Introduction n May 2017 Japan’s largest naval vessel in the Maritime Self Defense Forces, the JS Izumo, arrived in Vietnam as part of the Pacific Partnership naval exercise, focused on Ihumanitarian assistance and disaster relief (HA/DR).1 This multilateral naval exercise led by the United States with Australia, the United Kingdom and Japan as participating countries, involved a series of host nations in professional training opportunities, workshops and field training exercises. In March 2017, the Philippine Navy had also received two patrol aircraft from Japan with the purpose of aiding its future maritime patrol and HA/DR capabilities.2 Philippine Navy pilots undertook training in Japan from November 2016 to March 2017.
- 
												  Parliamentary Oversight of Security and Intelligence Agencies in the European UnionDIRECTORATE GENERAL FOR INTERNAL POLICIES POLICY DEPARTMENT C: CITIZENS' RIGHTS AND CONSTITUTIONAL AFFAIRS CIVIL LIBERTIES, JUSTICE AND HOME AFFAIRS PARLIAMENTARY OVERSIGHT OF SECURITY AND INTELLIGENCE AGENCIES IN THE EUROPEAN UNION STUDY Abstract This study evaluates the oversight of national security and intelligence agencies by parliaments and specialised non-parliamentary oversight bodies, with a view to identifying good practices that can inform the European Parliament’s approach to strengthening the oversight of Europol, Eurojust, Frontex and, to a lesser extent, Sitcen. The study puts forward a series of detailed recommendations (including in the field of access to classified information) that are formulated on the basis of in- depth assessments of: (1) the current functions and powers of these four bodies; (2) existing arrangements for the oversight of these bodies by the European Parliament, the Joint Supervisory Bodies and national parliaments; and (3) the legal and institutional frameworks for parliamentary and specialised oversight of security and intelligence agencies in EU Member States and other major democracies. PE 453.207 EN This document was requested by the European Parliament's Committee on Civil Liberties, Justice and Home Affairs. AUTHORS Aidan WILLS, Geneva Centre for the Democratic Control of Armed Forces (DCAF) Mathias VERMEULEN, European University Institute (EUI) Hans BORN, Project Leader, DCAF Martin SCHEININ, Project Leader, EUI Micha WIEBUSCH, Research Assistant, DCAF Ashley THORNTON, Language Consultant RESPONSIBLE ADMINISTRATOR Andreas HARTMANN Policy Department C: Citizens' Rights and Constitutional Affairs European Parliament B-1047 Bruxelles E-mail: [email protected] LINGUISTIC VERSIONS Original: EN ABOUT THE EDITOR To contact the Policy Department or to subscribe to its newsletter please write to: [email protected] Manuscript completed in June 2011.
- 
												  Gender Integration in Democracy, Human Rights, and Governance (DRG)Gender Integration in Democracy, Human Rights, and Governance (DRG) PROGRAMMING TOOLKIT JUNE 2016 Acknowledgements External consultant Alyson Kozma conducted the initial research and was the lead author of this toolkit. USAID’s Center of Excellence on Democracy, Human Rights, and Governance (DRG Center), specifically its Gender Working Group, comprised of members from the DRG Center’s leadership team and each of its nine divisions, supported the production of this toolkit. The following people contributed comments during an internal review of the publication: Adam Bushey (DRG), Colin Buckley (DRG), Cathy Cozzarelli (PPL), Julie Denham (DRG), Claire Ehmann (DRG), Mark Goldenbaum (DRG), Martin Hayes (DRG), Ajit Joshi (DRG), Bruce Kay (DRG), Mike Keshishian (DRG), Summer Lopez (DRG), Sharon Rogers (DRG), Lauren Seyfried (DRG), Andrew Solomon (DRG), Tamara Shaya (CMM), and Madeline Williams (DRG). The toolkit also draws on inputs from the DRG Cadre, including Foreign Service Officers and Foreign Service Nationals across missions, collected via electronic survey in 2013. This survey was designed to capture the DRG sub-sectoral priorities identified by the DRG Cadre as they relate to program cycle gender integration and program design. DISCLAIMER The author’s views expressed in this publication do not necessarily reflect the views of the United States Agency for International Development or the United States Government. C2 TABLE OF CONTENTS I. Glossary of Acronyms ..................................................................................................................................................................2
- 
												  Private Actors and Security GovernancePrivate Actors and Security Governance Alan Bryden, and Marina Caparini (editors.) © 2006, LIT & DCAF Contents List of Graphs and Tables ix Preface xi Abbreviations xiii Part I: Introduction 1 Approaching the Privatisation of Security from 3 a Security Governance Perspective Alan Bryden Part II: The International Policy Context 2 Fragile Statehood, Armed Non-State Actors 23 and Security Governance Ulrich Schneckener 3 Private Sector, Public Security 41 Alyson Bailes 4 Insurgencies, Security Governance and 65 the International Community Albrecht Schnabel. 5 Reconstructing the Public Monopoly 87 of Legitimate Force Herbert Wulf Part III: Regional and National Perspectives 6 Bulgaria's Private Security Industry 109 Philip Gounev 7 The Commercialisation of Post-Soviet Private Security 129 Duncan Hiscock 8 Challenges of Security Privatisation in Iraq 149 David Isenberg 9 Implementing South Africa’s Regulation of 167 Foreign Military Assistance Act Raenette Taljaard Part IV: Challenges of Regulation 10 Regulating Military and Security Services 189 in the European Union Elke Krahmann 11 The United Nations and the Dilemma 213 of Outsourcing Peacekeeping Operations Victor-Yves Ghebali 12 Assessing the Relationship between Humanitarian 231 Actors and Private Security Companies Christopher Spearin 13 Private Security Actors, Donors and SSR 247 Peter Wilson Part V: Conclusion 14 Applying a Security Governance Perspective to 263 the Privatisation of Security Marina Caparini Annex International Organisations and the Governance of 285 Private Security
- 
												  Global Journal of Human Social Science Relevance to the Career, Tutors Competence and Exacerbated by Shortage of Human Resources for HealthOnline ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS Integration of Community Health An Assessment of the Terrorism Satisfaction on the Training program Sources of Development of Aviation VOLUME 18 ISSUE 1 VERSION 1.0 Global Journal of Human-Social Science: H Interdisciplinary Global Journal of Human-Social Science: H Interdisciplinary Volume 18 Issue 1 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2018. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Glo bal Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG
- 
												  Defence Diplomacy: Conceptual and Practical Dimensions W Ith Specific Reference to South AfricaDEFENCE DIPLOMACY: CONCEPTUAL AND PRACTICAL DIMENSIONS W ITH SPECIFIC REFERENCE TO SOUTH AFRICA Prof Anton du Plessis Departm ent of Political Sciences University of Pretoria ABSTRACT This article explores defence diplomacy with reference to South Africa. Although the use of military means for diplomatic purposes is an es- tablished practice in South Africa, it is argued that as defence foreign relations, South African defence diplomacy approximates a military adjunct to diplomacy rather than a distinct type of diplomacy. At one level, its importance in a changing environment and use for foreign and security policy purposes are recognised in principle, whereas, at another level, defence diplomacy has become an overarching term for defence foreign relations. As a result, defence diplomacy does not receive the recognition it deserves. Conceptually, this is due less to the precarious relationship between various foreign policy instru- ments, and more to an underestimation of the nature, scope and utility of defence diplomacy. Practically, and due in part to conceptual am- biguity, this underestimation is reinforced by a lack of integration with foreign and defence policy and corresponding military policy and strat- egy, as well as by defence diplomacy being restricted to its military- defence policy context rather than enhanced by its diplomatic-foreign policy context. These conclusions are based on a brief exposition of the relationship between the military and diplomatic instruments of foreign policy; an account of the nature and scope of defence diplo- macy and related concepts; an overview of what accordingly con- stitutes South African defence diplomacy; and a concluding assess- ment and evaluation of its future prospects and constraints.