!"#$% !&&'()*+)',-%",).-/&)0*/)*%1)%#021)%$2/'3-)% % % % !"#$"%&"'()*+,*-*".$.&/*(0*12%,$%3(( $"4(526&.&%$6(5$,.&%&+$.&2"( 728$,4-(9:;<(!=,2+*$"(5$,6&$1*".(!6*%.&2"-( (% % % 45-%%$2/'3-*,%%6'7)0)(*7%%6*/0)-&8%%9*,):-&0'&% %
% % % % % % % % % % % % % % % % % % % % % % % % % % % % % ;>?>@9:;<( (
( ( 9A.#(B""&/*,-$,3( (BCD!(BE0(F!BE(GHEE!7( ((5)HI)BGG!( (% % % % % !&&'()*+)',-%",).-/&)0*/)*%1)%#021)%$2/'3-)%%;%!"#$%<% =)*%9*/0)/)%1-77*%>)?-/0@A%B%%C%DEFDG%6!HI=!% 888J$=-*J&.( % $J%$2/'3-*,%J'KK)&&)',%C%$12(*0)',A%!21)'.)&2*7%*,1%J2702/-% $L-(20).-%!M-,(N%%;%$!J$!%<% #..+KLL*$%*$J*%J*=,2+$J*=%
Enhancing Representative Democracy and Political Participation Towards 2014 European Parliament Elections
This publication collects the Programs and Manifestos that will be presented to the general public by European Political Parties on occasion of the EP 2014 Elections. The sources of the Documents are the European Parliament Official Internet Site and the Parties Official Web Sites. The Parties’ Manifestos have been presented in accordance to the list presented on the European Parliament’s 2014 Elections Website. The brochure wishes to provide to the Public an overview of the policy issues that wil be addressed at EU level by political families, giving evidence to priorities that will be addressed, and how the 2014 electoral campaign will be shaped and steered.
This publication has been realised by AUSE – Associazione Universitaria di Studi Europei in the framework of the Project “Representative Democracy and Political Participation. Towards a European Transnational Party System” (EACEA Project no. 2013-2946/001-001). The project has been funded with support of the European Commission – EACEA - Education, Audiovisual and Culture Executive Agency.
Cover image: European Parliament NewsRoom. Infographic REF. : 20140222IFG36704
This communication reflects the views only of the author, and the Commission cannot be held responsible for any use which may be made of the information contained therein.
AUSE - Associazione Universitaria di Studi Europei Celebrating in 2014 its 25th Anniversary, AUSE is Founding Member of The European Community Studies Association, ECSA-World, AUSE represents more than 100 professors and Italian researchers who teach and do research in the field of European integration. The main aims of the Association are the promotion of higher education and research in the field of European studies, the development of cooperation between the members and the enhancement of cooperation between universities in Europe and the World, the management of transnational programs of research, give technical assistance and advice on European integration, the publication of scientific works on the European Union.
Find out more on: www.ause.it
EACEA - Education, Audiovisual and Culture Executive Agency. The Education, Audiovisual and Culture Executive Agency (EACEA) is responsible for the management of certain parts of the EU's funding programmes in the fields of education, culture, audiovisual, sport, citizenship and volunteering. 1) The Agency is responsible for most management aspects of the programmes, including drawing up conditions and guidelines for funding opportunities; evaluating applications, selecting projects and signing project agreements; financial management; contacts with beneficiaries; monitoring of projects (intermediate and final reports, and controls); on-site project visits. 2) Information and support to applicants and beneficiaries 3) Dissemination and exploitation of projects' results 4) Contribution to European Knowledge and expertise
Fully operational since 1st of January 2006, the Executive Agency operates under the supervision of its three parent Directorates-General of the European Commission:
Education and Culture (DG EAC) Communication (DG COMM) Humanitarian Aid & Civil Protection (DG ECHO)
Find out more on: http://eacea.ec.europa.eu
!"##$%&' ! !!!!! ! "#$!%&'()$*+!,*'-.*/$+012!,'$22!3.0! ,*>?!@! 45$'5.$6!(7!0#$!,*'-.*/$+0!*+8!0#$!9:;
%&'()$*+!,$()-$A2!,*'0B! C!!!!!;D! !
,*'0B!(7!%&'()$*+!E(=.*-.202! C!!!!!FD! !
G--.*+=$!(7!H.I$'*-2!*+8!J$/(='*02!7('!%&'()$! C!!!!!K;! !
L'$$+2! C!!!!!M;! !
G--.*+=$!(7!%&'()$*+!N(+2$'5*0.5$2!*+8!O$7('/.202! C!!!!!;:D! !
"#$!,*'0B!(7!0#$!%&'()$*+!H$70! C!!!!!;:P! !
! Q(5$/$+0!7('!*!%&'()$!(7!H.I$'0.$2!*+8!J$/(='*=B! C!!!!!;9D!
%&'()$*+!J$/(='*0.=!,*'0B! C!!!!!;9K! !
%&'()$*+!R'$$!G--.*+=$! C!!!!!;DD! !
%&'()$*+!G--.*+=$!7('!R'$$8(/! C!!!!!; G--.*+=$!(7!%&'()$*+!S*0.(+*-!Q(5$/$+02! C!!!!!;@;! ! %&'()$*+!N#'.20.*+!,(-.0.=*-!Q(5$/$+0! C!!!!!;@D! ! %T!J$/(='*02! C!!!!!;KD! ! ! ! ! ! ! ! ! ! ! ()*'+,-./*01'20-3405*1678'2-*88'946' :;*-;4*<'.='6)*'20-3405*16'01>'6)*'?@AB'+3*C64.18' ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:; 5 2YHUYLHZRI3DUOLDPHQWDQGWKHHOHFWLRQV > @ 7KH(XURSHDQHOHFWLRQV WKLVWLPHLW VGLIIHUHQW 7KH(XURSHDQHOHFWLRQVRI0D\JLYHYRWHUVWKHFKDQFHWRLQIOXHQFHWKHIXWXUHSROLWLFDO FRXUVHRIWKH(XURSHDQ8QLRQZKHQWKH\HOHFWWKH0HPEHUVRIWKH(XURSHDQ3DUOLDPHQW 0(3V WRUHSUHVHQWWKHLULQWHUHVWVIRUWKHQH[WILYH\HDUV :KHQLVHOHFWLRQGD\" (DFKPHPEHUVWDWHKDVLWVRZQHOHFWRUDOODZVDQGHDFKRQHGHFLGHVRQZKDWGD\LWVFLWL]HQVZLOOJR WRWKHSROOVGXULQJWKHIRXUGD\HOHFWLRQSHULRGIURPWR0D\%ULWLVKYRWHUVZLOOWXUQRXW RQ0D\WRHOHFWWKHLU0(3V,ULVKYRWHUVZLOOFKRRVHWKHLU0(3VEHWZHHQDQG0D\ H[DFWGDWHWREHGHFLGHGE\,ULVK*RYHUQPHQW 7KHUHVXOWVIURPDOOVWDWHVZLOOEHDQQRXQFHGRQ WKHHYHQLQJRI6XQGD\0D\ +RZPDQ\0(3VZLOOEHHOHFWHG" 7KHUHKDYHEHHQ0HPEHUVRIWKH(XURSHDQ3DUOLDPHQWVLQFH&URDWLDMRLQHGWKH(8LQ-XO\ EXWWKLVQXPEHULVEHLQJVFDOHGGRZQDWWKHHOHFWLRQVWRDQGZLOOVWD\DWWKDWOHYHOLQ IXWXUH7KHVH0(3VZLOOUHSUHVHQWRYHUPLOOLRQFLWL]HQVLQPHPEHUVWDWHV7KHVHDWVDUH DOORFDWHGDPRQJWKHYDULRXVVWDWHVE\WKH(8WUHDWLHVRQWKHEDVLVRI GHJUHVVLYHSURSRUWLRQDOLW\ PHDQLQJFRXQWULHVZLWKODUJHUSRSXODWLRQVKDYHPRUHVHDWVWKDQVPDOOHURQHVEXWWKHODWWHUKDYH PRUHVHDWVWKDQVWULFWSURSRUWLRQDOLW\ZRXOGLPSO\ :K\DUHWKHVHHOHFWLRQVGLIIHUHQW" $VWKH(XURSHDQ8QLRQVHHNVWRSXOOWKURXJKWKHHFRQRPLFFULVLVDQG(8OHDGHUVUHIOHFWRQZKDW GLUHFWLRQWRWDNHLQIXWXUHWKHVHDUHWKHPRVWLPSRUWDQW(XURSHDQHOHFWLRQVWRGDWH 7KH\QRWRQO\DOORZYRWHUVWRSDVVMXGJPHQWRQ(8OHDGHUV HIIRUWVWRWDFNOHWKHHXUR]RQHFULVLVDQG WRH[SUHVVWKHLUYLHZVRQSODQVIRUFORVHUHFRQRPLFDQGSROLWLFDOLQWHJUDWLRQ WKH\DUHDOVRWKHILUVW HOHFWLRQVVLQFHWKH/LVERQ7UHDW\RI JDYHWKH(XURSHDQ3DUOLDPHQWDQXPEHURILPSRUWDQW QHZSRZHUV 2QHPDMRUQHZGHYHORSPHQWLQWURGXFHGE\WKH7UHDW\LVWKDWZKHQWKH(8PHPEHUVWDWHV QRPLQDWHWKHQH[WSUHVLGHQWRIWKH(XURSHDQ&RPPLVVLRQWRVXFFHHG-RVp0DQXHO%DUURVRLQ DXWXPQWKH\ZLOOIRUWKHILUVWWLPHKDYHWRWDNHDFFRXQWRIWKH(XURSHDQHOHFWLRQUHVXOWV 7KHQHZ3DUOLDPHQWPXVWHQGRUVHWKLVFDQGLGDWH LW HOHFWV WKH&RPPLVVLRQSUHVLGHQWLQWKHZRUGV RIWKH7UHDW\7KLVPHDQVYRWHUVQRZKDYHDFOHDUVD\LQZKRWDNHVRYHUDWWKHKHOPRI(8 JRYHUQPHQW 2IWKH(XURSHDQSROLWLFDOSDUWLHVILYHKDYHQRPLQDWHGDFDQGLGDWHWRVXFFHHGWKHFXUUHQW &RPPLVVLRQ3UHVLGHQW7KH(33KDVQRPLQDWHG-HDQ&ODXGH-XQFNHUIRUPHU/X[HPERXUJSULPH PLQLVWHUDQGIRUPHU(XURJURXSSUHVLGHQWWKH3(6FDQGLGDWHLV0DUWLQ6FKXO]FXUUHQWSUHVLGHQWRI WKH(XURSHDQ3DUOLDPHQWWKH/LEHUDOVDQG'HPRFUDWVKDYHRSWHGIRU*X\9HUKRIVWDGWIRUPHU %HOJLDQSULPHPLQLVWHUDQGFXUUHQW/LEHUDOJURXSOHDGHULQWKH(3WKH*UHHQVKDYHQRPLQDWHGD GXRRIFXUUHQW0(3V)UHQFK-RVp%RYpDQG*HUPDQ6ND.HOOHUZKLOHWKH(XURSHDQ/HIWKDYHSXW 3UHVV6HUYLFH 'LUHFWRUDWHIRUWKH0HGLD 6 'LUHFWRU6SRNHVSHUVRQ -DXPH'8&+*8,//27 (1 5HIHUHQFH1R 3.+ ZZZHOHFWLRQVHX IRUZDUG$OH[LV7VLSUDVOHDGHURIWKH*UHHN6<5,=$SDUW\ 7KHQHZSROLWLFDOPDMRULW\WKDWHPHUJHVIURPWKHHOHFWLRQVZLOODOVRVKDSH(XURSHDQOHJLVODWLRQRYHU WKHQH[WILYH\HDUVLQDUHDVIURPWKHVLQJOHPDUNHWWRFLYLOOLEHUWLHV7KH3DUOLDPHQWWKHRQO\GLUHFWO\ HOHFWHG(8LQVWLWXWLRQLVQRZDOLQFKSLQRIWKH(XURSHDQGHFLVLRQPDNLQJV\VWHPDQGKDVDQHTXDO VD\ZLWKQDWLRQDOJRYHUQPHQWVRQQHDUO\DOO(8ODZV :KDWLVWKH3DUOLDPHQW VUROH":KDWSRZHUVGRHVLWKDYH" 7KHRXWFRPHRIWKHHOHFWLRQVWRWKH(XURSHDQ3DUOLDPHQWZLOOIRUWKHILUVWWLPHLQWKH(8 V KLVWRU\GHWHUPLQHZKROHDGVWKH(XURSHDQ&RPPLVVLRQWKH(8 VH[HFXWLYHERG\&DQGLGDWHVIRU WKHUHPDLQLQJ&RPPLVVLRQSRUWIROLRVZLOODOVRKDYHWRSDVVDWRXJKSDUOLDPHQWDU\YHWWLQJSURFHVV EHIRUHWKH\FDQWDNHRIILFH 2QFHWKHFRPSRVLWLRQRIWKH&RPPLVVLRQLVVHWWOHG0(3VZLOOWXUQWRWKHLUPDLQSDUOLDPHQWDU\ GXWLHV WKHIUDPLQJRIODZVDIIHFWLQJWKHHYHU\GD\OLYHVRI(XURSH VFLWL]HQVSOXVWKHVHWWLQJRIWKH DQQXDO(8EXGJHWSRZHUVZKLFKLWVKDUHVZLWKWKH&RXQFLORI0LQLVWHUV WKH(8QDWLRQDO JRYHUQPHQWV LQVRPHWKLQJOLNHDELFDPHUDOV\VWHP7KH3DUOLDPHQWDOVRKDVSRZHUVRIVFUXWLQ\RU RYHUVLJKWRYHUWKHRWKHU(8LQVWLWXWLRQV LWPRQLWRUVKRZWKH\ZRUNDQGKRZWKH\VSHQGWKH WD[SD\HU VPRQH\/DVWEXWQRWOHDVW3DUOLDPHQWDFWVDVDVRXQGLQJERDUGIRUWKHSXEOLF VFRQFHUQV DQGFDQWKUXVWIUHVKLVVXHVRQWRWKH(XURSHDQSROLWLFDODJHQGD +HUHLVDQRYHUYLHZRI3DUOLDPHQW VUHVSRQVLELOLWLHVDQGSRZHUV 3URFHGXUHIRUDSSRLQWPHQWRIWKH(XURSHDQ&RPPLVVLRQ 7KLVZLOOEHWKHILUVWWLPHWKH(8PHPEHUVWDWHVDUHUHTXLUHGWRWDNHDFFRXQWRIWKHUHVXOWVRIWKH (XURSHDQHOHFWLRQVEHIRUHFKRRVLQJDQRPLQHHIRU3UHVLGHQWRIWKH&RPPLVVLRQ7KHSURFHGXUH ZLOOEHDVIROORZV WDNLQJLQWRDFFRXQWWKH(XURSHDQHOHFWLRQVWKHKHDGVRIVWDWHRUJRYHUQPHQWRIWKHPHPEHU VWDWHVSXWIRUZDUGDFDQGLGDWHIRU&RPPLVVLRQ3UHVLGHQW WKHFDQGLGDWHSUHVHQWVKLVKHUSROLWLFDOJXLGHOLQHV LQHIIHFWDPDQLIHVWR WRWKH3DUOLDPHQW WKHFDQGLGDWHPXVWEHDSSURYHGE\DQDEVROXWHPDMRULW\RI0(3V RXWRI LI DSSURYHGKHVKHLVGHHPHG HOHFWHG E\WKH3DUOLDPHQW LIKHVKHLVQRWDSSURYHGWKHPHPEHU VWDWHVPXVWSXWIRUZDUGDQHZFDQGLGDWH WKH3UHVLGHQWHOHFWDQG(8QDWLRQDOJRYHUQPHQWVWRJHWKHUDJUHHDOLVWRIFDQGLGDWHVIRUWKH RWKHU&RPPLVVLRQSRUWIROLRV RQHIURPHDFKFRXQWU\ WKHFDQGLGDWHVXQGHUJRFRQILUPDWLRQKHDULQJVDW3DUOLDPHQW WKHVHKHDULQJVDUHQRW IRUPDOLWLHV 3DUOLDPHQWKDVLQWKHSDVWUHMHFWHGQRPLQHHVLWFRQVLGHUHGXQVXLWDEOH WKH3UHVLGHQWDQGWKHRWKHU&RPPLVVLRQHUVDVDERG\DUHWKHQVXEMHFWWRDVLQJOHYRWHRI DSSURYDOE\3DUOLDPHQWUHTXLULQJDVLPSOHPDMRULW\ DPDMRULW\RIYRWHVFDVW LIDSSURYHGE\3DUOLDPHQWWKHQHZ&RPPLVVLRQLVIRUPDOO\DSSRLQWHGE\WKH(8KHDGVRI VWDWHJRYHUQPHQW /HJLVODWLYHSRZHUV 0(3VDUHWKH(8 VODZPDNHUV ZLWKRXWWKHLULQSXWDQGDSSURYDOPRVW(8ODZVFDQQRWFRPHLQWR EHLQJ:LWKWKH /LVERQ7UHDW\3DUOLDPHQWJDLQHGUHDOSRZHURYHUWKHILQDOLPSRUWDQWSROLF\ DUHDVQRWDEO\DJULFXOWXUHDQGFLYLOOLEHUWLHVLQZKLFKLWKDGSUHYLRXVO\RQO\KDGDFRQVXOWDWLYHUROH 7KHPDLQW\SHVRIOHJLVODWLYHSRZHUDUHDVIROORZV 2UGLQDU\OHJLVODWLYHSURFHGXUH $OVRNQRZQDV FRGHFLVLRQ WKLVLVWKHPDLQ(8OHJLVODWLYH SURFHGXUHXVHGWRGUDIWDQGDGRSWQHDUO\DOO(XURSHDQODZV LQDURXQGWRSROLF\DUHDV ,WJLYHV3DUOLDPHQWWKHSRZHUWRDFFHSWUHMHFWRUDPHQGGUDIWOHJLVODWLRQRQWKHVLQJOHPDUNHW HQYLURQPHQWFRQVXPHUSURWHFWLRQFLYLOOLEHUWLHVDJULFXOWXUHWUDQVSRUWUHVHDUFKDQGRWKHU DUHDV'XULQJWKLVWHUPIRUH[DPSOH0(3VKDYHXVHGWKHLUOHJLVODWLYHPXVFOHWRLQVLVWRQ VWURQJHUGDWDSURWHFWLRQUXOHVFDSVRQEDQNHUV ERQXVHVDQGJUHDWHUGHPRFUDWLFVFUXWLQ\RI WKH(8¶VIOHGJOLQJHFRQRPLFJRYHUQDQFHV\VWHP 3.+ 7 &RQVXOWDWLRQ 2QVRPHW\SHVRIOHJLVODWLRQ HJWD[FRPSHWLWLRQQHZHXUR]RQHPHPEHUV 3DUOLDPHQWJLYHVRQO\DQDGYLVRU\RSLQLRQ+RZHYHUWKHQXPEHURISROLF\DUHDVJRYHUQHGE\ WKLVSURFHGXUHKDVVKUXQNFRQVLGHUDEO\ZLWKPRVWOHJLVODWLRQQRZFRPLQJXQGHUFRGHFLVLRQ &RQVHQW ,IWKH(8LVSODQQLQJWRWDNHLQQHZPHPEHUVWDWHVRUFRQFOXGHDJUHHPHQWVZLWK QRQ(8FRXQWULHV3DUOLDPHQW VVHDORIDSSURYDOLVQHHGHGDOWKRXJKWKH(3FDQQRWDPHQG LQGLYLGXDOGHWDLOVRIVXFKDFFRUGV,QWKHFXUUHQWWHUP0(3VKDYHUHMHFWHGWKH $QWL&RXQWHUIHLWLQJ7UDGH$JUHHPHQW $&7$ DQGUHIXVHGWRDOORZEDQNGDWDWUDQVIHUVWRWKH 86$YLDWKH6:,)7QHWZRUN 5LJKWRILQLWLDWLYH 3DUOLDPHQWFDQDVNWKH&RPPLVVLRQWRSURSRVHQHZOHJLVODWLRQDQGRIWHQ GRHVVRDIWHUH[DPLQLQJWKH&RPPLVVLRQ VDQQXDOZRUNSURJUDPPH %XGJHWDU\SRZHUV 7KH(XURSHDQ8QLRQ VORQJWHUPVSHQGLQJEXGJHWKDVWREHDSSURYHGE\QDWLRQDOJRYHUQPHQWVDQG 0(3VWKHQHDFK\HDUWKHWZRVLGHVGHFLGHWRJHWKHUKRZWKHDQQXDOEXGJHWZLOOEHVSHQW3ROLFLHV VXFKDVDJULFXOWXUHUHJLRQDOGHYHORSPHQWHQHUJ\WUDQVSRUWWKHHQYLURQPHQWGHYHORSPHQWDLG DQGVFLHQWLILFUHVHDUFKDOOUHFHLYH(8IXQGLQJ 3DUOLDPHQWLVDOVRUHVSRQVLEOHIRUFKHFNLQJODWHULIWKHWD[SD\HU VPRQH\KDVEHHQXVHGDVLQWHQGHG DQGIRUVLJQLQJRIIWKHDFFRXQWVLILWLVVDWLVILHG2QQXPHURXVRFFDVLRQVLWKDVGHPDQGHGPRUH VWULQJHQWFRQWUROVDQGLQ LWIRUFHGWKHHQWLUH&RPPLVVLRQRXWRIRIILFHIRUEXGJHWDU\ PLVPDQDJHPHQW 'HPRFUDWLFFRQWURODQGVXSHUYLVRU\SRZHUV $EDVLFIXQFWLRQRIDQ\SDUOLDPHQWLVWKHVFUXWLQ\RURYHUVLJKWRIRWKHUEUDQFKHVRISRZHUWRHQVXUH GHPRFUDWLFDFFRXQWDELOLW\7KH(XURSHDQ3DUOLDPHQWSHUIRUPVWKLVWDVNLQDQXPEHURIZD\V 1RPLQDWLRQSRZHUV ,QDGGLWLRQWRLWVNH\UROHLQWKHHOHFWLRQRIWKH&RPPLVVLRQ3DUOLDPHQWKROGVKHDULQJVRIWKH 3UHVLGHQWDQGPHPEHUVRIWKH([HFXWLYH%RDUGRIWKH(XURSHDQ&HQWUDO%DQNDQGRIQRPLQHHVIRU WKH&RXUWRI$XGLWRUV 3DUOLDPHQWDU\VFUXWLQ\RIWKH(&% 7RHQVXUHWKHDFFRXQWDELOLW\RI(XURSHDQPRQHWDU\SROLF\WKH3UHVLGHQWRIWKH(XURSHDQ&HQWUDO %DQNUHSRUWVWRWKH(3(FRQRPLFV&RPPLWWHHHYHU\WKUHHPRQWKVDQGDOVRSUHVHQWVWKHEDQN V DQQXDOUHSRUWWR3DUOLDPHQW ,QLWVQHZFDSDFLW\DVWKH(8EDQNVXSHUYLVRUWKH(&%ZLOOEHVXEMHFWWRVWURQJSDUOLDPHQWDU\ RYHUVLJKWE\0(3VZKRZLOODOVREHHPSRZHUHGWRDSSURYHWKHWRSHFKHORQVRIWKHVXSHUYLVRU\ ERG\ 3DUOLDPHQWDU\LQTXLULHV 3DUOLDPHQWKDVWKHSRZHUWRVHWXSDWHPSRUDU\FRPPLWWHHHLWKHUWRLQYHVWLJDWHDQLVVXHRISXEOLF LQWHUHVW DUHFHQWFDVHZDVWKHFRPPLWWHHRQRUJDQLVHGFULPHFRUUXSWLRQDQGPRQH\ODXQGHULQJ RU WRORRNLQWRDOOHJHGEUHDFKHVRUPDODGPLQLVWUDWLRQRI&RPPXQLW\ODZ 3DUOLDPHQWDU\TXHVWLRQV 7RKROGWKHRWKHU(8LQVWLWXWLRQVWRDFFRXQW0(3VFDQDVNRUDODQGZULWWHQTXHVWLRQV%\WKLV PHDQVWKH&RPPLVVLRQDQG&RXQFLODUHUHJXODUO\IRUFHGWRDQVZHUTXHULHVVXSSO\GHWDLOHG LQIRUPDWLRQRUWDNHSDUWLQDGHEDWHLQ3DUOLDPHQWRQVSHFLILFSROLF\LVVXHV )RUHLJQSROLF\DQGKXPDQULJKWV 7KH+LJK5HSUHVHQWDWLYHIRUWKH(8 VFRPPRQIRUHLJQDQGVHFXULW\SROLF\ &)63 LVDFFRXQWDEOHWR 3DUOLDPHQWZKLFKKDVDULJKWWREHLQIRUPHGDQGFRQVXOWHGDERXWWKHSROLF\DQGFDQDOVRXVHLWV EXGJHWDU\SRZHUVWRVKDSHLWVVFDOHDQGVFRSH 3.+ 8 3DUOLDPHQW VFRQVHQWLVQHHGHGIRUDQ\HQODUJHPHQWRIWKH(8DQGIRUWKHFRQFOXVLRQRIWUDGHDQG RWKHULQWHUQDWLRQDODJUHHPHQWVZLWKQRQ(8VWDWHV0(3VDOVRGHYRWHFRQVLGHUDEOHHQHUJ\WR KXPDQULJKWVLVVXHVDQGWKHSURPRWLRQRIGHPRFUDWLFYDOXHVDURXQGWKHZRUOGWKHDZDUGRIWKH 6DNKDURY3UL]HIRU)UHHGRPRI7KRXJKWEHLQJWKHDQQXDOKLJKOLJKWRI3DUOLDPHQW VZRUNLQWKLVDUHD 3HWLWLRQV 7KH(3WDNHVWKHOHDGLQSURPRWLQJWUDQVSDUHQF\RSHQQHVVDQGSXEOLFDFFHVVLQWKHVRPHWLPHV ODE\ULQWKLQH%UXVVHOVZRUOG(YHU\(XURSHDQFLWL]HQKDVWKHULJKWWRSHWLWLRQ0(3VDERXW HQYLURQPHQWDOSUREOHPVGLVSXWHVZLWKFXVWRPVDXWKRULWLHVWUDQVIHUVRISHQVLRQULJKWVDQGRWKHU PDWWHUVSURYLGHGWKH\IDOOZLWKLQWKH(XURSHDQ8QLRQ VUHPLW7KHSXEOLFFDQDOVRWXUQWRWKH (XURSHDQ2PEXGVPDQDQLQGHSHQGHQWILJXUHDSSRLQWHGE\3DUOLDPHQWZKRKDVWKHSRZHUWR LQYHVWLJDWHDFFXVDWLRQVRIPDODGPLQLVWUDWLRQRUDEXVHRISRZHUE\DQ(8LQVWLWXWLRQ /,1.6 3DUOLDPHQW VSRZHUVDQGSURFHGXUHV 2UJDQLVDWLRQDQGZRUNRI3DUOLDPHQW 3ROLWLFDOJURXSV WKHGULYLQJIRUFHRIWKH(3 'HEDWHFRQWURYHUV\DQGFRQIOLFWDUHWKHOLIHEORRGRIDQ\GHPRFUDWLFDOO\HOHFWHGERG\7KH (XURSHDQ3DUOLDPHQWPDGHXSRISROLWLFLDQVZLWKVRPHWLPHVVKDUSO\GLIIHULQJYLHZVLVQR H[FHSWLRQ 7RKDUQHVVWKLVZLGHUDQJHRIRSLQLRQDQGQDWLRQDOLWLHVLQWRDZRUNDEOHV\VWHP0(3VKDYHDOZD\V RSHUDWHGWKURXJKWUDQVQDWLRQDOµSROLWLFDOJURXSV¶HDFKPDGHXSRIPHPEHUVIURPGLIIHUHQWFRXQWULHV EXWZLWKVLPLODUSROLWLFDOFRQYLFWLRQV&RRSHUDWLQJFORVHO\ZLWK0HPEHUVIURPRWKHUFRXQWULHVZKR EURDGO\VKDUHWKHLUSROLWLFDOYLHZVLVWKHPRVWHIIHFWLYHZD\IRU0(3VWRDFKLHYHWKHLUJRDOVDW (XURSHDQOHYHO 7KHUHDUHFXUUHQWO\VHYHQJURXSVLQWKH(3UDQJLQJDFURVVWKHSROLWLFDOVSHFWUXPDQGUHSUHVHQWLQJ RYHUQDWLRQDOSDUWLHV 7KHJURXSVDUHRIFHQWUDOLPSRUWDQFHLQWKHZRUNRI3DUOLDPHQW7KH\DUHWKHNH\SOD\HUVLQEXLOGLQJ YRWLQJPDMRULWLHVRQOHJLVODWLRQWKHEXGJHWDQGRWKHULVVXHV7KH\VHWWKHSDUOLDPHQWDU\DJHQGD DQGSOD\WKHGHFLVLYHUROHLQFKRRVLQJ3DUOLDPHQW V3UHVLGHQWDQGRWKHUOHDGLQJRIILFHKROGHUV 8QGHU3DUOLDPHQW VUXOHVPHPEHUVRIDJURXSPXVWVKDUHD SROLWLFDODIILQLW\ DQGPXVWLQFOXGHD PLQLPXPRI0HPEHUVIURPDWOHDVWRQHTXDUWHURIPHPEHUVWDWHV LHFXUUHQWO\DWOHDVWVHYHQ 1RQDOLJQHG0(3VWKRVHZKRGRQRWZLVKRUDUHXQDEOHWRMRLQDJURXSVLWVHSDUDWHO\ $FXOWXUHRIFRPSURPLVH«DQGDEDODQFHRISRZHU 1HYHULQ3DUOLDPHQW VKLVWRU\KDVDVLQJOHJURXSKHOGDQRYHUDOOPDMRULW\RI0HPEHUV6RLQRUGHUWR SDVV(8OHJLVODWLRQDQGDSSURYHWKHEXGJHWWKHJURXSVPXVWIRUJHDZRUNDEOHPDMRULW\WKURXJK QHJRWLDWLRQDQGFRPSURPLVH*LYHDQGWDNHDPRQJWKHJURXSVLVWKXVHVVHQWLDODOWKRXJKWKHODUJHU WKHJURXSWKHPRUHFORXWLWKDV *URXSGLVFLSOLQHLQWKH(3LVOHVVVWULFWWKDQLQVRPHQDWLRQDOSDUOLDPHQWV PHPEHUVRIWKHVDPH JURXSVRPHWLPHVYRWHRQGLIIHUHQW RIWHQQDWLRQDORUUHJLRQDO OLQHV+RZHYHUDVLQQDWLRQDO SDUOLDPHQWVWKHFRPPRQHVWSROLWLFDOGLYLGHVDUHOHIWULJKWLQQDWXUH,WLVRQ(XURSHDQHOHFWLRQGD\ WKDWYRWHUVZLOOGHFLGHWKHEDODQFHRISRZHUEHWZHHQWKHJURXSV 0RVWRIWKHFXUUHQWJURXSVLQWKH(3DUHDIILOLDWHGWRDSDQ(XURSHDQSROLWLFDOSDUW\DQGWKHVH SDUWLHVDUHH[SHFWHGWRSXWIRUZDUGFDQGLGDWHVIRUWKHSRVWRI&RPPLVVLRQ3UHVLGHQW 3.+ 9 7KHZRUNRIDQ0(3 2QFHWKHYRWHVKDYHEHHQFRXQWHGDQG0(3VDUHHOHFWHGZKDWZLOOWKHLUGDLO\URXWLQHEHDQGZKDW LQIOXHQFHFDQWKH\KDYHRQSROLWLFVLQ%UXVVHOVDQG6WUDVERXUJ" 7RDGYDQFHWKHLUYRWHUV LQWHUHVWVWKHPDMRULW\RI0(3VZLOOMRLQD SROLWLFDOJURXS WRPDNHFRPPRQ FDXVHZLWK0(3VIURPRWKHU(8VWDWHVZLWKDVLPLODUSROLWLFDORXWORRN 0(3VZLOODOVRVLWRQDSDUOLDPHQWDU\FRPPLWWHHGHYRWLQJWKHLUWLPHDQGHQHUJ\WRVFUXWLQLVLQJ OHJLVODWLRQ7KHUHDUHVWDQGLQJFRPPLWWHHVLQ3DUOLDPHQWHDFKVSHFLDOLVLQJLQLWVRZQSROLF\ DUHD7KHVHERGLHVDUHWKHOHJLVODWLYHSRZHUKRXVHVRIWKH(3ZKHUHNH\QHJRWLDWLRQVDUHKDQGOHG WKHILHUFHVWSROLWLFDODUJXPHQWVSOD\HGRXWDQGWKHQHFHVVDU\GHDOVRIWHQFXWDOWKRXJKILQDO GHFLVLRQVDUHWDNHQE\WKHIXOO3DUOLDPHQWRI0HPEHUV ,QDGGLWLRQ0(3VFDQEHPHPEHUVRILQWHUSDUOLDPHQWDU\GHOHJDWLRQVZKRVHUROHLVWRQXUWXUH FRQWDFWVZLWKWKHSDUOLDPHQWVRIQRQ(8FRXQWULHV 2IILFHKROGHUVRIWKH3DUOLDPHQW 7KH3UHVLGHQWRI3DUOLDPHQWHOHFWHGIURPDPRQJWKH0HPEHUVIRUDWZRDQGDKDOI\HDUVWLQW UHSUHVHQWVLWWRWKHRXWVLGHZRUOGFKDLUVSOHQDU\VHVVLRQVDQGRYHUVHHVDOORI3DUOLDPHQW VZRUN )RXUWHHQ9LFH3UHVLGHQWVVKDUHWKLVZRUNORDG $ FRPPLWWHHRUGHOHJDWLRQFKDLU JXLGHVWKHSURFHHGLQJVRIWKDWERG\$ FRRUGLQDWRULVWKH OHDGLQJUHSUHVHQWDWLYHRIKLVRUKHUSROLWLFDOJURXSLQDFRPPLWWHHZKLOHD UDSSRUWHXULVDQ0(3 FKRVHQWRSLORWDVSHFLILFUHVROXWLRQRUSLHFHRIOHJLVODWLRQWKURXJK3DUOLDPHQW 3DUOLDPHQW VJRYHUQLQJERGLHV 5HVSRQVLELOLW\IRU3DUOLDPHQW VLQWHUQDOPDQDJHPHQWOLHVZLWKGLIIHUHQWERGLHV SROLWLFDOGHFLVLRQVDUH WDNHQE\WKH&RQIHUHQFHRI3UHVLGHQWVPDGHXSRI3DUOLDPHQW V3UHVLGHQWDQGWKHSROLWLFDOJURXS OHDGHUV ILQDQFLDORUJDQLVDWLRQDODQGDGPLQLVWUDWLYHPDWWHUVDUHGHDOWZLWKE\WKH %XUHDX FRPSRVHGRIWKH3UHVLGHQWDQGWKH9LFH3UHVLGHQWV DGPLQLVWUDWLYHDQGILQDQFLDOFRQFHUQVRI 0HPEHUVDUHWKHUHVSRQVLELOLW\RIWKH &ROOHJHRI4XDHVWRUV DERG\RIILYH0(3VHOHFWHGE\WKH +RXVH /,1.6 2UJDQLVDWLRQDQGZRUNRI3DUOLDPHQW (OHFWRUDOODZ 7KHHOHFWLRQVWRWKH(XURSHDQ3DUOLDPHQWDUHVWLOOWRDODUJHH[WHQWRUJDQLVHGDFFRUGLQJWRQDWLRQDO OHJLVODWLRQVDQGWUDGLWLRQV7KHUHDUHFRPPRQ(8UXOHVZKLFKOD\GRZQWKDWWKHHOHFWLRQVPXVWEH E\GLUHFWXQLYHUVDOVXIIUDJHDVZHOODVIUHHDQGFRQILGHQWLDO0HPEHUVRIWKH(XURSHDQ3DUOLDPHQW PXVWEHHOHFWHGLQWKHPHPEHUVWDWHVRQWKHEDVLVRISURSRUWLRQDOUHSUHVHQWDWLRQ%XWLWLVXSWR HDFKPHPEHUVWDWHZKHWKHULWXVHVDQRSHQRUFORVHGOLVWV\VWHP :KHUHYRWLQJLVEDVHGRQDQRSHQOLVWV\VWHPYRWHUVFDQLQGLFDWHDSUHIHUHQFHIRURQHRUPRUH FDQGLGDWHVRQWKHOLVW7KLVLVGRQHLQ$XVWULD%HOJLXP%XOJDULD'HQPDUN(VWRQLD)LQODQG ,UHODQG,WDO\/DWYLD/LWKXDQLD/X[HPERXUJWKH1HWKHUODQGV3RODQG6ORYDNLD6ORYHQLDDQG 6ZHGHQ:KHQYRWLQJZLWKDFORVHGOLVWV\VWHPWKHSROLWLFDOSDUWLHVHVWDEOLVKWKHRUGHURI FDQGLGDWHVDQGWKHYRWHUVRQO\FDVWWKHLUYRWHIRUDSDUW\7KLVLVGRQHLQ)UDQFH*HUPDQ\*UHHFH +XQJDU\3RUWXJDO5RPDQLD6SDLQDQGWKH8. H[FHSW1RUWKHUQ,UHODQG 0HDQZKLOHLQ,UHODQGDQG 0DOWDDVZHOODVLQ1RUWKHUQ,UHODQGWKH6LQJOH7UDQVIHUDEOH9RWHV\VWHPLVXVHG (DFKPHPEHUVWDWHPD\HVWDEOLVKFRQVWLWXHQFLHVIRUHOHFWLRQVWRWKH(XURSHDQ3DUOLDPHQWRU VXEGLYLGHLWVHOHFWRUDODUHDLQDGLIIHUHQWPDQQHU0RVWPHPEHUVWDWHVKDYHFKRVHQWRFRQVLGHUWKH ZKROHFRXQWU\DVRQHFRQVWLWXHQF\%HOJLXP)UDQFH,UHODQGDQGWKH8.KDYHVHYHUDO 3.+ 10 FRQVWLWXHQFLHVRUHOHFWRUDODUHDV,Q*HUPDQ\,WDO\DQG3RODQGYRWHVDUHFDVWLQVHSDUDWH FRQVWLWXHQFLHVWRREXWWKHHOHFWLRQUHVXOWVDUHGHWHUPLQHGDWQDWLRQDOOHYHO 7KHHOHFWLRQSHULRGLVGHWHUPLQHGDW(8OHYHOEXWWKHH[DFWSROOLQJGDWHDQGRSHQLQJKRXUVIRU SROOLQJVWDWLRQVYDU\DFFRUGLQJWRWKHQDWLRQDOHOHFWRUDOODZV 9RWLQJLVFRPSXOVRU\LQ%HOJLXP&\SUXV*UHHFHDQG/X[HPERXUJ 7KHUHDUHGLIIHUHQFHVDPRQJPHPEHUVWDWHVDVWRWKHPLQLPXPDJHIRUYRWLQJDQGWKHPLQLPXP DJHIRUVWDQGLQJIRUHOHFWLRQ,QVHYHUDOPHPEHUVWDWHV\RXFDQERWKYRWHDQGVWDQGIRUHOHFWLRQDW WKHDJHRI 'HQPDUN)LQODQG*HUPDQ\/X[HPERXUJ1HWKHUODQGV3RUWXJDO6ORYHQLDDQG 6ZHGHQ %XWLQ$XVWULD\RXFDQYRWHDWWKHDJHRIDQGVWDQGIRUHOHFWLRQDWZKLOHLQ,WDO\\RX PXVWEHDQGUHVSHFWLYHO\ ,QVRPHFRXQWULHVVXFKDV)UDQFHDQGWKH8.SUHUHJLVWUDWLRQRQDQHOHFWRUDOUROOLVUHTXLUHG,Q PDQ\RWKHUFRXQWULHVWKLVLVGRQHDXWRPDWLFDOO\ (8FLWL]HQVOLYLQJLQD(8FRXQWU\RWKHUWKDQWKHLUFRXQWU\RIRULJLQDUHHQWLWOHGWRYRWHDQGVWDQGLQ (XURSHDQHOHFWLRQVLQWKHLUFRXQWU\RIUHVLGHQFHEXWWKHQDWLRQDOHOHFWRUDOODZPD\OD\GRZQVSHFLILF SURFHGXUHVRQKRZWRGRWKLV8VXDOO\WKH\DUHDOVRHQWLWOHGWRFKRRVHLQVWHDGWRYRWHLQWKHLU FRXQWU\RIRULJLQ IRUH[DPSOHE\SRVWRUDWWKHHPEDVV\ EXWWKLVDOVRGHSHQGVRQWKHQDWLRQDO HOHFWRUDOODZ&RPPRQZHDOWKFLWL]HQVIRUH[DPSOH&DQDGLDQVDQG$XVWUDOLDQVZKRVHQDPHV DSSHDURQWKHHOHFWRUDOUROOLQWKH8.DUHDOVRHQWLWOHGWRYRWH7KHUHDUHVHYHUDOH[DPSOHVRI HOHFWHG0HPEHUVLQWKHFXUUHQW3DUOLDPHQWZKRKDYHVWRRGIRUHOHFWLRQLQDFRXQWU\RWKHUWKDQWKHLU FRXQWU\RIRULJLQ $FFRUGLQJWR(8UHJXODWLRQVWKHUHDUHVHYHUDOSRVLWLRQVLQFRPSDWLEOHZLWKEHLQJD0HPEHURIWKH (XURSHDQ3DUOLDPHQW$Q0(3FDQQRWEHDPHPEHURIDQDWLRQDOJRYHUQPHQWRUQDWLRQDO SDUOLDPHQWQRUDQDFWLYHRIILFLDORIWKH(XURSHDQLQVWLWXWLRQV6RPHFRXQWULHVOD\GRZQIXUWKHU LQFRPSDWLELOLWLHV 7KH(XURSHDQ3DUOLDPHQW HOHFWRUDOSURFHGXUHV (3IDFWVKHHW KWWS ZZZHXURSDUOHXURSDHXIWXSGIHQ)78BSGI 6RPHIDFWVRQSUHYLRXV(XURSHDQHOHFWLRQV 6RPHIDFWVRQSUHYLRXV(XURSHDQHOHFWLRQV 7KHILUVWGLUHFWHOHFWLRQVWRWKH(XURSHDQ3DUOLDPHQWZHUHKHOGLQ 3UHYLRXVO\IURP WR 0(3VZHUHDSSRLQWHGE\WKHQDWLRQDOSDUOLDPHQWVRIWKHPHPEHUVWDWHVZLWKDOO0HPEHUV KROGLQJDGXDOPDQGDWH 7KH'HFLVLRQDQG$FWRQ(XURSHDQHOHFWLRQVE\GLUHFWXQLYHUVDOVXIIUDJHZHUHVLJQHGLQ%UXVVHOV RQ6HSWHPEHU $IWHUUDWLILFDWLRQE\DOOWKHPHPEHUVWDWHVWKHILUVWHOHFWLRQVWRRNSODFHRQ DQG-XQH DQG0HPEHUVZHUHHOHFWHG6LQFHWKHQDQRWKHUVL[HOHFWLRQVKDYHWDNHQ SODFH (OHFWLRQVDUHDOZD\VKHOGLQQHZPHPEHUVWDWHVZKHQWKH\MRLQWKH(8WRDOORZWKHPWRHOHFWWKHLU RZQUHSUHVHQWDWLYHVWRWKH(XURSHDQ3DUOLDPHQWHYHQLQPLGWHUP7KLVKDSSHQHGZLWK*UHHFHLQ 3RUWXJDODQG6SDLQLQ 6ZHGHQLQ $XVWULDDQG)LQODQGLQ DQG%XOJDULDDQG 5RPDQLDLQ(OHFWLRQVZHUHKHOGLQ&URDWLDLQ$SULOWRHQDEOHWKDWFRXQWU\ V0(3VWRWDNH WKHLUVHDWVZKHQLWMRLQHGWKH(8RQ-XO\ 3DVWHOHFWLRQVDQGWXUQRXWILJXUHV 7KHWXUQRXWLQ(XURSHDQHOHFWLRQVVLQFH KDVYDULHGVLJQLILFDQWO\IURPRQHPHPEHUVWDWHWR DQRWKHU:KLOHORZLQPDQ\FDVHVWKHILJXUHVDUHQRWGLVVLPLODUWRWKRVHIRUORFDOHOHFWLRQVLQPDQ\ 3.+ 11 (XURSHDQFRXQWULHV7KHUHKDVEHHQDGRZQZDUGWUHQGRYHUWKH\HDUVEXWWKLVLVLQOLQHZLWKD JHQHUDOGHFOLQHLQYRWLQJILJXUHVWKURXJKRXWWKHZHVWHUQGHPRFUDFLHVLQUHFHQWGHFDGHV /,1.6 3DUOLDPHQWLQWKHSDVW 5HVXOWVRIWKH HOHFWLRQV 7XUQRXWILJXUHV 3.+ 12 ! ! ! ! ' ! ! ! ! ! ! ! ! ! ! ! +,-./*01'2*./3*D8'20-6E! ! ! ! "#$!%,,!.2!%&'()$12!=$+0'$Q'.>#0!)(-.0.=*-!7*/.-B?!R0!20'.5$2!7('!*!%&'()$!(7!5*-&$2!=-(2$!0(!0#$! )$()-$!*+8!F*2$8!(+!8$/(='*=BS!0'*+2)*'$+=B!*+8!'$2)(+2.F.-.0BS!*2!6$--!*2!)'(2)$'.0B!0#'(&>#! 0#$!)'(/(0.(+!(7!*!2(=.*-!/*'T$0!$=(+(/B?! ! D2!0#$!)(-.0.=*-!#$.'2!(7!0#$!%N12!7(&+8.+>!7*0#$'2S!0#$!%,,!.+=-&8$2!U$20!H'(&)!.+!0#$!%&'()$*+!,*'-.*/$+0!*+8!/(20!#$*82!(7!20*0$!*+8!>(5$'+/$+0!(7!*+B! )(-.0.=*-!7*/.-B!.+!0#$!%&'()$*+!I(&+=.-S!*2!6$--!*2!/$/F$'2!.+!0#$!I(//.22.(+?! ! 4+!XQU!K*'=#!.+!G&F-.+S!0#$!%,,!6.--!-*&+=#!.02!%NQ6.8$!=*/)*.>+!7('!0#$!9:; 13 WHY VOTE FOR THE EUROPEAN PEOPLE’S PARTY? HERE ARE OUR COMMITMENTS WE NEED TO LEARN TO BE PROUD OF EUROPE AGAIN, FOR EUROPE HAS PROVEN TO THE WORLD THAT EUROPEANS ARE CAPABLE OF GREAT THINGS WHEN THEY ARE UNITED. 02 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 03 WHERE DO The European People’s Party is the WE COME political family that has shaped Europe. Members of our political FROM, AND family have been the founding In 2011 and 2012, we kept the WHERE ARE fathers of this great unifying Euro area together and laid the project, contributing to the fall foundation for recovery. Now we are WE GOING? of Communism and welcoming setting the agenda for economic new countries. Over time, the EPP reform, growth-friendly budget has become Europe’s largest consolidation and job creation political family, uniting parties in the Member States. of the centre-right across the continent. Finding solutions to crises means making tough choices. During the We believe that the European crisis the EPP proved itself as the Union can solve the economic party of responsible government. crisis that has a!ected all levels While others talked, we acted. of society. The European Union Our policies stemmed the crisis. is the solution to the crisis, not The spend-now-and-pay-later the cause. We want the European policies of our competitors caused economy to create new growth the crisis in the first place, and OUR COMMITMENT OUR COMMITMENT and jobs. Young people – like increase the risk of another crisis all European citizens - must be down the line. EPP believes that the EPP will reform financial able to look to their future with euro is a reliable currency markets so that all banks confidence again. We want to live We want people to live in a safe that assures political in the EU follow the same in freedom and dignity. We do and stable world, in freedom and stability and makes rules, and, globally, will not want to incur debt, which our with dignity. To achieve this, we us more competitive seek a better regulatory children will be forced to pay back. have to make the right choices internationally. framework for financial now, and renew our sense of markets. Today, and every day, we work solidarity. We want all Europeans to lead Europe out of the crisis. to take pride in where we have In 2009 and 2010, EPP-led come from, and where we are governments reacted quickly going. Europe has risen from the and decisively, pulling Europe ashes many times before, and will back from the brink of disaster. do so again. 04 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 05 CREATING Proposal A BETTER 01 EUROPE The people of the European Union FOR ALL value individual freedoms, and democratic rights. Europeans need CITIZENS to work together to build on these shared values. We already travel, work, buy and sell across borders. We believe working together strengthens us. Those political parties that call for separation and division will weaken their countries, economies, and relations with others. We can only tackle many challenges together and not in isolation. Either we become stronger together, or weaker apart. However, we do not OUR COMMITMENT OUR COMMITMENT want a centralised Europe that deals with every detail of people’s EPP supports a European EPP believes in building lives. Union that tackles the big a more open, more issues together, leaving responsive, more We want Europe to be bigger on the smaller issues to the democratic Europe. big things and smaller on small capable responsibility things. We want to focus on what of individual countries. really needs to be done better, together. The European Union as a community of values must defend our common values and interests in the world, whilst respecting the diversity and di!erent traditions of Member States. 06 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 07 FROM Proposal REFORM 02 TO GROWTH Our combined strength is in the more than 500 million people who make up the largest economy in the world – our EU. Our potential to be a global leader in new indus- tries is vast. To remain a strong and competitive player globally, create jobs and ensure continued wealth, reforms are necessary. Sustainable and targeted investment is the key. Creating the right conditions for new and sustainable growth and jobs is our primary political OUR COMMITMENT OUR COMMITMENT objective for the next five years. EPP will create conditions EPP invests in education, We need structural reforms, so that that favour small and research and technology, Europe attracts the private invest- medium-sized businesses, leading to innovation, ment that creates growth and jobs. family firms, start-ups new ideas, a competitive Socialist parties choose the wrong and entrepreneurs, economy rooted in approach to economic reforms. including R&D funding, knowledge and new They believe growth comes private investment, and digital services. from irresponsible spending, more accessible lending. or redistributing other people’s money. Our policies create healthy economic structures which attract private investment, create growth and jobs. 08 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 09 BUILDING Proposal A SOCIAL 03 MARKET ECONOMY TO COMBINE FREEDOM The cornerstone of EPP policy is the idea of the Social Market AND Economy. This precept aims to SOLIDARITY balance the principles of freedom and solidarity. We understand that the advantages of a free market must serve the common good, so that social cohesion is achieved. Simply put, the economy should serve the people, and not the other way around! We strive for sustainable OUR COMMITMENT OUR COMMITMENT growth based on a competitive and innovative economy, while EPP will balance the EPP will champion respecting the environment. We principles of freedom an EU energy market, are determined to combat climate and solidarity. and invest in low carbon change through more e"cient technologies. use of energy and investment in renewable energy while preserving Europe’s industrial base through a!ordable energy prices. It is our responsibility to leave our world safer and cleaner for future generations, and it stimulates innovation and a need for skills in these sectors. 10 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 11 MOVEMENT Proposal CONTROLLING Proposal OF 04 IMMIGRATION 05 EUROPEANS INTO EUROPE WITHIN TO ENSURE EUROPE INTERNAL SECURITY While having abolished internal borders, Schengen states have also tightened controls at their common Free movement of people within external borders to protect the the European Union is one of our security of those living and travel- greatest achievements together, ling within the Union. EU Member and we are committed to ensuring States need to cooperate closely it remains so. Why? So that any on border management to ensure European can travel, work, and internal security is maintained. OUR COMMITMENT live in any other country in the EU, OUR COMMITMENT Our common border agency while retaining the same rights as Frontex must be reinforced. EPP sees mobility as an in their own country. EPP demands greater absolute right that bene- cooperation between The EU must e!ectively coope- fits people, businesses Pan-European movement of EU countries on border rate with third countries’ border and the economy: qualified people helps businesses management, to show security authorities to prevent Freeing our citizens to recruit those they seek, and in solidarity with countries crime from migrating too. At the to work at home and some countries is the only solution that are on the front line same time, victims of political and abroad. to skills and labour shortages. of migration flows. religious persecution need genuine However, we are against social protection. Integration policies for fraud - social benefits for EU migrants have to be developed citizens should only be available and strengthened. Integration is a if they have worked in the country two-way street which involves both where they live. rights and responsibilities. 12 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 13 FIGHTING Proposal ENSURING Proposal ORGANISED 06 DATA 07 CRIME PROTECTION AS A HUMAN RIGHT OUR COMMITMENT The fight against organised crime, OUR COMMITMENT especially corruption and money EPP will lead the fight laundering, is a top priority for us. EPP vows to reinforce We believe that privacy is a against terrorism and Organised crime undermines citizens’ privacy rights, fundamental, inalienable human crime. the rule of law, fundamental rights, protecting personal right. It was the EPP that drove good governance and deprives data. the reform of data protection rules. governments of important These rules reinforce privacy revenues. for citizens as well as increase consumer trust online. We believe that transparent politics is vital for the future of democracy. This also helps to establish a Single We are committed to improving Market in digital services, which transparency and strengthening is central to the creation of new the rule of law. digital jobs. 14 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 15 PROMOTING Proposal BEING MORE Proposal PEACE AND 08 PRUDENT 09 STABILITY ABOUT EU IN A ENLARGEMENT GLOBALISED WORLD Europe has, more than any other continent, shaped the world in which we live. But in the past decades, other players and power centres around the world have emerged. Nation states acting alone will not be capable to defend our values and interests. OUR COMMITMENT OUR COMMITMENT The enlargement of the European In a time of increasing global Union is one of its success stories, EPP will boost Europe’s concerns such as international EPP favours judicious because we can share the benefits Foreign, Security and terrorism, weapons proliferation, enlargement, while of freedom, democracy, peace, Defence capacities – failed states, climate change, retaining the identity stability and the rule of law enhancing its ability natural disasters and mass of the EU, and taking the throughout our continent. to act in the world. migration, the EU must rea"rm EU’s capacity to integrate its values in the eyes of the world into consideration. For the future, though, it has and do everything in its power to be clear that in order to become to defend and promote them. a member of the European Union Therefore, the EU must strengthen not only the fulfillment of political and increase the e"ciency of its and economic criteria must be foreign policy. We gain strength safeguarded but the EU’s capacity through united action. to act must remain intact. 16 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 17 SPREADING Proposal BUILDING Proposal DEMOCRACY 10 A TRUSTFUL 11 AND THE RULE TRANS- OF LAW ATLANTIC IN OUR PARTNERSHIP IMMEDIATE NEIGHBOUR- HOOD Our immediate neighbourhood is a source of new opportunities, OUR COMMITMENT as well as challenges and potential OUR COMMITMENT The EU must maintain and develop threats. A much longer-term a strong transatlantic partnership, EPP will work to approach must be developed EPP welcomes the trade combining a free and fair market create a prosperous, for the relations with our eastern negotiations with the US, built on common values and democratic and stable neighbours. The EU must remain as long as the agreement mutual trust. Together, the EU neighbourhood. committed to supporting fragile protects Europe’s high and the US can take the lead in democracies in Eastern Europe. standards, and that developing strategies to address important elements of global threats and challenges. For the Southern Mediterranean our European identity countries, the EU should develop a are safeguarded. A transatlantic free market will vision and propose new strategies. contribute to trade revenues and Only the promise of shared increased growth, creating more prosperity can gain support of jobs and prosperity for European the wider public in the region. citizens. 18 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS I 19 MAKING OUR Proposal DEVELOPMENT 12 POLICY MORE EFFECTIVE ALL OUR COMMITMENTS OUR COMMITMENT EPP wants a development policy that is effective, The EU should reform its accountable, aimed development policy to improve at reducing poverty, e!ectiveness, accountability and and is based on the sustainability. This revised policy principles of the Social must be based on the principles Market Economy. of the Social Market Economy. Human rights, the fight against poverty, and providing education must be central factors in our development policy. 20 I EPP MANIFESTO / 22-25 MAY 2014 ELECTIONS MOVEMENT OF EUROPEANS ALL OUR WITHIN EUROPE • EPP sees mobility as an absolute BEING MORE PRUDENT COMMITMENTS right that benefits people, ABOUT EU ENLARGEMENT CREATING A BETTER businesses and the economy: • EPP favours judicious EUROPE FOR ALL CITIZENS Freeing our citizens to work enlargement, while retaining EPP supports a European Union • at home and abroad. the identity of the EU, and taking that tackles the big issues together, the EU’s capacity to integrate leaving the smaller issues to the CONTROLLING into consideration. capable responsibility of individual IMMIGRATION INTO countries. EUROPE TO ENSURE • EPP believes in building a more SPREADING DEMOCRACY open, more responsive, more INTERNAL SECURITY AND THE RULE OF LAW EPP demands greater cooperation democratic Europe. • IN OUR IMMEDIATE between EU countries on border NEIGHBOURHOOD management, to show solidarity FROM REFORM TO GROWTH • EPP will work to create a with countries that are on the prosperous, democratic and EPP will create conditions that • front line of migration flows. stable neighbourhood. favour small and medium-sized businesses, family firms, start-ups and entrepreneurs, including FIGHTING ORGANISED BUILDING A TRUSTFUL R&D funding, private investment, CRIME TRANSATLANTIC EPP will lead the fight against and more accessible lending. • PARTNERSHIP terrorism and crime. • EPP invests in education, research • EPP welcomes the trade negotia- and technology, leading to in- tions with the US, as long as the novation, new ideas, a competitive ENSURING DATA PROTEC- agreement protects Europe’s high WHERE DO WE COME economy rooted in knowledge TION AS A HUMAN RIGHT standards, and that important FROM, AND WHERE ARE and new digital services. • EPP vows to reinforce citizens’ elements of our European identity WE GOING? privacy rights, protecting are safeguarded. personal data. • EPP believes that the euro is BUILDING A SOCIAL a reliable currency that assures MARKET ECONOMY MAKING OUR political stability and makes us TO COMBINE FREEDOM PROMOTING PEACE DEVELOPMENT POLICY more competitive internationally. AND SOLIDARITY AND STABILITY IN A MORE EFFECTIVE • EPP will reform financial markets • EPP will balance the principles GLOBALISED WORLD • EPP wants a development policy so that all banks in the EU follow of freedom and solidarity. • EPP will boost Europe’s Foreign, that is e!ective, accountable, the same rules, and, globally, • EPP will champion an EU energy Security and Defence capacities – aimed at reducing poverty, and will seek a better regulatory market, and invest in low carbon enhancing its ability to act in the is based on the principles of the framework for financial markets. technologies. world. Social Market Economy. Produced with the financial support of the European Parliament. Editors : C. Kremer, K. Sasmatzoglou - EPP: Rue du Commerce 20, Brussels, B-1000. visit juncker.epp.eu JEAN-CLAUDE #withJuncker !"## ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! "##!$%&'()!#*(+*,--.!/012!3!/014! ! ! ! !! ! 56789:;<7596! 7=.!>,?!>.!>,)&!&(!@'A.! #$%&'()%'%*+,-.)%/0)0+$%/1+%20+13$%'(4%,)5%6,),7$(58%#$%'+$%4$)$+9,($4%)1%:$'4%20+13$%10)% 1/%).$%6+,5,58%#$%&'()%10+%$61(19,$5%)1%+$)0+(%)1%;1*<+,6.%-+1&).8%=10(-%3$13:$%5.10:4%:11>% )1% ).$,+% /0)0+$% &,).% 61(/,4$(6$8% ?::% 1/% 10+% 3$13:$% 905)% $(;1@% ).$% 3$+9'($()% 5$(5$% 1/% 5$60+,)@%20+13$%,5%'*:$%)1%3+1A,4$B%,(%'::%'53$6)5%1/%).$,+%:,A$58 #$%&'()%)1%:,A$%,(%/+$$419% '(4%4,-(,)@8%#$%41%(1)%&'()%)1%,(60+%4$*)%&.,6.%10+%6.,:4+$(%&,::%*$%/1+6$4%)1%3'@%*'6>8%C.')% ,5%&.@%&$%6'(%1(:@%53$(4%91($@%'(4%05$%).$%+$510+6$5%&$%.'A$8!% KƵƌƉůĂŶĞƚ͕ŽƵƌĨƌĞĞĚŽŵ͕ŽƵƌƌĞƐŽƵƌĐĞƐ͗/ĨǁĞǁĂŶƚƚŚĞŵƚŽůĂƐƚ͕ǁĞŚĂǀĞƚŽƚƌĞĂƚƚŚĞŵǁŝƚŚ ĐĂƌĞ͘/ĨǁĞǁĂŶƚŽƵƌĐŚŝůĚƌĞŶĂŶĚĨƵƚƵƌĞŐĞŶĞƌĂƚŝŽŶƐƚŽůŝǀĞŝŶĂŚĞĂůƚŚLJǁŽƌůĚ͕ŝŶĨƌĞĞĚŽŵ ĂŶĚŚĂƉƉŝŶĞƐƐ͕ǁĞŚĂǀĞƚŽŵĂŬĞƚŚĞƌŝŐŚƚĚĞĐŝƐŝŽŶƐƚŽĚĂLJ͘tĞŚĂǀĞƚŽƉůĂĐĞĂŶĞǁĞŵƉŚĂƐŝƐ ŽŶ ƐŽůŝĚĂƌŝƚLJ͘ tĞ ŶĞĞĚ ďĂůĂŶĐĞĚ ƉƵďůŝĐ ĨŝŶĂŶĐĞƐ͕ ŵŽĚĞƌŶŝƐĞ ŽƵƌ ĞĐŽŶŽŵŝĞƐ͕ ŝŶǀĞƐƚ ŝŶ ŬŶŽǁůĞĚŐĞ ĂŶĚ ŝŶŶŽǀĂƚŝŽŶ ĂŶĚ ƐƚƌĞŶŐƚŚĞŶ ƵƌŽƉĞĂŶ ĞĐŽŶŽŵŝĐ ŐŽǀĞƌŶĂŶĐĞ͘ ^ŽŵĞ ŽĨ ƚŚŝƐ ĚĞƉĞŶĚƐŽŶƵƐĂƐŝŶĚŝǀŝĚƵĂůƐ͕ďƵƚŝƚĂůƐŽĚĞƉĞŶĚƐŽŶƚŚĞǁĂLJǁĞŽƌŐĂŶŝƐĞŽƵƌƐĞůǀĞƐ͗ŝŶŽƵƌ ĐŽŵŵƵŶŝƚŝĞƐ͕ƌĞŐŝŽŶƐ͕ŶĂƚŝŽŶƐƚĂƚĞƐĂŶĚŝŶƚŚĞ ƵƌŽƉĞĂŶhŶŝŽŶ͘DĂŶLJŶĂƚŝŽŶĂůĂŶĚƌĞŐŝŽŶĂů ůĂǁƐĚĞƌŝǀĞĨƌŽŵ ƵƌŽƉĞĂŶůĞŐŝƐůĂƚŝŽŶ͘KƵƌĚĂŝůLJůŝǀĞƐĂŶĚŽƵƌĨƵƚƵƌĞƐĂƌĞŝŶĨůƵĞŶĐĞĚďLJƚŚĞ ĚĞĐŝƐŝŽŶƐƚĂŬĞŶŝŶƚŚĞ ƵƌŽƉĞĂŶWĂƌůŝĂŵĞŶƚ͘% dŚĞŽƵƚĐŽŵĞŽĨƚŚĞŶĞdžƚ ƵƌŽƉĞĂŶĞůĞĐƚŝŽŶƐŝŶDĂLJƚŚŝƐLJĞĂƌǁŝůůĚĞƚĞƌŵŝŶĞƚŚĞĚŝƌĞĐƚŝŽŶŽĨ hƉŽůŝĐLJŽŶĂƌĂŶŐĞŽĨŝŵƉŽƌƚĂŶƚŝƐƐƵĞƐ͕ǁŚŝĐŚŝŶƚƵƌŶǁŝůůŚĂǀĞĂƐŝŐŶŝĨŝĐĂŶƚŝŵƉĂĐƚŽŶƚŚĞ ůŝǀĞƐŽĨŽǀĞƌϱϬϬŵŝůůŝŽŶ ƵƌŽƉĞĂŶĐŝƚŝnjĞŶƐ͘% C.$5$%$:$6),1(5%905)%*$%A,$&$4%'5%'(%1331+)0(,)@%/1+%'%)+0:@%20+13$'(%4$*')$%1(%20+13$'(% ,550$5B%'(%1331+)0(,)@%)1%61(5,4$+%10+%:1(-%)$+9%/0)0+$8%C.$%5066$55/0:%20+13$'(%3+1;$6)%.'5% +$'6.$4%'%6+,),6':%;0(6)0+$8%C.$%20+13$'(%D(,1(%,5%).$%51:0),1(%)1%).$%6+,5,5B%(1)%).$%6'05$8% C.')%,5%&.@%,)%,5%51%,931+)'()%)1%9'>$%).$%+,-.)%6.1,6$%,(%).$%"E!F%20+13$'(%$:$6),1(58%C.$% ƵƌŽƉĞĂŶWĞŽƉůĞ͛ƐWĂƌƚLJǁŝůůŵĂŬĞLJŽƵƌǀŽƚĞĐŽƵŶƚ͘% <(--B)'&?!(C!A,@B.D! C.$% 20+13$'(% D(,1(% ,5% '% 61990(,)@% 1/% A':0$5% '(4% '% 61990(,)@% 1/% :'&8% G)% ,5% /10(4$4% 1(% ƵƌŽƉĞ͛ƐƌŝĐŚĐƵůƚƵƌĞĂŶĚůŽŶŐŚŝƐƚŽƌLJ%&.,6.%.'A$%.$:3$4%10+%31:,),6':%/'9,:@%)1%4$A$:13%,)5% 6$()+':%A':0$5%'(4%3+,(6,3:$5H%/+$$419B%+$531(5,*,:,)@B%;05),6$B%5$60+,)@B%+$53$6)%/1+%).$%4,-(,)@% "! ! 1/% .09'(% :,/$% ,(% $A$+@% 5)'-$% 1/% ,)5% $J,5)$(6$B% 51:,4'+,)@% &.,6.% /1+95% ).$% *'5,5% 1/% 516,':% 61.$5,1(B% 60:)0+':% '(4% :,(-0,5),6% 4,A$+5,)@% '(4% 50*5,4,'+,)@B% &.,6.% $(50+$5% ).')% 31:,),6':% 4$6,5,1(5% '+$%)'>$(% '5% 6:15$:@% '5% 3155,*:$%)1% ).$% 6,),7$(58% % #$% 5)'(4%/1+% $K0':,)@% *$)&$$(% &19$(%'(4%9$(B%/'9,:@B%).$%5$3'+'),1(%1/%31&$+5B%4$916+'6@%'(4%).$%+0:$%1/%:'&8%C.$%2LL% L:')/1+9B%'413)$4%,(%"E!"B%+$/:$6)5%10+%A':0$5B%3+,1+,),$5%'(4%9',(%31:,6,$58% C.$% /+$$419% 1/% +$:,-,1(B% ,(6:04,(-% ).$% +,-.)% )1% 61(A$+)% 1+% )1% .1:4% (1% +$:,-,1(B% ,5% '% /0(4'9$()':%.09'(%+,-.)8%#$%+$61-(,5$%).$%M+$61 7=.!"B*(E.,)!;)'()!>.!)..F! C.$% /,('(6,':% '(4% $61(19,6% 6+,5,5% .'5% '//$6)$4% '::% 20+13$'(58% G)% &'5% 6'05$4% *@% '% 4,A$+5$% +'(-$% 1/% /'6)1+5B% ,(6:04,(-% $J6$55,A$% 30*:,6% '(4% 3+,A')$% 4$*)B% '% :'6>% 1/% 6193$),),A$($55% ,(% 6$+)',(%Q$9*$+%R)')$5B%/:'&$4%+$-0:'),1(%1/%/,('(6,':%9'+>$)5%'(4%,(50//,6,$()%,()$-+'),1(%,(% ).$% 20+1% '+$'8% S1+% 9'(@% 6,),7$(5B% ).,5% .'5% :$4% )1% A$+@% 4,//,60:)% 6.'::$(-$5B! &.,6.% &$% 905)% 5)+,A$%)1%1A$+619$%)1-$).$+8%% dŚĞ ƵƌŽƉĞĂŶWĞŽƉůĞ͛ƐWĂƌƚLJŚĂƐĂůǁĂLJƐďĞĞŶƚŚĞĚƌŝǀŝŶŐĨŽƌĐĞŽĨ ƵƌŽƉĞĂŶŝŶƚĞŐƌĂƚŝŽŶ͘/ƚ .'5%61()+,*0)$4%)1%).$%/'::%1/%P1990(,59B%&$:619$4%($&%Q$9*$+%R)')$5%'(4!6.'93,1($4% '(%$A$+%6:15$+%0(,1(͘KǀĞƌƚŝŵĞ͕ŝƚŚĂƐďĞĐŽŵĞ ƵƌŽƉĞ͛ƐůĂƌŐĞƐƚƉŽůŝƚŝĐĂůĨĂŵŝůLJĂŶĚ)14'@B%,)5% 9$9*$+%3'+),$5%'+$%,(%-1A$+(9$()%,(%'%9';1+,)@%1/%2D%610()+,$58%%G(%).,5%6+,5,5B%).$%2LL%,5%).$% 3'+)@%1/%+$531(5,*:$%-1A$+(9$()8 T).$+5%53$'>%1/%516,':%;05),6$%'(4%+,-.)5B%*0)%5'@%(1).,(-%1/%.1&%).$5$%6'(%*$%'4A'(6$4%'(4% 5'/$-0'+4$48%#$%'+$%).$%1($5%).')%5)'(4%/1+%-$(0,($B%50*5)'(),':%'(4%:1(-%:'5),(-%-+1&).% /'6,:,)')$4%*@%'%6:$'+%A,5,1(%'(4%5)+')$-@%/1+%).$%/0)0+$B%5)$3<*@<5)$3%+$/1+95%1/%).$%$61(19@% &.,:$% 3+$5$+A,(-% 516,':% 61.$5,1(B% &.,6.% $(610+'-$% *05,($55$5% )1% ,(A$5)% '(4% 3$13:$% )1% *$% '*:$%)1%$(;1@%'(4%)1%5)04@B%&1+>%'(4!61(509$%*'5$4%1(%'%.,-.$+B%.$':).@%'(4%505)',('*:$% 5)'(4'+4%1/%:,A,(-8%#$%13315$%).$%5.1+)<5,-.)$4%'6),1(5%3+1315$4%*@%).$%516,':,5)5B%506.%'5% +$6>:$55:@%3+,(),(-%91($@8%#$%5$$>%:1(-<)$+9B%505)',('*:$%'(5&$+5%'(4%&$%+$;$6)%).$%/':5$% ͚ƐŽůƵƚŝŽŶƐ͛1//$+$4%*@%).$%3130:,5)58%% G(%"EEU%'(4%"E!EB%2LL%3'+),$5%,(%-1A$+(9$()5%+$'6)$4%K0,6>:@%'(4%4$6,5,A$:@%,(%1+4$+%)1%30::% 20+13$%*'6>%/+19%).$%*+,(>%1/%4,5'5)$+8%G(%"E!!%'(4%"E!"B%&$%>$3)%).$%20+1%'+$'%)1-$).$+8% #$%.'A$%5$)%).$%'-$(4'%/1+%$61(19,6%+$/1+9%'(4%-+1&). G)% ,5% ),9$% )1% +$<'//,+9% ).$% A':0$5% 1/% ).$% R16,':% Q'+>$)% 261(19@8% G)% +$K0,+$5% *':'(6,(-% ).$% 3+,(6,3:$5%1/%/+$$419%'(4%51:,4'+,)@B%':1(-%&,).%).$%($$4%/1+%/+$$%9'+>$)5%'(4%).$%61991(% -1148%%% "B*(E.!,)F!'&D!%'&'G.)D! S,+5)% '(4% /1+$915)B% ,(% 1+4$+% )1% *$))$+% 5$+A$% ).$% ,()$+$5)5% 1/% '::% 20+13$'(5B% &$% ($$4% '% 5)+1(-$+% 20+13$'(% D(,1(8% R.'+,(-% ).$% 5'9$% 60++$(6@% ,(% ).$% $0+1% '+$'% +$K0,+$5% 6:15$+% 611+4,('),1(% 1(% ('),1(':% *04-$)'+@% '(4% $61(19,6% 5)+')$-,$58% ?% 5)+1(-% 2D% ,5% ':51% >$@% )1% 6+$'),(-% '% 5066$55/0:% 5$60+,)@% 31:,6@B% 3+1)$6),(-% 10+% 6,),7$(5% ')% .19$% '(4% 10+% ,()$+$5)5% '+10(4%).$% &1+:48%?*1A$% '::B% '% 5)+1(-%2D% ,5%).$% *$5)% '(5&$+% )1% ).$% 6.'::$(-$5%1/%).$% "!5)% 6$()0+@8%C.$+$/1+$B%).$%2D%905)%*$619$%'%-$(0,($%L1:,),6':%D(,1(8%% C.$%20+13$'(%D(,1(%,(A1:A$5%'::%1/%058%#$%($$4%)1%3+$5$+A$%'(4%*$%3+104%1/%10+%4,A$+5,)@B% )+'4,),1(5%'(4%60:)0+':%.$+,)'-$8%N$53$6)%/1+%4,A$+5,)@%.'5%':&'@5%*$$(%'(%$55$(),':%$:$9$()% 1/% ƵƌŽƉĞ͛ƐƐƵĐĐĞƐƐ͘EŽƚĞǀĞƌLJƉŽůŝƚŝĐĂůƉƌŽďůĞŵƐŚŽƵůĚďĞƐŽůǀĞĚ1(%).$%20+13$'(%:$A$:8%#$% ($$4% :$55% +$-0:'),1(B% '(4% ,(5)$'4% '% ($&% $93.'5,5% 1(% ,93:$9$()'),1(% '(4% 61()+1:8% L'+:,'9$()5%'(4%-1A$+(9$()5%,(%10+%+$-,1(5%'(4%('),1(5%+$9',(%A,)':%)1%10+%/0)0+$8%G/%91+$% +$531(5,*,:,)@%,5%)1%*$%5.,/)$4%/+19%).$%Q$9*$+%R)')$5%)1%).$%2D%,(%519$%/,$:45B%).$%2D%':51% ($$45% )1% *$619$% 91+$% )+'(53'+$()% '(4% 4$916+'),68% C.$+$% ,5% (1% /0)0+$% /1+% ).$% D(,1(% ǁŝƚŚŽƵƚƚŚĞŝŶǀŽůǀĞŵĞŶƚŽĨŝƚƐƉĞŽƉůĞ͘dŚĞhŶŝŽŶŝƚƐĞůĨŚĂƐƚŽďĞǁŝƚŚŝŶƚŚĞĐŝƚŝnjĞŶ͛ƐƌĞĂĐŚB% 6193+$.$(5,*:$% '(4% 5,93:$8% V'),1(':% 3'+:,'9$()5% 905)% *$619$% 91+$% 3+1<'6),A$% '(4% ,(A1:A$4% ,(% 20+13$'(%4$6,5,1(<9'>,(-% &,).,(% ).$% /+'9$&1+>%1/%('),1(':%61(5),)0),1(58% #$% '+$%'&'+$%).')%0(,)@%&,).,(%5)')$5%,5%$55$(),':%/1+%).$%2D8%% S1+% ).$% /,+5)% ),9$B% ).$% 20+13$'(% L'+:,'9$()% &,::% $:$6)% ).$% L+$5,4$()% 1/% ).$% 20+13$'(% P199,55,1(% '/)$+% ).$% 20+13$'(% P10(6,:B% ).$% ,(5),)0),1(% 619315$4% 1/% .$'45% 1/% 5)')$% '(4% -1A$+(9$()B% .'5% 3+1315$4% &.1% ).,5% 5.10:4% *$8% C.,5% 3+1315':% &,::% )'>$% ,()1% '6610()% ).$% +$50:)%1/%).$%20+13$'(%$:$6),1(5%'(4%&,::%/1::1&%61(50:)'),1(5%&,).%).$%20+13$'(%L'+:,'9$()8% F! ! C.,5%&,::%$(50+$%).')%6,),7$(5%&,::B%/1+%).$%/,+5)%),9$B%4,+$6):@%,(/:0$(6$%&.1%&,::%*$619$%).$% 3+$5,4$()%1/%).$%$J$60),A$%*14@%1/%).$%20+13$'(%D(,1(%).+10-.%).$,+%A1)$5B%;05)%'5%,5%).$% 6'5$%/1+%('),1(':%-1A$+(9$()58% G(%1+4$+%)1%5.'3$%).$%/0)0+$%,)%,5%$55$(),':%)1%+$9$9*$+%).$%3'5)8%2J'6):@%1($%.0(4+$4%@$'+5% '-1B%).$%:,-.)5%&$()%10)%'::%1A$+%20+13$8%C.$%@$'+%!U!F%9'+>$4%).$%*$-,((,(-%1/%).$%915)% 4$A'5)'),(-% &'+% 20+13$% .'4% $A$+% $J3$+,$(6$4B% 6:',9,(-% 9'(@% 9,::,1(5% 1/% :,A$5B% '(4% 4$5)+1@,(-%).$%/0)0+$%1/%'%&.1:$%-$($+'),1(8%XW%@$'+5%'-1B%).$%&1+:4%&'5%5$)% ':,-.)%'-',(8% C14'@B% 506.% 6')'5)+13.$5% 5$$9% 0().,(>'*:$% ,(% 20+13$8% C.')% ,5% ).$% 6'5$% *$6'05$% &$% .'A$% *$$(% 5.'+,(-% 5)+$(-).B% 31:,),6':% 31&$+B% &$':).% '(4% >(1&:$4-$% 1A$+% ).$% 4$6'4$5% 1/% 6:15$+% 20+13$'(% ,()$-+'),1(8% N$3:'6,(-% ).$% +0:$% 1/% ).$% 31&$+/0:% &,).% ).$% +0:$% 1/% :'&% ).+10-.% 61991(%,(5),)0),1(5%'(4%4$916+'),6%3+16$40+$5%*@%/15)$+,(-%).$%61990(,)@%9$).14B%&.,6.% .'5% '::1&$4% 05% )1% $(50+$% ).')% ).$% 5)+1(-% '+$% ;05)% '(4% ).$% &$'>% '+$% 5$60+$8% C.$5$% '+$% '6.,$A$9$()5%).')%*$:1(-%)1%'::%1/%05B%'(4%&$%5.10:4%(1)%'::1&%10+5$:A$5%)1%/1+-$)%).$98%#$% '+$%3+104%).')%).$%2D%+$6$,A$4%).$%L$'6$%V1*$:%L+,7$%,(%"E!"8%! 20+13$%.'5%*$$(%,(%6+,5,5%/1+%91+$%).'(%/,A$%@$'+58%Q'(@%3$13:$B%$53$6,'::@%).$%@10(-B%41%(1)% /1+$5$$%'%315,),A$%/0)0+$8%20+156$3),6,59%,5%-+1&,(-8%Y0)%).$+$%'+$%+$'51(5%/1+%13),9,598%C.,5% ,5%(1)%).$%/,+5)%6+,5,5%&$%&,::%1A$+619$8%G/%&$%'6)%)1-$).$+%'(4%)'>$%).$%+,-.)%4$6,5,1(5%)14'@% 20+13$%6'(%$9$+-$%/+19%).$%6+,5,5%5)+1(-$+%'(4%91+$%3+153$+105%).'(%*$/1+$8%% 9B*!'F.,!(C!,!H.&&.*!"B*(E.%% ƵƌŽƉĞ ŚĂƐ ĐŽŵĞ Ă ůŽŶŐ ǁĂLJ͘ dŚĞ ƵƌŽƉĞĂŶ WĞŽƉůĞ͛Ɛ WĂƌƚLJ ŚĂƐ ĐŽŶƚƌŝďƵƚĞĚ ŵŽƌĞ ƚŽ ƚŚĞ 4$A$:139$()%1/%).$%20+13$'(%D(,1(%).'(%'(@%1).$+%31:,),6':%/1+6$8%C.$%/10(4,(-%/').$+5%1/%'% 0(,)$4%20+13$%&$+$%P.+,5),'(%Z$916+')58%TA$+%).$%:'5)%WE%@$'+5B%).$%9$(%'(4%&19$(%1/%).$% ƵƌŽƉĞĂŶWĞŽƉůĞ͛ƐWĂƌƚLJŚĂǀĞďĞĞŶĂƚƚŚĞĨŽƌĞĨƌŽŶƚŽĨŝŵƉƌŽǀŝŶŐĂŶĚƐƵĐĐĞƐƐŝǀĞůLJĞdžƉĂŶĚŝŶŐ ).$%D(,1(B%'5%&$::%'5%,()+1406,(-%).$%20+18%?::%).,5%$('*:$4%05%)1%:,A$%,(%3$'6$B%5$60+,)@%'(4% ,(6+$'5,(-%3+153$+,)@%1A$+%/,A$%4$6'4$58%#.,:$%1).$+5%.'A$%)':>$4B%&$%.'A$%'6)$48%!! #$%&'()%'%*$))$+%20+13$8%C.$%20+13$'(%D(,1(%905)%*$619$%5)+1(-$+B%5,93:$+%'(4%91+$% 4$916+'),68%C.$5$%',95%,(%(1%&'@%61()+'4,6)%$'6.%1).$+8%G(%/'6)B%).$@%'6)0'::@%+$,(/1+6$%1($% '(1).$+8%G(%1+4$+%)1%9'>$%3+1-+$55%,(%).,5%+$-'+4B%,)%,5%,93$+'),A$%).')%).$%2D%,(5),)0),1(5% &1+>% *$))$+% )1-$).$+% '(4% 619$% 6:15$+% )1% ).$% 6,),7$(58% ?% :1)% 6'(% *$% '6.,$A$4% &,).,(% ).$% $J,5),(-%:$-':%/+'9$&1+>8%% W! ! $!D&*()+.*!;)'()I!V1%610()+@%6'(%/'6$%).$%6.'::$(-$5%1/%).$%"!5)%6$()0+@%':1($8%2,).$+%&$% *$619$%5)+1(-$+%)1-$).$+B%1+%&$'>$+%,(%,51:'),1(8%C.,5%,5%)+0$%/1+%/1+$,-(%'(4%4$/$(6$%31:,6@B% 6:,9')$%3+1)$6),1(%'(4%$($+-@%31:,6@%'(4B%3$+.'35%915)%1/%'::B%/1+%/,56':B%$61(19,6%'(4%516,':% 31:,6@8%C.$+$/1+$B%1(%5)+')$-,6%9'))$+5B%10+%9$9*$+%5)')$5%905)%$(.'(6$%).$,+%6113$+'),1(% '(4% '6)% )1-$).$+8% C.$@% 905)% ':51% 4$A$:13% 9$'(5% )1% +$(4$+% ).$,+% 4$6,5,1(% 9'>,(-% 9$6.'(,595%91+$%$//,6,$()8%S1+%).$%P10(6,:B%).,5%9$'(5%'::1&,(-%91+$%4$6,5,1(5%)1%*$%9'4$% *@%K0':,/,$4%9';1+,)@%,(%).$%/,$:45%1/%/1+$,-(%31:,6@%'(4%;05),6$%'(4%.19$%'//',+58%C.$%P10(6,:% 5.10:4%*$%+$/1+9$4%,()1%1($%6$()+':%/1+9'),1(%).')%)'>$5%'::%:$-,5:'),A$%4$6,5,1(5%3+$3'+$4% *@%).$%4,//$+$()%P10(6,:5%1/%Q,(,5)$+58%C.,5%9'@%:$'4%)1%:$55%+$-0:'),1(%'(4%:$-,5:'),1(%,(%).$% /0)0+$8% C.$%20+13$'(%P199,55,1(%&,::%9',()',(%).$%3+,(6,3:$%1/%1($%6199,55,1($+%3$+%610()+@8%G/% &$%9'('-$%)1%+$406$%).$%(09*$+%1/%P199,55,1(%31+)/1:,15B%).$%6199,))$$%5)+06)0+$%1/%).$% 20+13$'(%L'+:,'9$()%5.10:4%9')6.%).$%P199,55,1(%31+)/1:,158%%C.$%L'+:,'9$()%&,::%.'A$%)1% 91(,)1+%).15$%31+)/1:,15%906.%91+$%6:15$:@8%% J&*.,-@').F!')D&'&B&'()DK!D'-E@.*!E*(%.FB*.DI!C.$%2D%905)%*$619$%91+$%'6),A$%1(%).15$% 5)+')$-,6%)13,65% ).')% '+$% *$5)% 4$':)% &,).% 1(%).$%2D% :$A$:B% '(4%4$A1)$% :$55% $($+-@%)1%).15$% &.,6.%'+$%*$))$+%4$':)%&,).%1(%).$%('),1(':B%+$-,1(':%1+%:16':%:$A$:8%G)%.'5%)1%*$%*,--$+%1(%).$% *,-%).,(-5%'(4%59'::$+%1(%).$%59'::%).,(-58%C.,5%ŝƐŝŶƚƵŶĞǁŝƚŚŽƵƌƉŽůŝƚŝĐĂůĨĂŵŝůLJ͛ƐĞŵƉŚĂƐŝƐ 1(% 50*5,4,'+,)@H% )1% '44+$55% $A$+@% 3+1*:$9% '5% 6:15$:@% '5% 3155,*:$% )1% ).$% 6,),7$(5L! C.$% P199,55,1(% 5.10:4% '6)% '5% '% -')$>$$3$+% )1% 3+$A$()% 1A$++$-0:'),1(% '(4% 6$()+':,5'),1(8% G)% 5.10:4%91A$%)1%+$406$%).$%(09*$+%1/%:$-,5:'),A$%3+1315':58%% M(*.!F.-(%*,%?I!G(%/0)0+$B%,)%905)%*$%6:$'+$+%).')%).$%6,),7$(5%61()+1:%.1&%2D%,(5),)0),1(5% /0(6),1(B% +').$+% ).'(% 2D% ,(5),)0),1(5% 61()+1::,(-% ).$% :,A$5% 1/% ).$% 6,),7$(58% C.')% 9$'(5% ).')% $:$6),1(5% )1% ).$% 20+13$'(% L'+:,'9$()% 905)% *$619$B% 91+$% 6:$'+:@% ).'(% *$/1+$B% 61()$5)5% *$)&$$(% 6:$'+% 31:,),6':% ':)$+('),A$5B% '(4% *$)&$$(% ).$% :$'4$+5% +$3+$5$(),(-% ).15$% ':)$+('),A$58%2:$6),1(5%)1%).$%20+13$'(%L'+:,'9$()%905)%*$619$%4$%/'6)1%$:$6),1(5%/1+%).$% 315,),1(%1/%L+$5,4$()%1/%).$%P199,55,1(8%T(6$%).$%A1)$+5%.'A$%9'4$%).$,+%6.1,6$B%).$%2D% ,(5),)0),1(5%905)%'5509$%31:,),6':%+$531(5,*,:,)@%/1+%).$,+%4$6,5,1(%*$/1+$%).$%3$13:$8% ! ! [! ! N89M!8"N98M!79!O89P7Q!$6:!R9SJ! C.$%20+13$'(%D(,1(%,5%).$%:'+-$5)%$61(19@%,(%).$%&1+:48%#$%3155$55%'%&$':).%1/%$61(19,6% '(4% 60:)0+':% +$510+6$5% '(4% .'A$% '% +$531(5,*,:,)@% )1% 0),:,5$% ).$9% ,(% 1+4$+% )1% 9',()',(! $61(19,6%'(4%31:,),6':%:$'4$+5.,38%% %#.,:$% 20+13$% ,5% 3+$5$()$4% &,).% -+$')% 1331+)0(,),$5B% ,)% ':51% /'6$5% 519$% -+$')% 6.'::$(-$58% C.$+$% ,5% $A$+@% +$'51(% /1+% 13),9,59% ,(% ).,5% ($&% -:1*':% :'(456'3$B% *0)% ,)% ':51% +$K0,+$5% '% &,::,(-($55%)1%'4'3)B%6.'(-$B%+$/1+9%'(4%,((1A')$8%#$%6'(%$J,)%).$%6+,5,5%&,).%10+%20+13$'(% A':0$5% ,()'6)% '(4% 5)+$(-).$($48% C1% +$9',(% '% 5)+1(-% '(4% 6193$),),A$% ,()$+('),1(':% 3:'@$+B% &,).%).$%'*,:,)@%)1%6+$')$%;1*5%'(4%$(50+$%).$%&$':).%1/%10+%3$13:$B%&$%($$4%)1%6'++@%10)% +$/1+95%1(%).$%1($%.'(4%'(4%9'>$%505)',('*:$%'(4%)'+-$)$4%,(A$5)9$()5%1(%).$%1).$+8%% P+$'),(-%).$%+,-.)%61(4,),1(5%/1+%505)',('*:$%-+1&).%'(4%;1*% 6+$'),1(%,(%20+13$%,5%).$%>$@% 31:,),6':%1*;$6),A$%1/%).$%2LL%/1+%).$%($J)%/,A$%@$'+58%C1%'6.,$A$%).,5B%&$%.'A$%)1%9'>$%10+% $61(19,$5%5)+1(-$+%'(4%10+%,(405)+,$5%91+$%6193$),),A$%'(4%+$5,:,$()8%#$%&'()%)1%3+1A,4$%'% *$))$+%/0)0+$%&,).%($&%1331+)0(,),$5%/1+%'::%20+13$'(%6,),7$(5B%$53$6,'::@%).$%@10(-8%#$%'+$% 6199,))$4% )1% '6.,$A,(-% ).,5% *@% 30)),(-% ,()1% 3+'6),6$% ).$% 3+,(6,3:$5% 1/% ).$% R16,':% Q'+>$)% 261(19@B%,(%&.,6.%6193$),),A$($55%'(4%$()+$3+$($0+,':%/+$$419%'+$%619*,($4%&,).%516,':% ;05),6$%'(4%505)',('*,:,)@8%#$%*$:,$A$%).$%R16,':%Q'+>$)%261(19@%,5%).$%*$5)%914$:%)1%'::1&% $A$+@%,(4,A,40':%)1%+$'6.%.,5%1+%.$+%/0::%31)$(),':%&.,:$%'4A'(6,(-%51:,4'+,)@%'(4%).$%61991(% -1148%C.,5%':51%9$'(5%).')%31:,),6,'(5%.'A$%'%+$531(5,*,:,)@%)1%5$)%'33+13+,')$%+0:$5%)1%-1A$+(% '(4%+$-0:')$%9'+>$)58%% "%()(-'%!*.C(*-D!C(*!-(*.!.-E@(?-.)&! N$/1+95% '+$% ($6$55'+@% )14'@% )1% $(50+$% ).$% +,-.)% 61(4,),1(5% $J,5)% )1% 6+$')$% ($&% ;1*5% '(4% -0'+'()$$% ).$% 505)',('*,:,)@% 1/% 10+% 516,':% 5$60+,)@% 5@5)$958% ?5% 5$A$+':% 610()+,$5% ,(% 20+13$% .'A$% 5.1&(B% '(% $'+:@% ,93:$9$()'),1(% 1/% +$/1+95% )1% *0,:4% 914$+(B% ,((1A'),A$% '(4% 6193$),),A$%$61(19,$5%3'A$5%).$%&'@%)1%6+$')$%4@('9,6%$61(19,$5%'(4%($&%;1*58%N$/1+95% 6'(%+$5)1+$%906.<($$4$4%/,56':%6+$4,*,:,)@%'(4%3+1A,4$%).$%*'5,5%/1+%-+1&).%'(4%;1*%6+$'),1(8%% V1&%,5%).$%),9$%/1+%+$/1+95%&.,6.%&,::%'::1&%/1+%).$%6+$'),1(%1/%($&%;1*5%'(4%505)',('*:$% -+1&).8%G/%+$/1+95%'+$%4$:'@$4B%51%,5%-+1&).\%,/%-+1&).%,5%4$:'@$4B%10+%516,':%5$60+,)@%914$:B% 1($%1/%).$%9',(%3,::'+5%1/%).$%20+13$'(%914$:%1/%).$%R16,':%Q'+>$)%261(19@B%,5%;$13'+4,7$48% X! ! C.$5$%+$/1+95%5.10:4%,(6:04$%,93+1A$9$()5%,(%).$%.$':).%5$6)1+B%3$(5,1(%5@5)$95B%:'*10+% 9'+>$)5% '(4% $406'),1(% 5@5)$958% R16,':% 4,':1-0$% ,5% '% 3+$+$K0,5,)$% /1+% ).$% 5066$55/0:% ,93:$9$()'),1(%1/%6193+$.$(5,A$%'(4%/',+%+$/1+958%% L+1-+$55%)1&'+45%'6.,$A,(-%).$%20+13$%"E"E%R)+')$-@%)'+-$)5%1/% '(%,(6+$'5$4%$93:1@9$()% +')$%'(4% +$406,(-% 31A$+)@% ,5% 60++$():@% 0(5'),5/'6)1+@8% C.$+$/1+$B% ).$% 20+13$% "E"E%3+16$55% 5.10:4%*$%5)+$(-).$($48%% ?5%).$%$61(19@%.'5%)1%5$+A$%.09'(%4$A$:139$()B%9'+>$)%1+,$()$4%+$/1+95%')%*1).%('),1(':% '(4%20+13$'(%:$A$:%',9$4%')%,93+1A,(-%20+13$^5%$61(19,6%3$+/1+9'(6$%'(4%6193:$),(-%).$% G()$+(':%Q'+>$)%'+$%$55$(),':%/1+%/15)$+,(-%6193$),),A$($55%'(4%'))+'6),(-%3+,A')$%,(A$5)9$()% '(4%5)+$(-).$(,(-%10+%$61(19@8%C.$%:$A$:%1/%3+,A')$%,(A$5)9$()%,(%).$%2D%.'5%/'::$(%*@%IWE% *,::,1(% 20+1% 3$+% @$'+% 5,(6$% ).$% 5)'+)% 1/% ).$% 6+,5,58% P+$'),(-% ).$% +,-.)% 61(4,),1(5% )1% -$)% ).$% ,(A$5)9$()%,(%).$%2D%*'6>%)1%'(4%'*1A$%3+$<6+,5,5%:$A$:5%&,::%*$%1($%1/%).$%915)%,931+)'()% 6.'::$(-$5%,(%).$%@$'+5%)1%619$8%R)+06)0+':%+$/1+95%'+$%3,A1)':%)1%,93+1A,(-%).$%61(4,),1(5% /1+% ,(A$5)9$()B% '))+'6),(-% 3+,A')$% 6'3,)':% '(4% 6+$'),(-% ).$% +,-.)% 61(4,),1(5% /1+% -+1&).% ,(% 20+13$8% C.$@% '+$% ':51% ($6$55'+@% )1% 4$':% &,).% /0)0+$% 5)+06)0+':% 6.'::$(-$5% 506.% '5% ).$% 4$91-+'3.,6%6.'(-$5%).')%20+13$%6'(%$J3$6)%)1%/'6$%,(%).$%619,(-%@$'+58%P193$),),A$($55B% '%/1605%1(%$406'),1(%'(4%'%($&%,(405)+,':%'(4%$()+$3+$($0+,':%53,+,)%'+$%3+$<61(4,),1(5%/1+% 3+153$+,)@B% &.$+$*@% .$':).@B% 6193$),),A$% $61(19,$5% '))+'6)% ,(A$5)1+5% '(4% 6+$')$% .,-.< K0':,)@%;1*5%,(%20+13$8%C.$%,()$+(':%9'+>$)%5.10:4%*$%$(.'(6$4%*@%$(610+'-,(-%$61(19,$5% )1%/'6,:,)')$%91+$%:'*10+%/:$J,*,:,)@%'(4%91*,:,)@8%%C1%*$619$%'%>(1&:$4-$<*'5$4%516,$)@%&$% .'A$%)1%,93+1A$%611+4,('),1(%*$)&$$(%10+%$406'),1(%5@5)$95%'(4%&1+>%3:'6$5B%$(.'(6$%).$% :,(>5%*$)&$$(%$406'),1(%'(4%,(405)+@B%,93:$9$()%40':%$406'),1(':%5@5)$95%&.$+$%/$'5,*:$% '(4% +$61-(,5$% ).$% A':0$% 1/% (1( %_,-.% :$A$:5% 1/% 0($93:1@9$()B% 3'+),60:'+:@% @10).% 0($93:1@9$()B% ,5% '% 4'(-$+% /1+% 516,':% 61.$5,1(%'(4%/1+%20+13$'(%,()$-+'),1(8%G)%0(4$+9,($5%).$%-1':%1/%505)',('*:$%4$A$:139$()B% -+1&).% '(4% 6193$),),A$($55B% '5% ,)% 4$3+,A$5% ).$% 2D% 1/% A':0'*:$% >(1&<.1&B% ,((1A'),1(% 1331+)0(,),$5%'(4%.09'(%+$510+6$58!`'*10+%9'+>$)5%($$4%)1%*$%+$/1+9$4%,(%1+4$+%)1%'::1&% ]! ! /1+%'%-+$')$+%(09*$+%1/%3$13:$% )1%.'A$%'%4$6$()%;1*8%O1*:$55%-+1&).%,5%(1)%'(%13),1(%/1+% 20+13$8%% ͻ% #$% &,::% 3+191)$% ,(6:05,A$% '(4% '6),A$% $93:1@9$()% 31:,6,$58% #$% &'()% ,((1A'),A$% $406'),1(%5@5)$95%'(4%*$))$+%K0':,/,6'),1(5%/1+%10+%6,),7$(5%'5%&$::%'5%914$+(B%:,/$<:1(-% :$'+(,(-%)+',(,(-%5@5)$95%,(%1+4$+%)1%3+1A,4$%'66$55%)1%.,-. C.$% 0('66$3)'*:@% .,-.% @10).% 0($93:1@9$()% +')$% ,(% 519$% 2D% Q$9*$+% R)')$5% +$K0,+$5% 4$6,5,A$%'6),1(B%')%*1).%20+13$'(%'(4%('),1(':%:$A$:5B%'5%&$::%'5%)'+-$)$4%9$'50+$5B%506.%'5% ).$% 6+$'),1(% 1/% ,(6$(),A$5% /1+% $()$+3+,5$5% '(4% 6193'(,$5% )1% +$6+0,)% @10(-% 3$13:$8% #$% 50331+)%).$%$//1+)5%1/%).$%Q$9*$+%R)')$5%')%('),1(':%:$A$:B%&.,6.%.'A$%)1%*$%619*,($4%&,).% ).$%)11:5%'(4%/,('(6,':%+$510+6$5%'A',:'*:$%')%20+13$'(%:$A$:B%)1%+$406$%@10).%0($93:1@9$()% '(4% $(610+'-$% $()+$3+$($0+5.,38% 2LL% 50331+)5% 2D% 3+1-+'99$5% $53$6,'::@% ,(% ).$% /,$:4% 1/% +$5$'+6.%'(4%,((1A'),1(B%&.,6.%',9%)1%3+1A,4$%@10(-%3$13:$%&,).%'66$55%)1%.,-.%K0':,)@%;1*5B% )+',(,(-% 1+% '33+$(),6$5.,35% '/)$+% ).$,+% -+'40'),1(8% #$% &,::% 3+191)$% ).$% 53$$4@% ,93:$9$()'),1(%1/%).$5$%3+1-+'99$5%')%('),1(':%:$A$:8%% #$% 905)% '6.,$A$% 3+1-+$55% ,(% ).$% /,-.)% '-',(5)% 31A$+)@% '(4% 516,':% $J6:05,1(% &.,6.% '//$6)5% 9,::,1(5%1/%20+13$'(5%'(4%).+$')$(5%).$%ǀŝŶĚŝĐĂƚŝŽŶŽĨĐŝƚŝnjĞŶ͛Ɛ%.09'(%+,-.)58%P.,:4%31A$+)@B% ,(<&1+>% 31A$+)@% '(4% 31A$+)@% '91(-% ).$% $:4$+:@% 3'+),60:'+:@% &'++'()% 10+% '))$(),1(8% S',+% &'-$5%'+$%'(%,931+)'()%)11:%)1%3+$A$()%).$5$%/1+95%1/%31A$+)@8%#$%50331+)%610()+@<53$6,/,6% 9,(,909%&'-$%:$A$:5%,93:$9$()$4%'661+4,(-%)1%('),1(':%:'*10+%:'&58%% #$% +$-'+4% '6),A$% '-$,(-% '5% '(% ,931+)'()% /'6)1+%,(% ,93+1A,(-% K0':,)@% 1/% :,/$8% ?6),A$% '-$,(-% 5.10:4% *$% 3+191)$4% '5% 3'+)% 1/% '% &,4$+% +$/1+9% 1/% 3$(5,1(% 5@5)$95% )1% $(50+$% ).$@% '+$% '4$K0')$%'(4%505)',('*:$%'(4%41%(1)%;$13'+4,5$%).$%5)'*,:,)@%1/%30*:,6%/,('(6$58% 2//$6),A$%6.,:4%6'+$B%$406'),1(%'(4%.$':).%5@5)$95B%)1-$).$+%&,).%).$%3+1A,5,1(%1/%6'+$%/1+% ).$%$:4$+:@%'(4%3$13:$%&,).%4,5'*,:,),$5%'(4%).$%,()$-+'),1(%1/%9'+-,(':,5$4%61990(,),$5%'+$% 6+06,':%/1+%).$%&$::<*$,(-%1/%20+13$͛ƐĐŝƚŝnjĞŶƐ͕ĨŽƌƚŚĞŝŶĐůƵƐŝǀĞŶĞƐƐŽĨŽƵƌƐŽĐŝĞƚŝĞƐ͘dŚĞƐĞ% '+$%':51%,931+)'()%/'6)1+5%)1%$(50+$%:'*10+%9'+>$)5%/0(6),1(%3+13$+:@%'(4%)1%'44+$55%/0)0+$% 4$91-+'3.,6%6.'::$(-$58%?(1).$+%,931+)'()%K0$5),1(%).')%($$45%)1%*$%'5>$4%,5%.1&%*$5)%)1% ,(6+$'5$% ).$% (09*$+% 1/% &19$(% 3'+),6,3'),(-% ,(% ).$% :'*10+% /1+6$% '(4% ,(% 4$6,5,1(<9'>,(-% 315,),1(58%G(6+$'5,(-%).$%+')$%1/%$93:1@9$()%&,::%$('*:$%).$%2D%)1%-+1&%5)+1(-$+B%'(4%'::1&% 91+$%6,),7$(5%)1%61()+,*0)$%)1%).$%61991(%-1148%% !E! ! #$% 3+191)$% ).$% +$5)+06)0+,(-% 1/% ).$% 30*:,6% 5$6)1+% ,(% 1+4$+% )1% 4$:,A$+% .,-.% K0':,)@% 30*:,6% 5$+A,6$5%,(%'%)+'(53'+$()B%'6610()'*:$B%$//$6),A$%'(4%$//,6,$()%9'(($+%&.,:5)%$(50+,(-%).')% '49,(,5)+'),A$%*0+4$(5%'+$%9,(,9,5$48! #$%':51%50331+)%).$%61(),(0$4%/,-.)%'-',(5)%61++03),1(8%R)+06)0+':%+$/1+95%&,::%+$:$'5$%A,)':% +$510+6$5% ).')% 5.10:4% *$% +$'::16')$4% )1% 6+$')$% ;1*5% '(4% -+1&).8% P,),7$(5% '(4% *05,($55$5% ($$4% 5)+$'9:,($4B% ,()$-+')$4% 5$+A,6$5% ).')% 41% (1)% &'5)$% ),9$% '(4% 91($@8% 2<-1A$+(9$()B% 4,-,)':,5'),1(%1/%).$%30*:,6%5$6)1+%'(4%$<:$'+(,(-%'+$%6+06,':%,(%).,5%5$(5$8%% G(% 1+4$+% )1% +$531(4% )1% ).$% 4$91-+'3.,6% 6.'::$(-$5% '(4% )1% 9'>$% 3$(5,1(% 5@5)$95% 505)',('*:$B%'4$K0')$%'(4%5'/$B%91+$%3$13:$%&,::%.'A$%)1%&1+>%/1+%:1(-$+8%C.,5%&,::%.'A$%)1% *$% '6.,$A$4% *@% +',5,(-% ).$% '6)0':% +$),+$9$()% '-$% '(4% 4,5,(6$(),A,5,(-% $'+:@% +$),+$9$()8% N$,(/1+6,(-%,()$+-$($+'),1(':%51:,4'+,)@%,5%($$4$4%,(%'::%'+$'5%1/%516,$)@8% M(*.!EBH@'%!DE.)F')+!'D!)(&!&=.!,)D>.*!! C.$+$% &,::% *$% (1% &'@% 10)%1/% ).$% 6+,5,5% &,).10)%*04-$)% 61(51:,4'),1(B%'(4%).$+$% &,::%*$%(1% *04-$)% 61(51:,4'),1(% &,).10)% ).$% +$/1+95% ($6$55'+@% )1% 3+191)$% 505)',('*:$% -+1&).8% P10()+,$5%).')%.'A$%9'4$%),9$:@%+$/1+95%'+$%906.%*$))$+%315,),1($4%).'(%610()+,$5%&.,6.% 315)31($4%5)+06)0+':%+$/1+958%L15)31(,(-%+$/1+95%.'5%:$4%)1%.,-.$+%0($93:1@9$()B%:1&$+% 3+,A')$% ,(A$5)9$()% '(4% 0(505)',('*:$% 4$*)8% G(A$5),(-% ,(% 0(+$/1+9$4% $61(19,$5% ($A$+% -$($+')$5% 505)',('*:$% -+1&).8% S,56':% 61(51:,4'),1(% '(4% ).$% +$-0:'),1(% 1/% /,('(6,':% 9'+>$)5% '+$%($6$55'+@%61(4,),1(5%/1+%3+$A$(),(-%/0)0+$%6+,5$58% M,A$(% 60++$()% .,-.% 4$*)% :$A$:5B% '44,),1(':% ,++$531(5,*:$! 30*:,6% 53$(4,(-B% '5% 3+1315$4% *@% 1).$+% 31:,),6':% 3'+),$5B% &,::% ,($A,)'*:@% :$'4% )1% '(% $61(19,6% '(4% 516,':% 4,5'5)$+8% C.$% :,(>% *$)&$$(% 4$6:,(,(-% 6193$),),A$($55B% ,++$531(5,*:$% 53$(4,(-B% 311+:@% +$-0:')$4% *'(>5B% 0($93:1@9$()B%.,-.%4$*)%:$A$:5B%'(4%,(5$60+$%&$:/'+$%'(4%516,':%5$60+,)@%5@5)$95%,5%6:$'+8%% C.$%2LL%41$5%(1)%*$:,$A$%).')%'%/0+).$+%$J'6$+*'),1(%1/%4$*)%'(4%4$/,6,)%:$A$:5%,5%).$%+,-.)% &'@%)1%$J,)%/+19%).$%6+,5,5%'(4%6+$')$%-+1&).%,(%20+13$8%#.,:$%+$6$()%$J3$+,$(6$%.'5%5.1&(% ).')% 91+$% -1A$+(9$()% 53$(4,(-% ,5% (1)% ).$% '(5&$+B% ,)% ':51% .'5% *$619$% $A,4$()% ).')% 2D% Q$9*$+% R)')$5% &.,6.% )11>% 4$)$+9,($4% 5)$35% )1% +$5.'3$% ).$,+% 30*:,6% /,('(6$5% .'A$% 5$$(% 5)+1(-% $61(19,6% -+1&).% ,(% ).$% :'5)% 6103:$% 1/% @$'+58% C.$% 2LL% .'5% '% 6:$'+% 3+$/$+$(6$% /1+% )+,99,(-% 0(3+1406),A$% $J3$(4,)0+$5% 1A$+% ,(6+$'5,(-% +')$5% 1/% )'J'),1(8% C.$% 4$6:,($% ,(% !!! ! 6193$),),A$($55% '(4% 3+1406),A,)@% ,5% 1($%1/%).$%:$'4,(-% 6'05$5% 1/%).$% 6+,5,5% ,(% 20+13$8% T0+% $61(19,$5% 6'(% 1(:@% 6193$)$% ,(% '% -:1*':,5$4% &1+:4% ,/% ).$@% '+$% 5)+1(-% '(4% 6'3'*:$% 1/% '4'3),(-8%% ͻ% #$%5)'(4%/1+%/,56':%61(51:,4'),1(%,93:$9$()$4%,(%'%-+1&).$%).$%+,-.)%*':'(6$%*$)&$$(%/,56':%61(51:,4'),1(%'(4%-+1&).<$(.'(6,(-%31:,6,$5B% &.,6.%50331+)%).$%+$':%$61(19@%'(4%.$:3%)1%6+$')$%($&B%5)'*:$%;1*5B%,(%1+4$+%)1%)'6>:$% .,-.%0($93:1@9$()%+')$5%'(4%3+1)$6)%516,':%61.$5,1(8% ͻ% #$% 5)'(4% /1+% 505)',('*:$% -+1&).% *'5$4% 1(% '% 6193$),),A$% '(4% ,((1A'),A$% $61(19@8% C.+10-.% 5)+06)0+':% +$/1+95% &$% &,::% 6+$')$% .$':).@B% 6193$),),A$% $61(19,6% 5)+06)0+$5% &.,6.%'))+'6)%3+,A')$%,(A$5)9$()B%6+$')$%-+1&).%'(4%,(6+$'5$%$93:1@9$()8%% ͻ% #$%+$;$6)%)'>,(-%1(%91+$%4$*)%)14'@B%*$6'05$%,)%&,::%.'+9%$A$+@1($%)191++1&8%#$% '+$%6199,))$4%)1%,93:$9$(),(-%'::%1/%).$%9$'50+$5%':+$'4@%'-+$$4%')%20+13$'(%:$A$:% ).')%&,::%,93+1A$%$61(19,6%-1A$+('(6$B%+$406$%4$*)%'(4%5)+$(-).$(%10+%$61(19,$58%% !!!!!J-,*&!')A.D&-.)&D!,*.!,!D(@B&'()!! L0*:,6% ,(A$5)9$()% 5.10:4B% /,+5)% '(4% /1+$915)B% /1605% 1(% -+1&).<-$($+'),(-% '+$'5B% 506.% '5% $406'),1(B% +$5$'+6.% '(4% ,((1A'),1(8% C1% 9$$)%).,5% ',9B% ).$% 30*:,6% 5$6)1+% 5.10:4%/15)$+% 61< 13$+'),1(% &,).% ).$% 3+,A')$% 5$6)1+8% Z$A$:13,(-% ).$% 20+13$'(% $61(19@% ,()1% '% &1+:4&,4$B% 6193$),),A$B%>(1&:$4-$%$61(19@%,5%1($%1/%).$%915)%,931+)'()%6.'::$(-$5%/1+%).$%20+13$'(% D(,1(%,(%).$%@$'+5%)1%619$8%a(1&:$4-$%,5%6$()+':%)1%$61(19,6%-+1&).%'(4%;1*%6+$'),1(%'(4% &$% 905)B% ).$+$/1+$B% 6+$')$% ).$% *$5)% 61(4,),1(5% /1+% 4$A$:13,(-% '% >(1&:$4-$<*'5$4% 516,$)@% &,).10)% :$'A,(-% 3$13:$% *$.,(48% N$5$'+6.% '(4% ,((1A'),1(B% $53$6,'::@% .,-.$+% $406'),1(% ,(5),)0),1(5% '(4% 6$()$+5% 1/% $J6$::$(6$B% '+$% >$@% $:$9$()5% ,(% ).,5% +$53$6)8% _,-. ͻ% #$% 50331+)% ,(,),'),A$5% ')% 20+13$'(% :$A$:% ',9$4% ')% +$<:'0(6.,(-% 10+% $61(19@% *@% 5)$33,(-% 03% )'+-$)$4% ,(A$5)9$()B% 4$A$:13,(-% 2D% ($)&1+>5% ,(% ).$% /,$:45% 1/% $($+-@B% !"! ! )+'(531+)%'(4%G(/1+9'),1(%'(4%P1990(,6'),1(%C$6.(1:1-@%bGPCdB%,(%3'+),60:'+%).+10-.% L0*:,6%L+,A')$%L'+)($+5.,35%bLLL5d8% ͻ% #$% 0+-$():@% ($$4% )1% $(.'(6$% ).$% +1:$% 1/% ).$% 20+13$'(% G(A$5)9$()% Y'(>% b2GYd% )1% /'6,:,)')$% $'5,$+% '66$55% )1% 6'3,)':B% $53$6,'::@% /1+% 10+% R9'::% '(4% Q$4,09% 2()$+3+,5$5% bRQ25d8% M.,DB*.D!C(*!,!D&*()+!"B*(!! C.$%20+1% ,5% 91+$%).'(% ;05)% '% 60++$(6@8% G)% ,5% '% -+$')%0(,/@,(-%3+1;$6)% '(4% ,(4,53$(5'*:$% /1+% ƵƌŽƉĞ͛ƐĨƵƚƵƌĞ8%C.$%20+1%(1)%1(:@%5)+$(-).$(5%).$%$61(19@%'(4%9'>$%05%91+$%6193$),),A$% ,()$+('),1('::@B% *0)% ':51% 6+$')$5% 31:,),6':% 5)'*,:,)@% *@% /'6,:,)'),(-% ,()$+(':% 61.$+$(6$% '(4% 61991(%31:,6,$5%)1&'+45%).$%10)5,4$%&1+:48%%C.$%20+1%,5%91+$%).'(%;05)%'%60++$(6@8%G)%,5%'% -+$')%0(,/@,(-%3+1;$6)%'(4%,(4,53$(5'*:$%/1+%20+13$͛ƐĨƵƚƵƌĞ8% C.$% 6+,5,5% .'5% 5.1&(% ).')% &$% ($$4% 3+1/10(4% $61(19,6% +$/1+95% ')% ('),1(':% :$A$:B% &.,:$% +$5.'3,(-%$61(19,6%-1A$+('(6$%1(%).$%20+13$'(%:$A$:8%% ͻ% #$% ($$4% 5)+1(-% -1A$+('(6$% )1% 3+1)$6)% ).$% 5)'*,:,)@% 1/% ).$% 20+13$'(% 261(19,6% '(4% Q1($)'+@%D(,1(%b2QDd8%% ͻ% C.$%20+1B%'5%10+%61991(%60++$(6@B%,5%*'5$4%1(%).$%3+,(6,3:$%1/%3+,6$%5)'*,:,)@%,(%1+4$+% )1% 3+1A,4$% ).$% R,(-:$% Q'+>$)% &,).% '% +$:,'*:$% 60++$(6@% '(4% .$:3% 05% )1% 9'J,9,5$% ).$% *$($/,)5%1/%*$,(-%).$%*,--$5)%$61(19@%,(%).$%&1+:48% ͻ% ?%91($)'+@%0(,1(%($$45%*04-$)'+@%'(4!/,56':%+0:$5%&.,6.%.'A$%)1%*$%+$53$6)$48%C.$% 20+13$'(% P199,55,1(% 5.'::% 9'>$% /0::% 05$% 1/% ).$,+% 31&$+5% )1% 9'>$% 50+$% ).')% 2D% 610()+,$5% +$/1+9% '(4% +$53$6)% ':+$'4@% '-+$$4% +0:$5% )1% +$406$% 4$*)% '(4% 4$/,6,)58! C.$% P199,55,1(% ($$45% $//$6),A$% )11:5% )1% 5'/$-0'+4% 6193:,'(6$% 1/% ).15$% Q$9*$+% R)')$5% ).')%41%(1)%/0:/,::%).$%2De5%$61(19,6%-1A$+('(6$%1*:,-'),1(58% x C.$% 91($)'+@% D(,1(% ':51% ($$45% ).$% )11:5% '(4% 9$'(5% )1% 5)'*,:,7$% ).$% $61(19@8% C.$% Y'(>,(-% D(,1(% ,5% '(% ,931+)'()% 5)$38% S0+).$+% 611+4,('),1(% 1/% /,56':% '(4% *04-$)'+@% 31:,6,$5%5.10:4%*$%61(5,4$+$48% C.$%,93:$9$()'),1(%1/%).$5$%5'(6),1(5%($$45%)1%*$%,93+1A$48%C.,5%,5%1($%1/%).$%>$@%:$551(5% /+19%).$%6+,5,58%% !I! ! Q$9*$+5.,3% ,(% '(% 261(19,6% '(4% Q1($)'+@% D(,1(% .'5% -+$')% '4A'()'-$5% /1+% 3'+),6,3'),(-% 610()+,$5B% *0)% ,)% 905)% -1% .'(4% ,(% .'(4% &,).% +$531(5,*,:,)@% '(4% 51:,4'+,)@8% ?5% :1(-% '5% $'6.% 610()+@%/0:/,:5%,)5%+$531(5,*,:,)@B%'::%6'(%*$($/,)%/+19%,)8%#$%($$4%)1%+$5)1+$%61(/,4$(6$%,(%).$% 20+1% '+$'% '5% '% &.1:$% '(4% ,(% 6$+)',(% Q$9*$+% R)')$5% ,(% 3'+),60:'+8% #$% 905)% ).$+$/1+$% 3+$5$+A$% ).$% 61.$5,1(% 1/% ).$% D(,1(8% #$% '::% *$($/,)% /+19% ).$% 61991(% 60++$(6@% '(4% ).$% R,(-:$% Q'+>$)8% #$%($$4% )1% 5)'(4% )1-$).$+B%$53$6,'::@% ,(% 6.'::$(-,(-%),9$5% '(4% .$:3%).15$% 610()+,$5% ,(% 4,//,60:)@\% ).$@% ,(% )0+(% ($$4% )1% +$/1+9% ,(% 1+4$+% )1% 'A1,4% ($&% 6+,5$58% #$% '6>(1&:$4-$% ).$% ,99$(5$% $//1+)5% '(4% 5'6+,/,6$5% 9'4$% *@% 3$13:$B% 6193'(,$5% '(4% -1A$+(9$()5% 5,(6$% ).$% *$-,((,(-% 1/% ).$% 6+,5,58% C.$% 2D% 905)% 50331+)% ).$,+% $//1+)5% )1% 914$+(,5$%).$,+%$61(19,$5%'(4%6+$')$%($&%;1*58%% C.$% $61(19,6% 4$A$:139$()5% '(4% 4$6,5,1(5% 9'4$% ,(% ).$% 20+1% '+$'% .'A$% '% /0(4'9$()':% ,93'6)%1(%2D%610()+,$5B%$A$(%).15$%).')%41%(1)%05$%).$%20+1%'5%'%60++$(6@8%% ͻ% #$%,(A,)$%'::%2D%Q$9*$+%R)')$5%)1%$(.'(6$%).$,+%611+4,('),1(%1/%$61(19,6%31:,6,$5B% *$6'05$% &$% &'()% )1% 'A1,4% 5)+',(5% &,).,(% ).$% R,(-:$% Q'+>$)8% G93+1A,(-% $61(19,6% -1A$+('(6$%&,::%.$:3%3+$3'+$%(1(<20+1%9$9*$+5%)1%;1,(%).$%20+1%'+$'%,(%).$%/0)0+$8% ͻ% C.$% :1(-<)$+9% 31:,),6':% -1':% 1/% ).$% 2LL% ,5% ).')% ).$% 2D% '(4% ).$% 20+1% '+$'% 5.10:4% $A$()0'::@%61(A$+-$8%?::%2D%9$9*$+5%).')%/0:/,:%).$%6+,)$+,'%1/%'66$55,1(%)1%).$% 20+1% '+$'%5.'::%*$%-,A$(%).$%6.'(6$%)1%;1,(%'(4%+$'3%).$%*$($/,)5%1/%).$%61991(%60++$(6@8% Q.,@&=?!H,)TD!&(!F*'A.!')A.D&-.)&!!! C.$%6+,5,5%.'5%5.1&(%).')%,++$531(5,*:$%+,5>%)'>,(-%6'(%;$13'+4,5$%).$%5)'*,:,)@%1/%).$%&.1:$% $61(19@8% Y'(>5% 5.10:4% 3'+),6,3')$% ,(% 505)',('*:$% 4$A$:139$()58% G++$531(5,*:$% +,5>5% )'>$(% /1+%5.1+)<)$+9%3$+51(':%'(4%5.'+$.1:4$+%*$($/,)5B%'5%&$::%'5%91+':%.'7'+4B%($$4%)1%*$%:$-'::@% 61()+1::$48%2J6$55,A$%ďŽŶƵƐĞƐĂƌĞƵŶĂĐĐĞƉƚĂďůĞ͘dŚĞŶĞǁƌƵůĞƐŽŶďĂŶŬĞƌ͛ƐďŽŶƵƐĞƐŶĞĞĚƚŽ *$%,93:$9$()$4%*@%Q$9*$+%R)')$5%&,).10)%4$:'@8%C.$%/,('(6,':%5$6)1+%,5%6+06,':%)1%4+,A,(-% ,(A$5)9$()%,(%).$%+$':%$61(19@B%5),90:'),(-%$()+$3+$($0+5.,3%'(4%$61(19,6%4$A$:139$()8% ZĞŐĂŝŶŝŶŐĐŝƚŝnjĞŶƐ͛ĐŽŶĨŝĚĞŶĐĞŝŶƚŚĞĨŝŶĂŶĐŝĂůƐĞĐƚŽƌŝƐĞƐƐĞŶƚŝĂůĨŽƌƚŚĞĨƵŶĐƚŝŽŶŝŶŐŽĨŽƵƌ $61(19,$58%Y'(>5%($$4%)1%/1605%3+,9'+,:@%1(%).$,+%9',(%/0(6),1(B%&.,6.%,5%5$+A,(-%).$%+$':% $61(19@B%5),90:'),(-%$()+$3+$($0+5.,3%'(4%$61(19,6%4$A$:139$()8% C.$%6+$'),1(%1/%'%*'(>,(-%0(,1(%,5%$55$(),':%)1%).$%50+A,A':%'(4%3+153$+,)@%1/%).$%20+1%'+$'8% #$% 905)% $(50+$% ).')% ).$% A,6,105% :,(>% *$)&$$(% 51A$+$,-(% 4$*)% '(4% *'(>% 4$*)% ,5% /,('::@% !F! ! *+1>$(8%?%.$':).@%Y'(>,(-%D(,1(%,5%$55$(),':%)1%'6.,$A$%).,58%C1%$(50+$%'%5)'*:$%2D%*'(>,(-% 5$6)1+% ).$% 6193:$),1(% 1/% ).$% Y'(>,(-% D(,1(% ,5% 1/% 3'+'910()% ,931+)'(6$8% C.,5% ,(A1:A$5% ,93:$9$(),(-% ).$% 5,(-:$% +0:$% *11>B% ,8$8% *'(>% 6'3,)':% +0:$5B% ).$% +$61A$+@% '(4% +$51:0),1(% /+'9$&1+>B%'%+0:$%/1+%('),1(':%4$315,)%-0'+'()$$5%56.$9$5B%'%61991(%$//$6),A$%503$+A,5,1(% 9$6.'(,59B%'(4%'%5,(-:$%+$51:0),1(%9$6.'(,59%/1+%5@5)$9,6%*'(>58%#$%50331+)%'%61991(% *'(>,(-% 503$+A,51+@% 5@5)$9% *@%).$% 2PY% /1+% '::% 5@5)$9,6% '(4% )+'(5*10(4'+@% &1+>,(-% 9';1+% *'(>58% S1+% 59'::$+% *'(>5% 506.% '% 5)+,6)% 503$+A,51+@% 5@5)$9% ,5% (1)% ($6$55'+@8% C.,5% ,5% >$@% )1% 6+$'),(-%'%*$))$+%*'(>,(-%5@5)$9%,(%20+13$8%T(%).$%-:1*':%:$A$:B%&$%20+13$'(5%.'A$%)1%&1+>% )1-$).$+%)1%'6.,$A$%'%+$-0:')1+@%/+'9$&1+>%/1+%).$%/,('(6,':%9'+>$)5%,(%1+4$+%)1%$(50+$%).')% ).$+$%&,::%*$%(1%503$+A,51+@%͚ďůĂĐŬŚŽůĞƐ͛&.,6.%$(4'(-$+%).$%5)'*,:,)@%1/%).$%&1+:4%$61(19@% 1(6$%'-',(8%% :.A.@(E')+!,!:'+'&,@!$+.)F,!C(*!+*(>&=!,)F!U(HD! 20+13$e5%Z,-,)':%?-$(4'%/1+%"E"E%'413)$4%'%(09*$+%1/%)'+-$)5B%,(6:04,(-H%*+1'4*'(4%03)'>$% '(4% '66$55B% $<6199$+6$B% 4,-,)':% ,(6:05,1(B% 6+155<*1+4$+% 30*:,6% 5$+A,6$5% $<:$'+(,(-% '(4% +$5$'+6.%'(4%,((1A'),1(8%C.$%2LL%.'5%*$$(B%'(4%&,::%61(),(0$%)1%*$B%')%).$%/1+$/+1()%1/%).$% 4$A$:139$()%1/%).$%Z,-,)':%?-$(4'8%Q1+$%53$6,/,6'::@B%).$%2LL%,5%6199,))$4%)1%3+191),(-% ,(A$5)9$()%,(%).$%4$3:1@9$()%1/%'%($J)%-$($+'),1(%*+1'4*'(4%($)&1+>%'(4%)1%+$'3,(-%).$% *$($/,)5%1/%($&%91*,:$%5$+A,6$5%*@%/0+).$+%$(.'(6,(-%91*,:$%53$6)+09%'::16'),1(%$//,6,$(6@8% ?%5)'*:$%'(4%3+$4,6)'*:$%+$-0:')1+@%$(A,+1(9$()%905)%*$%-0'+'()$$48%% `'5):@B%).$%2LL%,5%6199,))$4%)1%$(.'(6,(-%+$5$'+6.%'(4%4$A$:139$()%$//1+)5%,(%GPC%'5%&$::%'5% 6+$'),(-% ).$% *$5)% 3155,*:$% $(A,+1(9$()% /1+% ).$% 03)'>$% 1/% 3+19,5,(-% ($&% )$6.(1:1-,6':% 4$A$:139$()5%&,).%).$%31)$(),':%)1%,93'6)%315,),A$:@%1(%20+13$e5%6193$),),A$($55B%506.%'5% 6:104% 61930),(-8% ?% *05,($55% /+'9$&1+>% ($$45% )1% *$% $5)'*:,5.$4% )1%*+,(-% *'6>% )1% 20+13$% 4$A$:139$()% '(4% 3+1406),1(% 6193$)$(6$5% ,(% ).$% '+$'% 1/% ,(/1+9'),1(% '(4% 5$60+,)@% )$6.(1:1-,$5B%).05%+$406,(-%4$3$(4$(6,$5%1(%).,+4%610()+,$58%G(%).,5%+$-'+4%).$%2LL%*$:,$A$5% ).')%20+13$e5%P:104%R)+')$-@%,5%6+06,':%)1%).$%6193:$),1(%1/%).$%Z,-,)':%R,(-:$%Q'+>$)8%P:104% 61930),(-% &,::% ':51% .'A$% '% .0-$% ,93'6)% 1(% 20+13$^5% 6193$),),A$($55% ,(% A,$&% 1/% ).$% 6193:$),1(%1/%).$%5,(-:$%9'+>$)8%% ! ! !W! ! J&*.)+&=.)')+!"B*(E.VD!')FBD&*',@!H,D.!,)F!%(-E.&'&'A.).DD! ?% 5)+1(-B% 4@('9,6% '(4% ,((1A'),A$% ,(405)+,':% *'5$% ,5% $55$(),':% /1+% $61(19,6% -+1&).% '(4% 3+153$+,)@8%C.$%+$':%$61(19@B%10+%RQ25B%3:05%'(%,((1A'),A$%'(4%6+$'),A$%,(405)+,':%5$6)1+B% '+$%6$()+':%)1%10+%$61(19,6%+$61A$+@8%C.$%2LL%$(41+5$5%).$%)'+-$)%1/%*115),(-%,(405)+@%'5%'% ƉƌŽƉŽƌƚŝŽŶŽĨƚŚĞ h͛Ɛ'W)1%"Ef%*@%"E"E%&,).%'%A,$&%)1%9'>,(-%20+13$%'(%'))+'6),A$%3:'6$% 1/% 3+1406),1(% '(4% ,(A$5)9$()8% G(405)+@% 9$'(5% 3+1406),1(% '(4% 3+1406),1(% 6+$')$5% 505)',('*:$%;1*58%G/%,(405)+@%,5%)1%.'A$%'%505)',('*:$%/0)0+$%,(%20+13$B%,)%($$45%)1%+$)',(%'(4% 4$A$:13%,)5%,((1A'),A$%6'3'6,)@8%C.,5%+$K0,+$5%).$%2D%'(4%,)5%Q$9*$+%R)')$5%)1%*$%5$+,105% '*10)%+$':,5,(-%,)5%1*;$6),A$%1/%53$(4,(-%If%1/%).$%MZL%1(%+$5$'+6.8%! C.$% 2LL% +$($&5% ,)5% 6199,)9$()% )1% 5$)),(-% '% 61991(% ,(405)+,':% 31:,6@% *'5$4% 1(% '% +$':% 61(A$+-$(6$% 1/% $61(19,6% '(4% 516,':% (1+958% C.$% 3,::'+% 1/% '(@% 61991(% ,(405)+,':% 31:,6@% ,5% +$5$'+6.% '(4% ,((1A'),1(8% #$% $(610+'-$% ).$% :'0(6.% 1/% 20+13$'(% )$(4$+5% )1% 4$A$:13% ($&% ,((1A'),A$% )$6.(1:1-,$5% '(4% 5$)% 61991(% +$5$'+6.% 3+1-+'99$5% *$)&$$(% )13% 0(,A$+5,),$5% '(4%+$5$'+6.%1+-'(,5'),1(58! $! ).>! ").*+?! ,)F! <@'-,&.! <=,)+.! E(@'%?! &(>,*FD! ,! %(-E.&'&'A.! ,)F! +*..)! "B*(E.,)! .%()(-?! C.$%',9%1/%10+%$($+-@%31:,6@%,5%)1%5'/$-0'+4%).$%5033:@%1/%$($+-@%)1%20+13$%')%'//1+4'*:$% 3+,6$5% '(4% ,(% '(% $(A,+1(9$()% /+,$(4:@% 9'(($+8% C.$% +'3,4:@% ,(6+$'5,(-% -:1*':% 4$9'(4% /1+% $($+-@B% '5% &$::% '5% ).$% -+1&,(-% $($+-@% 3+,6$% -'3% *$)&$$(% 20+13$% '(4% ).$% DRB% '(4% ).$% 6.'::$(-$% 1/% )'6>:,(-% 6:,9')$% 6.'(-$B% ($6$55,)')$5% 91A,(-% '&'@% /+19% 10+% 4$3$(4$(6$% 1(% /155,:% /0$:58% #$% 905)% 6+$')$% 1331+)0(,),$5% /1+% 20+13$'(% *05,($55$5% )1% 4$A$:13% ($&% 505)',('*:$%)$6.(1:1-,$5%&.,6.%6'(%3+1A,4$%($&%;1*5B%4$6+$'5$%10+%4$3$(4$(6$%1(%$($+-@% ,931+)5%'(4%.$:3%)1%4$A$:13%/0+).$+%'%6+$4,*:$%20+13$'(%31:,6@%)1%/,-.)%6:,9')$%6.'(-$8%G(% ).,5%61()$J)B%).$%2LL%&'()5%).$%20+13$'(%D(,1(%)1%*$%).$%/+1()+0(($+%,(%6'+*1( ![! ! #$%'+$%61(A,(6$4%).')%'%610+'-$105%'(4%+'3,4%91A$%)1&'+45%).$%915)%914$+(%'(4%$//,6,$()% 505)',('*:$%)$6.(1:1-,$5%&,::%*$($/,)%(1)%1(:@%10+%6:,9')$%'(4%3+1A,4$%).$%*'5,5%/1+%'%-:1*':% 51:0),1(%)1%6:,9')$%6.'(-$B%*0)%).')%,)%&,::%':51%*$%*$($/,6,':%/1+%).$%$61(19@%'5%,)%&,::%9'>$% 05%:$55%4$3$(4$()%1(%/155,:%/0$:%,931+)58%C.,5%,5%'(%,931+)'()%,(A$5)9$()B%&.,6.%&,::%*$($/,)% '::%1/%10+%6,),7$(5%'(4%/0)0+$%-$($+'),1(58%C.$%20+13$'(%D(,1(%905)%+$9',(%).$%&1+:4%:$'4$+% ,(%).,5%'+$'8%S0+).$+91+$B%20+13$%905)%$(-'-$%'::%+$:$A'()%,()$+('),1(':%3'+)($+5%,(%1+4$+%)1% '4A'(6$%)1&'+45%5$)),(-% )'(-,*:$%-:1*':%6:,9')$%6.'(-$%6199,)9$()5B%'%3+$<61(4,),1(%/1+% 5066$$4,(-%,(%619*'),(-%6:,9')$%6.'(-$8%% Y,(4,(-B% *0)% +$':,5),6B% 2D% :$A$:% )'+-$)5% /1+% "EIE% 610:4% *$% 3+1315$4% /1+% ).15$% 31:,6@% '+$'5% &.$+$% ).$@% 3+1A,4$% '% 3+1A$(% '44$4 C.$%1*;$6),A$%1/%30)),(-%).$%2D%$61(19@%*'6>%1(%).$%-+1&).%)+'6>%6'(%1(:@%*$%'6.,$A$4%,/% $($+-@%3+,6$5%'+$%6193$),),A$%'(4%5033:,$5%'+$%505)',('*:$%'(4%5$60+$8%C14'@B%$($+-@%3+,6$5% '+$%50*5)'(),'::@%.,-.$+%,(%20+13$%).'(%,(%).$%DR%'(4%1).$+%,()$+('),1(':%6193$),)1+5B%&.,6.% *0+4$(5%2D%,(405)+,$5%&,).%'%5$A$+$%6193$),),A$%4,5'4A'()'-$%'(4%+$3+$5$()5%'(%,(6+$'5,(-% *0+4$(% /1+% RQ25% '(4% 3+,A')$% .105$.1:458% G(% ).')% 5$(5$% ).$% 2LL% ,5% /0::@% 6199,))$4% )1% 4,A$+5,/@,(-%10+%$($+-@%510+6$5%'(4%)1%).$%6193:$),1(%1/%).$%,()$+(':%$($+-@%9'+>$)8%C+0$% 6193$),),1(%&,::%.$:3%*+,(-%41&(%$($+-@%3+,6$58%V1%+$-,1(%1+%Q$9*$+%R)')$%5.10:4%+$9',(% ,51:')$4%/+19%20+13$'(%($)&1+>5%'/)$+%"E!W8%% ƵƌŽƉĞΖƐĞŶĞƌŐLJĚĞƉĞŶĚĞŶĐĞŝƐŽŶĞŽĨƚŚĞďŝŐŐĞƐƚĐŚĂůůĞŶŐĞƐĨŽƌƚŚĞĐŽŵƉĞƚŝƚŝǀĞŶĞƐƐŽĨŽƵƌ ĞĐŽŶŽŵŝĞƐ͘tĞŶĞĞĚĂĐŽŵŵŽŶĂƉƉƌŽĂĐŚĂŶĚƉƵďůŝĐƐƵƉƉŽƌƚƚŽƌĞĚƵĐĞƚŚŝƐĚĞƉĞŶĚĞŶĐLJ͕ĂƐ ǁĞůůĂƐĂĐůĞĂƌĐŽŵŵŽŶĂƉƉƌŽĂĐŚƚŽƉƌĞƐĞƌǀŝŶŐĂŶĚĞdžƉůŽŝƚŝŶŐĞŶĞƌŐLJƌĞƐŽƵƌĐĞƐǁŝƚŚŝŶƚŚĞ ƵƌŽƉĞĂŶ hŶŝŽŶ͕ ƌĞĚƵĐŝŶŐ ĞŶĞƌŐLJ ĐŽŶƐƵŵƉƚŝŽŶ ĂŶĚ ŝŶǀĞƐƚŝŶŐ ŝŶ ƌĞƐĞĂƌĐŚ ŽŶ ůŽǁ<ĞŶĞƌŐLJ ƚĞĐŚŶŽůŽŐŝĞƐ ĂŶĚ ƌĞŶĞǁĂďůĞ ĞŶĞƌŐLJ͘ ^ŝŐŶŝĨŝĐĂŶƚ ŝŶǀĞƐƚŵĞŶƚ ŝŶ ŶĞǁ ĂŶĚ ŝŶƚĞůůŝŐĞŶƚ ĞŶĞƌŐLJ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞŝƐŶĞĞĚĞĚƚŽƐĞĐƵƌĞƚŚĞƵŶŝŶƚĞƌƌƵƉƚĞĚƐƵƉƉůLJŽĨĞŶĞƌŐLJĂƚĂĨĨŽƌĚĂďůĞƉƌŝĐĞƐ͘ ^ƵĐŚ ŝŶǀĞƐƚŵĞŶƚƐ ĂƌĞ ǀŝƚĂů ĨŽƌ ũŽďƐ ĂŶĚ ƐƵƐƚĂŝŶĂďůĞ ŐƌŽǁƚŚ ĂŶĚ ǁŝůů ŚĞůƉ ĞŶŚĂŶĐĞ ĐŽŵƉĞƚŝƚŝǀĞŶĞƐƐ͘% !X! ! N'+=&')+!&,W!C*,BFK!&,W!.A,D'()!,)F!&,W!,A('F,)%.!! dĂdžĨƌĂƵĚ͕ƚĂdžĞǀĂƐŝŽŶĂŶĚƚĂdžĂǀŽŝĚĂŶĐĞƵŶĚĞƌŵŝŶĞĐŝƚŝnjĞŶ͛ƐƚƌƵƐƚŝŶƉƵďůŝĐĂĚŵŝŶŝƐƚƌĂƚŝŽŶ8% C.$5$%3+'6),6$5%'+$%0($).,6':%'(4%0(/',+%)1%).15$%&.1%&1+>%.'+4%'(4%61()+,*0)$%).$,+%/',+% 5.'+$% 1/% )'J$5% ,(% 1+4$+% /1+% 516,$)@% )1% /0(6),1(% 3+13$+:@B% '5% ,)% 5)$':5% +$510+6$5% /+19% ).$% /,('(6,(-%1/%$406'),1(B%30*:,6%.$':).%'(4%&$:/'+$8%%G)%4,5)1+)5%'%:$A$:%3:'@,(-%/,$:4B%6+$')$5%'(% 0(6193$),),A$%$(A,+1(9$()%/1+%6193'(,$5%'(4%0(4$+9,($5%).$%$//1+)5%1/%610()+,$5%5$$>,(-% )1%+$5)1+$%510(4%30*:,6%/,('(6$58%C'6>:,(-%)'J%$A'5,1(B%'44+$55,(-%*'(>%5$6+$6@%'(4%/,-.),(-% 91($@%:'0(4$+,(-%'+$%6+06,':%61931($()5%1/%'%/0(6),1(,(-%4$916+'6@8% C'J%/+'04B%)'J%$A'5,1(%'(4%)'J%'A1,4'(6$%'+$B%)1%'%:'+-$%$J)$()B%'%6+155<*1+4$+%3+1*:$98%C.$@% ).$+$/1+$%4$9'(4%'%6+155<*1+4$+%51:0),1(8%#$%&,::%/,-.)%/1+%).$%$5)'*:,5.9$()%1/%'%61991(% 4$/,(,),1(% 1/% 2D% )'J% .'A$(5% '(4% 4$6,5,A$% '6),1(% '-',(5)% ).$98% T).$+% ($&% 9$'50+$5% '+$% +$K0,+$4B%,(6:04,(-%,93+1A,(-%9$).145%05$4%)1%,4$(),/@%)'J3'@$+5%,(A1:A$4%,(%6+155%*1+4$+% )'J% $A'5,1(% 13$+'),1(5B% 5)+$(-).$(,(-% +0:$5% 1(% 90)0':% '55,5)'(6$% '(4% $(.'(6,(-% ).$% 611+4,('),1(%1/%)'J%5@5)$95%,(%).$%2D8%C.$5$%9$'50+$5%5.10:4%':51%,(6:04$%).$%$5)'*:,5.9$()% 1/%'%61991(%61(51:,4')$4%61+31+')$%)'J%*'5$8%C.$%2D%5.'::%':51%305.%/1+%.,-.$+%5)'(4'+45%1/% )+'(53'+$(6@%,(%,()$+('),1(':%/1+'B%506.%'5%).$%M"E8%2J,5),(-%*,:')$+':%'-+$$9$()5%*$)&$$(% '(@%2D%610()+@%'(4%).,+4%610()+,$5B%1+%1A$+5$'5%;0+,54,6),1(5B%5.'::%'33:@%$K0'::@%)1%'::%2D% 610()+,$5%,(%1+4$+%)1%$(50+$%'%:$A$:%3:'@,(-%/,$:48%% 8.C(*-')+!&=.!J')+@.!M,*T.&!&(!-,T.!'&!,!*.,@!.)+').!C(*!+*(>&=!!!! L+1A,4,(-%/1+%).$%/+$$%91A$9$()%1/%3$+51(5B%6'3,)':B%-1145%'(4%5$+A,6$5%'6+155%).$%20+13$'(% D(,1(%,5%'%>$@%31:,6@%)1%5),90:')$%$61(19,6%-+1&).%&,).10)%/0+).$+%,(6+$'5,(-%30*:,6%4$*)8% #$%905)%'6)%&,).%0+-$(6@B%*1).%')%).$%Q$9*$+%R)')$5%'(4%20+13$'(%:$A$:5B%)1%+$91A$%).$% +$9',(,(-%*'++,$+5%).')%.,(4$+%9'+>$)%'66$55%'(4%6193$),),1(%&.,:$%+$53$6),(-%61+$%:'*10+% 5)'(4'+45%'(4%516,':%+,-.)58%%G)%,5%1/%0)915)%,931+)'(6$%)1%$(50+$%).')%).$%R,(-:$%Q'+>$)%:'&5% '+$% ,93:$9$()$4% '(4% $(/1+6$4% 61++$6):@% *@% ).$% Q$9*$+% R)')$5% 51% ).')% 6,),7$(5% '(4% *05,($55$5%6'(%)+0:@%*$($/,)%/+19%).$%R,(-:$%Q'+>$)8%C.$%+$/1+9%1/%).$%2De5%R,(-:$%Q'+>$)%,5% ).$%*$5)%&'@%/1+%20+13$%)1%,(6+$'5$%).$%:$A$:%1/%6193$),),A$($55%'(4%+$)0+(%)1%-+1&).%'(4% '))',(%.,-.%:$A$:5%1/%$93:1@9$()8%C.$%,93:$9$()'),1(%1/%).$%R$+A,6$5%Z,+$6),A$%,5%).$+$/1+$% '(%0+-$()%3+,1+,)@8% !]! ! P+$'),(-%'%Z,-,)':%R,(-:$%Q'+>$)%,5%6+06,':B%5,(6$%,)%6'(%*$%'%4+,A$+%/1+%6193$),),A$($55%'(4% $61(19,6% -+1&).B% 3+1A,4,(-% ;1*5% /1+% .,-.:@% K0':,/,$4% &1+>$+5% &.,:$% ')% ).$% 5'9$% ),9$% 3+$5$(),(-%61(509$+5%&,).%'%&,4$+%6.1,6$%1/%-1145%')%6193$),),A$%3+,6$58%Y@%*+$'>,(-%41&(% *'++,$+5! /1+% 20+13$'(% 6193'(,$5% '(4% $()+$3+$($0+5B% ).$% 4,-,)':% $61(19@% 6'(% '6)% '5% '% 53$'+.$'4%/1+%6+$'),(-%;1*5%'(4%'6.,$A,(-%'%6193$),),A$%R,(-:$%Q'+>$)8%Y@%:,(>,(-%).$%4,-,)':% '-$(4'%&,).%).$%4$A$:139$()%1/%$<6199$+6$%'(4%($&%5$+A,6$5%506.%'5%$<.$':).B%$<)+'4$B%$< *'(>,(-%'(4%$<:$'+(,(-B%,93+1A,(-%4,-,)':%,(/+'5)+06)0+$%,5%3,A1)':%,(%13$(,(-%03%).$%R,(-:$% Q'+>$)8% C.$% 4,-,)':% $61(19@% .'5% *$619$% '% +$':,)@% '(4% .'5% 9'(@% '4A'()'-$5% /1+% 6,),7$(5% '::% 1A$+% 20+13$8%R05)',('*:$%'(4%5)+')$-,6%,(A$5)9$()%,(%>$@%$('*:,(-%)$6.(1:1-,$5%,5%'%4+,A,(-%/1+6$% )1% /15)$+% ).$% )$6.(1:1-,6':% '(4% $61(19,6% 6193$),),A$($55% 1/% 20+13$8% C.$5$% )$6.(1:1-,$5% $('*:$%).$%4$A$:139$()%1/%).15$%-1145%'(4%5$+A,6$5%).')%6'(%*$619$%3'+)%1/%$A$+@4'@%:,/$% ,(%).$%/0)0+$8%#$%&'()%)1%50331+)%).$5$%)$6.(1:1-,$5%*@%3+1A,4,(-%/0(4,(-%1331+)0(,),$5%)1% 9'>$% 20+13$% '(% '))+'6),A$% *05,($55% $(A,+1(9$()% /1+% ).$5$% ,(405)+,$5% '(4% )1% ,(6$(),A,5$% 6113$+'),1(%*$)&$$(%+$5$'+6.%,(5),)0),1(5B%,(405)+@%'(4%RQ258% Y@%'4A'(6,(-%'%)+0:@%)+'(5<20+13$'(%)+'(531+)'),1(%($)&1+>%&$%6'(%/'6,:,)')$%).$%91A$9$()% 1/%*1).%3$13:$%'(4%-11458%C.$%2D%5.10:4%)'>$%5)$35%)1%+$91A$%*1)):$($6>5B%$53$6,'::@%,(%).$% /1+9%1/%'49,(,5)+'),A$%'(4%)$6.(1:1-,6':%*'++,$+5%,(%1+4$+%)1%6+$')$%'%914$+(B%$//,6,$()%'(4% 505)',('*:$%20+13$'(%)+'(531+)'),1(%,(/+'5)+06)0+$8% J&*.)+&=.)')+!JM"D!! RQ25%'+$%).$%*'6>*1($%1/%).$%20+13$'(%$61(19@%'(4%3:'@%'%/0(4'9$()':%+1:$%,(%10+%$//1+)5% )1% 6+$')$% ($&% ;1*58% ?::% $//1+)5% 5.10:4% 61(),(0$% )1% +$5)1+$% :,K0,4,)@% )1% ).$% $61(19@% '(4% /'6,:,)')$% /,('(6,(-% 1/% ,(A$5)9$()B% 3'+),60:'+:@% &,).% +$53$6)% )1% RQ258% #$% +$6'::% ).')% '::% 2D% Q$9*$+%R)')$5%905)%+$53$6)%).$%'-+$$4%3+,(6,3:$%1/%).$%R9'::%Y05,($55%?6)%&.,6.%5),30:')$5% ).')% ,)% 5.10:4% 1(:@% )'>$% ).+$$% 4'@5% )1% 5)'+)% '% ($&% 6193'(@% ,(% ).$% 2D8% N0:$5% 5.10:4% *$% 5,93:,/,$4B%+$4%)'3$%5.10:4%*$%60)%'(4%RQ25%5.10:4%*$%-,A$(%+$':%1331+)0(,),$5%)1%-+1&%*@% 6199$+6,':,5,(-% ).$,+% 3+1406)5% '(4% 5$+A,6$5% /+$$:@% '6+155% ƚŚĞ hŶŝŽŶ͛Ɛ ^ŝŶŐůĞ DĂƌŬĞƚ '(4% *$@1(48% C.')% ,5% &.@% &$% $(610+'-$% ).$% /,(':,5'),1(% 1/% ).$% P1991(% 20+13$'(% R':$5% `'&% 3+1;$6)B% &.,6.% .'5% ).$% 31)$(),':% )1% 5,-(,/,6'():@% *$($/,)% 61(509$+5% *@% $(610+'-,(-% 91+$% 6+155<ďŽƌĚĞƌƐĂůĞƐ͕ƉĂƌƚŝĐƵůĂƌůLJďLJ^D ͛Ɛ͘% !U! ! #$%($$4%)1%6+$')$%).$%+,-.)%61(4,),1(5%/1+%RQ25B%$('*:,(-%).$9%)1%+$'6.%).$,+%/0::%31)$(),':8% L+13$+%9'+>$)%'66$55%'(4%'//1+4'*:$%,()$::$6)0':%3+13$+)@%+,-.)5%/1+%*1).%RQ2e5%'(4%:'+-$+% 6193'(,$5%&,::%,(6+$'5$%,(6$(),A$5%/1+%3+1/,)'*:$%,((1A'),1(8%#$%5.10:4%$(50+$%).')%).$%2D% +$9',(5% /,56'::@% 6193$),),A$% /1+% $()+$3+$($0+5% '(4% ,((1A')1+58% #$% &,::% /,-.)% /1+% 91+$% '66$55,*:$% NcZ% /0(4,(-% '(4% *$))$+% 9'+>$)% '66$55% /1+% RQ25% ).+10-.% $(50+,(-% ).')% 30*:,6% )$(4$+5% '+$% '::16')$4% ,(% 506.% &'@5% '5% )1% /15)$+% ,((1A'),1(8% C.+10-.% ).$% +$/1+9% 1/% ).$% *'(>,(-% 5$6)1+% ,(% 20+13$B% &$% &'()% )1% $(50+$% ).')% A,'*:$% 20+13$'(% RQ25% .'A$% '66$55% )1% '//1+4'*:$% 6+$4,)B% ,++$53$6),A$% 1/% ).$% 610()+@% 1/% ).$,+% $5)'*:,5.9$()8% C.$% 2PY% '(4% ).$% 2GY% 905)%.'A$%'(%'6),A$%+1:$%'(4%'413)%9$'50+$5%,(%1+4$+%)1%/'6,:,)')$% '66$55%)1% 6+$4,)%0(4$+% +$'51('*:$%61(4,),1(5%/1+%6193'(,$5B%$53$6,'::@%RQ258%Q15)%RQ25%'+$%/'9,:@%*05,($55$5%'(4% ).$+$%,5%'%53$6,/,6%/1605%1(%).$9%,(%).$%R9'::%Y05,($55%?6)L!R0331+)%5.10:4%*$%3+1A,4$4%1(%'(% $K0':%*'5,5%)1%/'9,:@%*05,($55$5%'(4%)1%5)'+)<0358%% ")DB*')+!,!='[email protected].@!(C!%()DB-.*!E*(&.%&'()! P1(509$+5%'+$%')%).$%.$'+)%1/%).$%R,(-:$%Q'+>$)%'(4%905)%*$%$931&$+$4%)1%9'>$%05$%1/% ).$,+% +,-.)5% '(4% *$% '::1&$4% )1% 9'>$% 4$6,5,1(5% /+$$:@8% P1(509$+% 3+1)$6),1(% 905)% *$% +$,(/1+6$4B%$53$6,'::@%,(%).$%61()$J)%1/%).$%4$A$:139$()%1/%).$%4,-,)':%9'+>$)B%)'>,(-%,()1% '6610()% 6+155<60)),(-% ,550$5% 506.% '5% 4')'% 3+1)$6),1(B% 1(:,($% '4A$+),5,(-% '(4% 0(/',+% 6199$+6,':% 3+'6),6$58% G(% 1+4$+% )1% $(50+$% '(% $//$6),A$% '(4% $//,6,$()% $(/1+6$9$()% 1/% ).$,+% +,-.)5B%61(509$+5%905)%.'A$%'66$55%)1%+$4+$55%9$6.'(,5958% 5)A.D&')+!')!"B*(E.,)!*.+'()DI!"B*(E.,)!D(@'F,*'&?!C(*!='+=.*!+*(>&=!,)F!%(-E.&'&'A.).DD! 261(19,6B%516,':%'(4%)$++,)1+,':%61.$5,1(%$('*:$5%'::%Q$9*$+%R)')$5B%'5%&$::%'5%+$-,1(':%'(4% :16':% '0).1+,),$5% b,(6:04,(-% ).$% 6,),$5dB% )1% 9'>$% ).$% *$5)% 05$% 1/% ,(A$5)9$()% 1331+)0(,),$5B% '661+4,(-%)1%).$,+%1&(%($$45B%)1%$(.'(6$%).$,+%6193$),),A$($558%P1.$5,1(%31:,6@%,5%':51%).$% ,(5)+09$()% )1% ,93:$9$()% ).$% 61991(% -1':5% 1/% ).$% 20+13$% "E"E% 5)+')$-@8% N$/1+9$4% 61.$5,1(% 31:,6@B% /1605,(-% 1(% ,((1A'),1(B% RQ25B% +$($&'*:$% $($+-@% '(4% $($+-@% $//,6,$(6@% '::1&5% /1+% 5)+')$-,6% 30*:,6% ,(A$5)9$()% ,(% '::% Q$9*$+% R)')$5% '(4% ,5% ).$+$/1+$% (1)% 1(:@% '(% ,(5)+09$()%&.,6.%3+191)$5%51:,4'+,)@B%*0)%':51%$(.'(6$5%6193$),),A$($55B% $(50+$5%$($+-@% 5$60+,)@%'(4%6+$')$5%;1*5%'(4%-+1&).%'::%1A$+%20+13$8%2//,6,$(6@%'(4%3+1406),A,)@%($$4%)1%*$% ).$%>$@%4+,A$+5%1/%61.$5,1(%31:,6@8%2A$+@%20+1%53$()%/+19%).$%2D%*04-$)%5.10:4%*+,(-%'44$4% A':0$%)1%).$%3+1;$6)5%,)%50331+)5%'(4%)1%).$%61990(,),$5%,(%&.,6.%).$%91($@%,5%53$()8%2D% "E! ! /0(4,(-%5.10:4%*$%05$4%)1%9'>$%).$%*$5)%3155,*:$%,93'6)%1(%,93+1A,(-%6193$),),A$($55%'(4% 6+$'),(-%;1*5%,(%20+13$8% :.-(+*,E='%!%=,@@.)+.D!,)F!=,*-()'D,&'()!(C!>(*T!,)F!C,-'@?! `1(-$+% :,/$% $J3$6)'(6@% 3+$5$()5% *1).% '% 6.'::$(-$% '(4% '(% 1331+)0(,)@% ')% ).$% 5'9$% ),9$8% C.$5$%6.'(-$5%&,::%'//$6)%3$(5,1(%5@5)$95B%.$':).%6'+$%5@5)$95B%.105,(-B%'55,5)'(6$%/1+%).$% $:4$+:@B%5$60+,)@B%91*,:,)@B%0+*'(%3:'((,(-B%)+'(531+)'),1(%'(4%)10+,598%R$(,1+5%.'A$%)1%*$% ,(A1:A$4%,(%).$%/1+90:'),1(%'(4%,93:$9$()'),1(%1/%).$%31:,6,$5%'413)$4%)1%613$%&,).%).$5$% 6.'(-$5%'(4%)1%3+$A$()%4,56+,9,('),1(B%'*05$%1+%31A$+)@8% C.$%516,':%'(4%$61(19,6%,93:,6'),1(5%1/%:1(-$+%:,/$%$J3$6)'(6@%'+$%(09$+1058%C.$%,93'6)%1(% 516,':% 5$60+,)@% 5@5)$95% ,5% 6+06,':8% #$% .'A$% )1% 4$/$(4% ,)% ,(% ).$% ,()$+$5)5% 1/% +$53$6)% '(4% ,()$+-$($+'),1(':% 51:,4'+,)@8% P1(6$+(,(-% .$':).% 31:,6,$5B% &$% .'A$% )1% 4$A$:13% '% 5)+')$-@% 6$()$+$4%1(%).$%61(6$3)%1/%g.$':).@%'-$,(-g%&.,6.%3+191)$5%:,/$:1(-%.$':).,$+%:,/$5)@:$58%% R)+1(-% /'9,:,$5% '+$% ':51% '% 3+$61(4,),1(% /1+% 315,),A$% 4$91-+'3.,6% 4$A$:139$()58% C.$% 2LL% +$61-(,5$5% ).$% /'9,:@% '5% ,++$3:'6$'*:$% '(4% '5% ).$% 61+$% ,(5),)0),1(% &.$+$% :1A$B% 6.'+,)@B% 5@93').@% '(4% .09'(% 51:,4'+,)@% '+$% 6.$+,5.$4% '(4% ,(5),::$4B% ).$+$*@% 0(,),(-% 4,//$+$()% -$($+'),1(58!#.,:$%6:$'+:@%.1(10+,(-%).$%,931+)'(6$%1/%).$%/'9,:@%/1+%+',5,(-%6.,:4+$(B%).$% 2LL%'4A16')$5%).')%3+1 ůƵĞ'ƌŽǁƚŚ͗ŵĂƌŝƚŝŵĞƉŽůŝĐŝĞƐĂƐĂƐŽƵƌĐĞŽĨŐƌŽǁƚŚĂŶĚƉƌŽƐƉĞƌŝƚLJ! dŚĞ^ĞĂŝƐĂƐŽƵƌĐĞŽĨƉƌŽƐƉĞƌŝƚLJĂŶĚŐƌŽǁƚŚƉŽƚĞŶƚŝĂůĨŽƌƚŚĞǁŚŽůĞŽĨ ƵƌŽƉĞ͘dŚŝƐŝƐǁŚLJ ƚŚĞ hΖƐ /ŶƚĞŐƌĂƚĞĚ DĂƌŝƚŝŵĞ WŽůŝĐLJ͕ ŵƵƐƚ ƐĞĞŬ ƚŽ ƉƌŽǀŝĚĞ Ă ŵŽƌĞ ĐŽŚĞƌĞŶƚ ĂƉƉƌŽĂĐŚ ƚŽ ŵĂƌŝƚŝŵĞ ŝƐƐƵĞƐ͕ ǁŝƚŚ ŝŶĐƌĞĂƐĞĚ ĐŽŽƌĚŝŶĂƚŝŽŶ ďĞƚǁĞĞŶ ĚŝĨĨĞƌĞŶƚ ƉŽůŝĐLJ ĂƌĞĂƐ ƚŚĂƚ ŝŶĐůƵĚĞ ŐƌŽǁƚŚ͕ ĞŶǀŝƌŽŶŵĞŶƚ͕ ƐŚŝƉƉŝŶŐ͕ ĨŝƐŚŝŶŐ͕ ƐĞĂ njŽŶĞƐ͕ ĐŽŶƚŝŶĞŶƚĂů ƐŚĞůĨ͕ ĞdžĐůƵƐŝǀĞ ĞĐŽŶŽŵŝĐ njŽŶĞƐ͕ĂŶĚĨŝƐŚŝŶŐnjŽŶĞƐ͘/ŶƚŚĞƐĞƉŽůŝĐLJĂƌĞĂƐƚŚĞƌĞĂƌĞƐĞĐƚŽƌƐŽĨƚŚĞŵĂƌŝƚŝŵĞĞĐŽŶŽŵLJ ǁŝƚŚ ŚŝŐŚ ŐƌŽǁƚŚ ƉŽƚĞŶƚŝĂů͕ ǁŚĞƌĞ ƚŚĞ h ƐŚŽƵůĚ ĨŽĐƵƐ ŝƚƐ ĂƚƚĞŶƚŝŽŶ ŽŶ͘ dŚŝƐ ŝŶĐůƵĚĞƐ ƚƌĂĚŝƚŝŽŶĂůŝŶĚƵƐƚƌŝĞƐ͕ƐƵĐŚĂƐŵĂƌŝŶĞƚŽƵƌŝƐŵĂŶĚĨŝƐŚĞƌŝĞƐ͕ĂŶĚ ƐĞĂĞŶĞƌŐLJĞdžƉůŽƌĂƚŝŽŶ ĂƐ ǁĞůů ĂƐ ĞŵĞƌŐŝŶŐ ĞĐŽŶŽŵŝĐ ƐĞĐƚŽƌƐ ƐƵĐŚ ĂƐ ƌĞŶĞǁĂďůĞ ĞŶĞƌŐLJ ƐŽƵƌĐĞƐ͕ ĂƋƵĂĐƵůƚƵƌĞ ĂŶĚ ŵĂƌŝŶĞďŝŽƚĞĐŚŶŽůŽŐŝĞƐ͘% "!! ! J,C.+B,*F')+!C((F!,)F!>,&.*!D.%B*'&?!! C.$%&1+:4͛Ɛ%3130:'),1(%,5%,(6+$'5,(-%')%'%+')$%1/%]E%9,::,1(%3$+%@$'+8%G)%,5%$J3$6)$4%)1%+$'6.% $,-.)%*,::,1(%3$13:$%*@%"E"W8%C.,5%3:'6$5%$A$+%-+$')$+%4$9'(45%1(%/114%5$60+,)@B%$53$6,'::@%,(% ).$%4$A$:13,(-%&1+:48%20+13$%).$+$/1+$%($$45%'%5)+1(-B%$//,6,$()%'(4%505)',('*:$%'-+,60:)0+':% 5$6)1+8% C1% $(50+$% ).$% /0)0+$% 1/% 20+13$'(% /'+9,(-B% &$% ($$4% '% *':'(6$4% '(4% 505)',('*:$% 61991(%'-+,60:)0+':%31:,6@%).')%$9*+'6$5%4,//$+$()%/'+9,(-%)$6.(,K0$5B%&,).%'%53$6,':%/1605% 1(%@10(-%/'+9$+5%'(4%).$%-+1&,(-%4$9'(4%/1+%:16':B%5$'51(':%'(4%1+-'(,6%3+1406)58%#$%':51% ($$4%)1%4$A$:13%5$+A,6$5%,(%+0+':%'+$'5%,(%1+4$+%)1%'A1,4%'%+0+':%$J1405B%$53$6,'::@%1/%@10(-% 3$13:$8% 20+13$% 905)% ':51% 50331+)% /,5.,(-% '(4% 'K0'60:)0+$% 3+1/$55,1(':5% &,).% '% 61991(% 31:,6@%)1%3+191)$%505)',('*:$%'(4%6193$),),A$%/,5.$+,$58%G/%&$%&'()%)1%9$$)%).$%4$9'(45%1/% ĂŐůŽďĂůŝƐĞĚǁŽƌůĚǁŚŝůĞƉƌŽƚĞĐƚŝŶŐ ƵƌŽƉĞ͛ƐĐŝƚŝnjĞŶƐǁĞŵƵƐƚ͗ĂͿĞŶƐƵƌĞƚŚĞƉƌŽĚƵĐƚŝŽŶ1/% .,-. #')$+% 5$60+,)@% ,5% 1($% 1/% ).$% 9',(% -:1*':% 6.'::$(-$5% 1/% ).$% "!5)% 6$()0+@8% Z0+,(-% ).$% ($J)% 4$6'4$B%)$(5,1(5%'(4%61(/:,6)5%1A$+%'66$55%)1%&')$+%'+$%:,>$:@%)1%*$619$%91+$%/+$K0$()%'(4% 610:4%$(4'(-$+%5)'*,:,)@%'(4%5$60+,)@%,(%9'(@%3'+)5%1/%).$%&1+:48%Z$91-+'3.,6%'(4%6:,9')$% 4$A$:139$()5% /0+).$+% 6193:,6')$% ).,5% 5,)0'),1(8% #$% .'A$% )1% &1+>% .'+4$+% '(4% /'5)$+% )1% $(.'(6$% 3'+)($+5.,35B% 3+191)$% 6113$+'),1(% 1(% 5.'+$4% &')$+5% '(4% 3+1315$% 505)',('*:$% 51:0),1(5%)1%&')$+%5$60+,)@%6.'::$(-$58%% JBD&,')')+!C((F!D,C.&?! 2D% 6,),7$(5% '+$% 91+$% '(4% 91+$% 4$9'(4,(-% '(4% 61(6$+($4% '*10)% ).$% K0':,)@B% 5'/$)@% '(4% 1+,-,(5% 1/% ).$,+% /1148% C.$% 2LL% 3'@5% 53$6,':% '))$(),1(% )1% ).$% )+'6$'*,:,)@% 1/% /114% 3+1406)5B% 3:'6,(-%'(%1*:,-'),1(%1(%3+1406$+5%)1%3+1A,4$%,(/1+9'),1(%51%).')%).$%61(509$+%6'(%4$6,4$% /1+% ).$95$:A$5% &.$).$+% 1+% (1)% )1% 30+6.'5$% ).$% 3+1406)8% G(/1+9'),1(% '(4% $406'),1(% '+$% $55$(),':%)1%$('*:,(-%10+%6,),7$(5%)1%9'>$%,(/1+9$4%6.1,6$58%#$%0(4$+:,($%).')%2D%6,),7$(5% .'A$% ).$% +,-.)% )1H% .,-. ""! ! )+'(53'+$(6@%'(4%)+'6$'*,:,)@%,(%).$%/114%6.',(\%6:$'+B%3+$6,5$%'(4%,(/1+9'),A$%/114%:'*$::,(-\% )+'4,),1(':%'(4%+$-,1(':%53$6,':,),$5%'(4%60,5,($58%% "FB%,&'()!! C.$%2LL%'))'6.$5%.,-.%,931+)'(6$%)1%).$%+1:$%1/%.,-. C.$%2LL%*$:,$A$5%).')%('),1(':%9,(1+,),$5%($$4%:$-':%5'/$-0'+45%)1%3+$5$+A$%'(4%3+1)$6)%).$,+% :'(-0'-$B%60:)0+$%'(4%,4$(),)@8%C.$%20+13$'(%D(,1(%5.10:4%4$A$:13%'%:$-,5:'),A$%/+'9$&1+>% /1+% ).$% 3+1)$6),1(% 1/% 3$+51(5% '(4% 61990(,),$5% *$:1(-,(-% )1% ('),1(':% 9,(1+,),$58% S0+).$+91+$% ).$% 2D% 5.10:4% $(610+'-$% ).')% *$5)% 3+'6),6$5% '+$% 5.'+$4% *$)&$$(% 9$9*$+% 5)')$58%% #*(A'F')+!,!CB&B*.!&(!?(B)+!E.(E@.! C.$%2LL%,5%6199,))$4%)1%@10(-%20+13$'(5B%;05)%'5%@10(-%20+13$'(5%'+$%6199,))$4%)1%).$% 20+13$'(%3+1;$6)8%#$%*$:,$A$%,(%).$%'*,:,)@%1/%@10(-%20+13$'(5%)1%6+$')$B%)1%-+1&B%'(4%)1% 3+153$+8%C.$%*$5)%$406')$4%-$($+'),1(%,(%).$%&1+:4%4$5$+A$5%91+$%'(4%6'(%'6.,$A$%91+$8% #,).%.'+4%&1+>B%&,).%6199,)9$()%'(4%+$531(5,*,:,)@B%).$%@10).%1/%20+13$%6'(%5)+$(-).$(% 10+%D(,1(8%% #$%'+$%).$%31:,),6':%/1+6$%).')%,(A,)$4%@10(-%3$13:$%)1%3'+),6,3')$%,(%).$%4$6,5,1(%9'>,(-% 3+16$55B%).$+$/1+$%&$%&$:619$%).$%3+1315':5%1/%@10(-%20+13$'(5%/+19%'::%1A$+%20+13$H% "I! ! x C1%.'A$%'%6193:$)$%,()$+(':%.,-.$+%$406'),1(%9'+>$)%*@%'6.,$A,(-H%S0::%+$61-(,),1(%1/% K0':,/,6'),1(5%'6+155%20+13$\%'%20+13$'(%/+'9$&1+>%/1+%$406'),1(%5)'(4'+45\%-+$')$+% 6113$+'),1(%,(%+$5$'+6.%'(4%,(6+$'5$4%91*,:,)@%1/%5)04$()5%'(4%:$6)0+$+5%*$@1(4%).$% $J,5),(-% 91*,:,)@% 3+1-+'99$5\% '0)19'),6% +$61-(,),1(% 1/% 4$-+$$5% ,(% '::% 2D% 9$9*$+% 5)')$5\% '% 0(,A$+5':% -+'40')$%4,3:19'% ,(% ).$% 2DB% &.,6.% &10:4% '::1&% /0::%/+$$419% 1/% 91A$9$()%1/%5)04$()5%'6+155%).$%2D8% x C1% ,()+1406$% 2D% $406'),1(% ,(% 56.11:5% '6+155% 20+13$% ,(% 1+4$+% )1% 3+$3'+$% ).$% ($J)% -$($+'),1(% /1+% /0)0+$% 6.'::$(-$5% '(4% )1% (0+)0+$% )1% '% 20+13$'(% '33+1'6.% )1&'+45% 505)',('*:$%4$A$:139$()8% x C1%:'0(6.%'(%'((0':%2D%O1*%S',+%&$$>%,(%.,-.$+%$406'),1(%,(5),)0),1(5%'6+155%).$%2D8% x C1%:'0(6.%'(%2D<531(51+$4%($)&1+>%/1+%@10(-%$()+$3+$($0+5%,(%1+4$+%)1%/'6,:,)')$%'(% $J6.'(-$% 1/% $J3$+,$(6$B% ,4$'5% '(4% )1% /15)$+% )+'(5*1+4$+% ;1,()% 3+1;$6)5% '(4% ,(A$5)9$()8% x C1%/1605%NcZ%'(4%,((1A'),1(%,(A$5)9$()%1(%*115),(-%).$%$61(19@%'(4%;1*%6+$'),1(8% x C1%.'+91(,5$%).$%3+16$40+$5%1/%$5)'*:,5.,(-%'%6193'(@%,(%'::%).$%2D%Q$9*$+%R)')$58% x C1%:'0(6.%'(%1//,6,':%2D%($)&1+>%/1+%61::'*1+'),1(%*$)&$$(%RQ25B%:'+-$%6193'(,$5% '(4%$406'),1(':%,(5),)0),1(58% x C1% 50331+)% ).$% /0::% ,93:$9$()'),1(% 1/% ).$% L1,()5% 1/% R,(-:$% P1()'6)% /1+% 5)'+)<035B% ,()+1406$4%*@%).$%20+13$'(%P199,55,1(%'(4%)1%/0+).$+%4$A$:13%).$%2DN2R%;1*5%5,)$8% D(,)$4B%&$%6'(%9'>$%50+$%).')%@10(-%3$13:$%:11>%')%).$%/0)0+$%&,).%13),9,59B%.13$%'(4% 61(/,4$(6$8% X(@B)&,*?!D.*A'%.D! i1:0()$$+,(-%,5%'%9';1+%)11:%/1+%(0+)0+,(-%6,A,:%516,$)@%'(4%5)+$(-).$(,(-%51:,4'+,)@%ʹ%1($%1/% ).$% 61+$% A':0$5% 1/% ).$% 2D% ʹ% '5% &$::% '5% '(% $55$(),':% 61931($()% ,(% 50331+),(-% 61990(,)@% 4$A$:139$()% 3+1-+'99$58% G)% 3:'@5% '% 6+06,':% +1:$% ,(% ,93+1A,(-% 516,':% 61.$5,1(B% 5.'3,(-% 516,$)@%'(4%3+1A,4,(-%3$13:$%&,).%($&%6193$)$(6$5%'(4%5>,::58%% "F! ! P+155<*1+4$+% A1:0()$$+,(-% ,(% 3'+),60:'+% -,A$5% @10(-% 20+13$'(% 6,),7$(5% 1331+)0(,),$5% /1+% ,()$+60:)0+':%$(+,6.9$()8%C.$%2LL%50331+)5%91+$%2D%/0(4,(-%/1+%A1:0()$$+,(-%'(4%.,-.:,-.)5% ,)5%516,':%4,9$(5,1(%'5%'(%$J3+$55,1(%1/%20+13$'(%6,),7$(5.,3%'5%&$::%'5%).$%.$':).B%$406'),1(% '(4%.09'(,)'+,'(%*$($/,)5%,)%3+1A,4$58%% "W! ! J"<;857Y!N98!";89#"$6!<575Z"6J!! R$60+,)@%/1+%6,),7$(5%,(%20+13$%,5%'%>$@%3+,1+,)@%/1+%058%%#.,:$%'550+,(-%).$%/+$$%91A$9$()%1/% 3$+51(5%&,).,(%).$%20+13$'(%D(,1(B%&$%.'A$%)1%41%).$%0)915)%)1%3+$A$()%6+,9,(':%'6)5%506.% '5%)$++1+,5)%'))'6>5B%6@*$+<'))'6>5B%1+-'(,5$4%6+,9$B%/+'04%'(4%61++03),1(8%#$%.'A$%)1%/,-.)% 6+,9,(':% '6)5% '5% &$::% '5% ).$,+% 6'05$58% #$% .'A$% )1% /,-.)% ($&% 6+,9,(':% ).+$')5% ).')% .'A$% $9$+-$4%,(%'+$'5%506.%'5%,()$::$6)0':%3+13$+)@B%,(4,A,40':%3+,A'6@%'(4%3$+51(':%,()$-+,)@8%% 9E.)!H(*F.*DK!'--'+*,&'()!,)F!')&.+*,&'()! C.$% R6.$(-$(% ?+$'B% &.,6.% *$($/,)5% [WE% 9,::,1(% )+'A$:$+5% '((0'::@B% ,5% 1($% 1/% ).$% -+$')$5)% '6.,$A$9$()5% 1/% ).$% 2D8% _1&$A$+B% ,)% ,5% '% 3+16$55% &.,6.% .'5% @$)% )1% *$% 6193:$)$48% C.$% 9'('-$9$()% 1/% ).$% R6.$(-$(% '-+$$9$()5% 905)% 3:'6$% 91+$% $93.'5,5% 1(% 31:,),6':% ƌĞƐƉŽŶƐŝďŝůŝƚLJ ƐĂŶĐƚŝŽŶŝŶŐ ĚĞĨĂƵůƚŝŶŐ DĞŵďĞƌ ^ƚĂƚĞƐ ĂŶĚ &ƌŽŶƚĞdž͛Ɛ +$510+6$5% 5.10:4% *$% +$,(/1+6$48% C.$% ,()$+(':% 91*,:,)@% 1/% K0':,/,$4% &1+>$+5% 6'(% 61()+,*0)$% )1% )'6>:,(-% :'*10+% 5.1+)'-$%,(%'%(09*$+%1/%9$9*$+%5)')$58%#.,:5)%.'A,(-%'*1:,5.$4%,()$+(':%*1+4$+5B%R6.$(-$(% 5)')$5%.'A$%':51%),-.)$($4%61()+1:5%')%).$,+%61991(%$J)$+(':%*1+4$+5%)1%$(50+$%).$%5$60+,)@% 1/%).15$%:,A,(-%'(4%)+'A$::,(-%&,).,(%).$%D(,1(8%2D%Q$9*$+%R)')$5%($$4%)1%6113$+')$%6:15$:@% 1(%*1+4$+%9'('-$9$()%)1%$(50+$%,()$+(':%5$60+,)@%,5%9',()',($48%2J)$+(':%*1+4$+5%'+$%3+1($% )1% ,++$-0:'+% 9,-+'),1(B% .09'(% )+'//,6>,(-B% ,::,6,)% '+95% '(4% 4+0-5% 6,+60:'),1(B% '5% &$::% '5% ,()$+('),1(':%)$++1+,598%S+1()$J%905)%*$%+$,(/1+6$48%C.$%2D%905)%':51%$//$6),A$:@%6113$+')$% ǁŝƚŚƚŚŝƌĚĐŽƵŶƚƌŝĞƐ͛ďŽƌĚĞƌƐĞĐƵƌŝƚLJĂƵƚŚŽƌŝƚŝĞƐƚŽƉƌĞǀĞŶƚĐƌŝŵĞĨƌŽŵƐƉŝůůŝŶŐŽǀĞƌ͘C.$%2LL% 0(4$+:,($5% ).$% ,931+)'(6$% 1/% '44+$55,(-% +11)% 6'05$5% 1/% 9,-+'),1(% /:1&5% *@% $(.'(6,(-% 6113$+'),1(% &,).% ).$% 610()+,$5% 1/% 1+,-,(% '(4% )+'(5,)B% ,(6:04,(-% ).+10-.% '33+13+,')$% 2D% 4$A$:139$()% 50331+)% '(4% '(% $//$6),A$% +$3')+,'),1(% 31:,6@8% ?)% ).$% 5'9$% ),9$B% A,6),95% 1/% 31:,),6':%'(4%+$:,-,105%3$+5$60),1(%905)%+$6$,A$%-$(0,($%3+1)$6),1(8%% WWďĞůŝĞǀĞƐƚŚĂƚǁŚĞŶĚĞĂůŝŶŐǁŝƚŚŝůůĞŐĂůŵŝŐƌĂƚŝŽŶ͕ǁĞŵƵƐƚ͗% x >ŝŶŬ ĨŝŶĂŶĐŝĂů ĂƐƐŝƐƚĂŶĐĞ ƚŽ ƚŚŝƌĚ ĐŽƵŶƚƌŝĞƐ ǁŝƚŚ ƚŚĞŝƌ ƉƌŽŐƌĞƐƐ ŽŶ ĨŝŐŚƚŝŶŐ ŝůůĞŐĂů ŵŝŐƌĂƚŝŽŶĂŶĚĐŽŽƉĞƌĂƚŝŶŐŽŶŝƐƐƵĞƐƐƵĐŚĂƐĂƐLJůƵŵ͕ƌĞĂĚŵŝƐƐŝŽŶĂŶĚƌĞƚƵƌŶƐ͘% x L+191)$%$J)+'%6113$+'),1(%'(4%5@($+-,$5%1/%P1'5)%M0'+4%R$+A,6$58% C.$% 2LL% 50331+)5% '% 61991(% 9,-+'),1(% 31:,6@B% &.,6.% ':51% +$/:$6)5% ($$45% ,(% 10+% :'*10+% 9'+>$)58% R19$% 1/% 10+% Q$9*$+% R)')$5% /'6$% '% 5.1+)'-$% 1/% K0':,/,$4% :'*10+% ).')% ,5% (1)% "[! ! 6193:$)$:@%9$)%/+19%&,).,(%).$%20+13$'(%D(,1(8%2A$(%,(%519$%Q$9*$+%R)')$5%&,).%.,-.$+% 0($93:1@9$()B%5.1+)'-$5%1/%K0':,/,$4%:'*10+%41%1660+8%% x C.$%2D%905)%+$9',(%6193$),),A$%1(%).$%-:1*':%:'*10+%9'+>$)B%&.,6.%,5%&.@%&$%($$4% 91+$%5>,::$4%3$13:$%,(%).$%2D8%% x #$%($$4%$(.'(6$4%6113$+'),1(%*$)&$$(%-1A$+(9$()5B%6,A,:%516,$)@%'(4%).$%3+,A')$% 5$6)1+8% x #$%905)%4$A$:13%'%9$).14%)1%+$61-(,5$%4,3:19'5%'(4%3+1/$55,1(':%K0':,/,6'),1(5%1/% (1(<2D%9,-+'()58%% x G()$-+'),1(% 31:,6,$5% /1+% 9,-+'()5% ,()1% 10+% 61990(,),$5% .'A$% )1% *$% 4$A$:13$4% '(4% 5)+$(-).$($48% G()$-+'),1(% ,5% '% )&1<&'@% +1'4% &.,6.% ,(A1:A$5% *1).% +,-.)5% '(4% +$531(5,*,:,),$58% $!"B*(E.,)!,D?@B-!D?D&.-! C.$%+,-.)%1/%'5@:09%/1+%3$13:$%/:$$,(-%).$,+%610()+@%1/%1+,-,(%/1+%/$'+%1/%3$+5$60),1(%.'5%)1%*$% +$53$6)$4% '(4% 3+1)$6)$48% 20+13$B% &,).% ,)5% 31:,),6':% '(4% $61(19,6% 5)'*,:,)@B% .'5% '% +$531(5,*,:,)@%)1%5.1&%51:,4'+,)@%'(4%3+1A,4$%5'/$)@%/1+%3$13:$%,(%($$48%C.,5%905)%*$%6'++,$4% 10)%0(4$+%61(4,),1(5%).')%'+$%;05)B%.09'(,)'+,'(%'(4%,(%'661+4'(6$%&,).%).$%+0:$%1/%:'&8%C.$% P1991(%20+13$'(%?5@:09%R@5)$9%'(4%).$%$5)'*:,5.9$()%1/%).$%20+13$'(%?5@:09%R0331+)% T//,6$% 3+1A,4$5% /1+% 5)'(4'+45% )1% K0':,/@% /1+% '5@:09B% % 9,(,909% 5)'(4'+45% /1+% +$6$3),1(% /'6,:,),$5% /1+% '5@:09% 5$$>$+5% '(4% ).$% $5)'*:,5.9$()% 1/% 20+14'6% /1+% ).$% 6193'+,51(% 1/% /,(-$+3+,()5% ,(% '::% Q$9*$+% R)')$58% C.,5% ,5% ).$% /10(4'),1(% 1/% 5.'+$4% +$531(5,*,:,)@% '(4% 51:,4'+,)@% ,(% ).,5% '+$'% *$)&$$(% Q$9*$+% R)')$58% V1&% '6),1(% ,5% ($6$55'+@% /1+% ,)% )1% *$% /0::@% ,93:$9$()$4H%% x #$%0(4$+:,($%10+%6:$'+%6199,)9$()%)1%).$%P.'+)$+%1/%S0(4'9$()':%N,-.)5%'(4%).$% 1*:,-'),1(5%1/%G()$+('),1(':%:'&B%,(6:04,(-%).$%M$($A'%P1(A$(),1(8%?5%Q$9*$+%R)')$5% &1+>%6:15$+%)1-$).$+%)1%,93:$9$()%'%61991(%'5@:09%5@5)$9B%:$-':%1331+)0(,),$5%/1+% ,(4,A,40':5%)1%,99,-+')$%)1%20+13$%905)%4$A$:13\%% x #$% .'A$% )1% ,93+1A$% ).$% ,93:$9$()'),1(% 1/% ).$% P1991(% ?5@:09% R@5)$9% '(4% $(.'(6$%3+'6),6':%6113$+'),1(%*$)&$$(%Q$9*$+%R)')$5\% "X! ! x #$% 905)% 5.1&% 51:,4'+,)@% &,).% ).,+4% 610()+,$5% ,(% )+10*:$4% +$-,1(5% ).')% 6'++@% ).$% :'+-$5)%+$531(5,*,:,)@%/1+%4,53:'6$4%3$+51(58%#$%($$4%)1%61(),(0$%)1%3+1A,4$%50331+)% )1%).$%D(,)$4%V'),1(5%N$/0-$$%?-$(6@%bDV_PNd\%% x #$%905)%)'6>:$%).$%'*05$%1/%'5@:09%5@5)$95\% x #$%($$4%)1%$J6.'(-$%*$5)%3+'6),6$5%*$)&$$(%Q$9*$+%R)')$5\% x C.$%2D%.'5%)1%*0,:4%3'+)($+5.,35%&,).%610()+,$5%1/%1+,-,(%'(4%)+'(5,)%'(4%.$:3%).$9%)1% 4$A$:13%).$,+%1&(%'5@:09%5@5)$958% 8.&B*)!,)F!A'D,!E(@'%?! #$%($$4%)1%4$A$:13%).$%($6$55'+@%3+$61(4,),1(5%/1+%'(%$//$6),A$%'(4%.09'($%5@5)$9%/1+% +$)0+(8% C.$% 2D͛Ɛ% 31:,6@% )1% /'6,:,)')$% A,5':$%,::$-':%,99,-+'),1(8% x #$%($$4%)1%4$A$:13%'(4%,93:$9$()%A1:0()'+@%+$'49,55,1(%3+1-+'95B%).$%$//$6),A$% 1+-'(,5'),1(%1/%+$)0+(5%'5%&$::%'5%,(6+$'5$4%6113$+'),1(%&,).%6193$)$()%'0).1+,),$5% ,(%610()+,$5%1/%1+,-,(%'(4%)+'(5,)8%% x ?%505)',('*:$%'5@:09%31:,6@%+$K0,+$5%)'6>:,(-%).$%+11)%6'05$5%1/%/1+6$4%9,-+'),1(%'(4% 4,53:'6$9$()8%C.$+$/1+$%).$%2D%.'5%'%5)+1(-%+1:$%)1%3:'@%,(%+$406,(-%/114%,(5$60+,)@B% '44+$55,(-%).$%61(5$K0$(6$5%1/%6:,9')$%6.'(-$%,(%/+'-,:$%4$A$:13,(-%610()+,$5%'(4% +$-,1(5% '(4% 5)+$(-).$(,(-% 4$916+'6@% '(4% ).$% +$53$6)% /1+% .09'(% +,-.)58% C.,5% +$531(5,*,:,)@% +$5)5% /,+5)%'(4% /1+$915)% &,).% ).$% ,(4,A,40':% Q$9*$+% R)')$58% Q$9*$+% R)')$5% 5.10:4% '::16')$% '4$K0')$% +$510+6$5% '(4% ,93:$9$()% ($6$55'+@% 9$'50+$5% )1% 9'>$% 50+$% ).')% +$)0+(% 4$6,5,1(5% '6)0'::@% :$'4% )1% ).$% +$)0+(% 1/% 3$+51(5% )1% ).$,+% 610()+,$5%1/%1+,-,(8%P113$+'),1(%')%2D%:$A$:%.'5%)1%*$%5)+$(-).$($4%)1%'::1&%/1+%).,58% N'+=&')+!(*+,)'D.F!%*'-.!,)F!%(**BE&'()! C.$%3+$A$(),1(%1/%'(4%/,-.)%'-',(5)%5$+,105%'(4%1+-'(,5$4%6+,9$B%$53$6,'::@%61++03),1(%'(4% 91($@%:'0(4$+,(-B%'+$%)13%3+,1+,),$5%'5%).$@%0(4$+9,($%).$%+0:$%1/%:'&B%/0(4'9$()':%+,-.)5B% -114%-1A$+('(6$%'(4%4$3+,A$%-1A$+(9$()5%1/%,931+)'()%+$A$(0$58%C.$5$%6+,9$5%.'+9%).$% 30*:,6%'(4%3+,A')$%5$6)1+5B%4$6+$'5$%).$%61(/,4$(6$%1/%).$%3130:'),1(B%).+$')$(%4$916+'6@B% ĚĂŵĂŐĞƚŚĞůĞŐĂůĞĐŽŶŽŵLJĂŶĚĚŝƐƚŽƌƚƚŚĞ h͛ƐŝŶƚĞƌŶĂůŵĂƌŬĞƚ͘% Q1+$1A$+B% +$6$()% 6'5$5% 1/% '::$-$4% 61++03),1(% ,(A1:A,(-% 2D% 31:,),6,'(5% 0(4$+9,($% ).$% 6+$4,*,:,)@% 1/% 2D% ,(5),)0),1(58% #$% .'A$% )1% 30)% '(% $(4% )1% 61++03)% '(4% (1(<)+'(53'+$()% "]! ! 3+'6),6$58%C.$%/,-.)%'-',(5)%61++03),1(%5.10:4%(1)%*$%'*05$4%/1+%31:,),6':%30+315$5%'(4%).$% -0'+'()$$%1/%'%/',+%)+,':%'(4%3+$5093),1(%1/%,((16$(6$%'+$%/0(4'9$()':%.09'(%+,-.)5%&.,6.% ($$4% )1% *$% +$53$6)$48% #$% *$:,$A$% ).')% )+'(53'+$()% 31:,),65% ,5% A,)':% /1+% ).$% /0)0+$% 1/% 4$916+'6@%'(4%&$%'+$%6199,))$4%)1%,93+1A,(-%)+'(53'+$(6@%'(4%5)+$(-).$(,(-%).$%+0:$%1/% :'&8%% tĞŶĞĞĚƚŽƐĂĨĞŐƵĂƌĚƚŚĞƌĞŐƵůĂƌĞĐŽŶŽŵLJĂŶĚĞŶƐƵƌĞŽƵƌĐŝƚŝnjĞŶƐ͛ƐĞĐƵƌŝƚLJ͘% x C.$% 2LL% 50331+)5% )'+-$),(-% '(4% 5$,7,(-% 6+,9,(':% '55$)5% /+19% 6+,9,(':% 1+-'(,5'),1(5% ).')%13$+')$%'6+155%('),1(':%*1+4$+58% x `'&% $(/1+6$9$()% '(4% ;04,6,':% 6113$+'),1(% *$)&$$(% Q$9*$+% R)')$5% '(4% &,).%).,+4% 610()+,$5% .'5%)1%*$%3+191)$48% #$% ($$4%)1%/,(4% 61991(% :$-,5:'),A$% 5)'(4'+45% '(4% 13$+'),1(':%)11:5%)1%$//$6),A$:@%619*')%6+,9$8%% x ?6),1(5%')%('),1(':%'(4%20+13$'(%:$A$:%.'A$%)1%$J)$(4%/+19%6+,9$%3+$A$(),1(%)1%:'&% $(/1+6$9$()B%'5%3+$A$(),(-%1+-'(,5$4%6+,9$%+$K0,+$5%'%90:),4,56,3:,('+@%'33+1'6.8%% x 2()$+3+,5$5%5.10:4%*$%$J6:04$4%/+19%3'+),6,3'),1(%,(%'(@%30*:,6%61()+'6)%).+10-.10)% ).$%2D%,/%).$@%.'A$%*$$(%/10(4%)1%.'A$%3'+),6,3')$4%,(%'%6+,9,(':%1+-'(,5'),1(B%91($@% :'0(4$+,(-%1+%'(@%1).$+%5$+,105%6+,9$8% x C.$% 2LL% 6'::5% /1+% 5&,/)% ,93:$9$()'),1(% 1/% '::% ($6$55'+@% +$/1+95B% ,(6:04,(-% ).$% '413),1(% 1/% :05)+'),1(% :$-,5:'),1(B% &.,6.% &,::% $(50+$% 61(5,5)$()% $(/1+6$9$()% 1/% ).$% +0:$% 1/% :'&% '(4% 4$916+'),6% 3+,(6,3:$5% ,(% '::% 315)<61990(,5)% 610()+,$5% &.$+$% ).$% 4$619315,),1(%1/%)1)':,)'+,'(%+$5,40$5%/',:$48%% x #$% ($$4% $J)+'4,),1(% '-+$$9$()5% &,).% ).,+4% 610()+,$5% '(4% 90)0':% :$-':% '55,5)'(6$% '-+$$9$()5B%'5%).$@%'+$%>$@%)1%/,-.),(-%1+-'(,5$4%6+,9$%')%'%-:1*':%:$A$:8%% x C+'//,6>,(-%,(%.09'(%*$,(-5%,5%).$%5:'A$+@%1/%10+%),9$8%G)%,5%'%5$+,105%6+,9$%'(4%'%)+'-,6% A,1:'),1(% 1/% .09'(% +,-.)58% #$% '6>(1&:$4-$% ).$% -$(4$+<53$6,/,6% '53$6)% 1/% .09'(% )+'//,6>,(-8% S,-0+$5% 5.1&% ).')% &19$(% '(4% -,+:5% '+$% ).$% 9',(% A,6),95% 1/% )+'//,6>,(-8% #1+>,(-%)1&'+45%).$%$:,9,('),1(%1/%)+'//,6>,(-%,(%.09'(%*$,(-5%6'((1)%*$%'6.,$A$4% &,).10)%5)+1(-%6113$+'),1(%'6+155%).$%2D%'(4%*$@1(48%?)%2D%:$A$:B%).$%/1605%905)%*$% 1(% 6+,9,(':% :'&% 3+1A,5,1(5B% ).$% 3+15$60),1(% 1/% 1//$(4$+5B% A,6),95e% 50331+)B% A,6),95e% +,-.)5% ,(% 6+,9,(':% 3+16$$4,(-5% '(4% $5)'*:,5.,(-% 3'+)($+5.,35B% ,(% 3'+),60:'+% &,).% 6,A,:% 516,$)@8% ?(%$).,6':%$(A,+1(9$()%905)%*$%60:),A')$48% "U! ! S.&&.*!E(@'%.K!UBF'%',@!,)F!%BD&(-D!%((E.*,&'()! L1:,6$B%;04,6,':%'(4%605)195%6113$+'),1(%,5%,()$(4$4%)1%$(50+$%'%-+$')$+%:$A$:%1/%5$60+,)@%/1+% 2D%6,),7$(58%C.$%20+13$'(%?++$5)%#'++'()%.'5%*$$(%1($%1/%).$%915)%5066$55/0:%)11:5%,(%).$% /,-.)%'-',(5)%6+,9$%'(4%,(%$(.'(6,(-%;04,6,':%6113$+'),1(8%#$%905)%'550+$%20+13$e5%6,),7$(5% ).')% ).$% $//$6),A$% 4,5+03),1(% 1/% 6+,9,(':% ($)&1+>5% ,5% *+10-.)% '*10)% *@% ).$% $//,6,$()% 611+4,('),1(% 1/% ,(A$5),-'),1(58% Q0)0':% )+05)% *$)&$$(% ;04,6,':% '49,(,5)+'),1(5% ,5% '% 3+,1+,)@8% Q1A,(-! 6:15$+% )1% '% -$(0,($% 20+13$'(% '+$'% 1/% 6,A,:% :'&% *@% ,93+1A,(-% ).$% +$-0:')1+@% $(A,+1(9$()%'(4%$//$6),A$($55%1/%;05),6$%5@5)$95%'6+155%).$%2D%.'5%':&'@5%*$$(%'%3+,1+,)@% /1+%).$%2LL8% x L'+),60:'+% '))$(),1(% .'5% )1% *$% -,A$(% )1% ).$% /0::% +$61-(,),1(% 1/% $A,4$(6$B% 5$()$(6$5% '(4%61(/,56'),1(%1+4$+5%,(%'::%Q$9*$+%R)')$58% x C.$%2LL%,5%,(%/'A10+%1/%'%20+13$'(%G(A$5),-'),1(%T+4$+%'5%,)%'44+$55$5%4,//,60:),$5%,(% 1*)',(,(-%,(/1+9'),1(%'(4%$A,4$(6$%,(%6+155<*1+4$+%6'5$58%% x #$% ($$4% )1% $(50+$% '% .,-.% :$A$:% 1/% 50331+)% '(4% 3+1)$6),1(% /1+% A,6),95% 1/% 6+,9$% +$-'+4:$55%1/%&.$+$%,(%).$%D(,1(%).$@%/'::%A,6),9%)1%).$%6+,9$8%% x C.$%2LL%&$:619$5%).$%6+$'),1(%1/%$//$6),A$%,(5)+09$()5%'(4%9$'50+$5%)1%61()+1:%).$% /:1&%1/%2D%91($@%&.,:5)%+$53$6),(-%).$%3+,(6,3:$%1/%50*5,4,'+,)@8! J&*.)+&=.)')+!E*'A,%?!&=*(B+=!F,&,!E*(&.%&'()! C.$%2LL%*$:,$A$5%).')%3+,A'6@%,5%'%/0(4'9$()':B%,(':,$('*:$%.09'(%+,-.)8%C.$%3+1-+$55%).')% .'5%*$$(%'6.,$A$4%1A$+%).$%:'5)%"E%@$'+5%5.1&5%).')%).$%4,-,)':%'-$%.'5%619$%)1%'//$6)%).$% $61(19@B%5$60+,)@%5)+')$-,$5B%61990(,6'),1(5B%5)')$%+$531(5,*,:,),$5%'5%&$::%'5%'::%*+'(6.$5% 1/%$A$+@4'@%:,/$8%% x C.$%+$/1+9%1/%4')'%3+1)$6),1(%+0:$5B%&.,6.%&'5%4+,A$(%*@%).$%2LLB%5$+A$5%)1%+$,(/1+6$% 3+,A'6@%/1+%6,),7$(5%'5%&$::%'5%,(6+$'5$%61(509$+%61(/,4$(6$%1(:,($B%&.,6.%3+1A,4$5%'% &$:619$%*115)%)1%).$%Z,-,)':%R,(-:$%Q'+>$)8% x C.,5%5$)%1/%+0:$5%&,::%'6.,$A$%-+$')$+%.'+91(,5'),1(%,(%).$%5,(-:$%9'+>$)8%_1&$A$+B%,)% ,5%$55$(),':%).')%).$%($&%+0:$5%5)+,>$%).$%+,-.)%*':'(6$%*$)&$$(%3+1)$6),(-%3$+51(':% 4')'%'(4% $(50+,(-% ).$%/+$$% /:1&% 1/% 4')'% ,(% ).$% 2D% 4,-,)':% 5,(-:$% 9'+>$)B% &.,6.% ,5% '% ($6$55'+@%61(4,),1(%)1%*$($/,)%/+19%).$%,((1A'),1(%31)$(),':%1/%).$%4,-,)':%$61(19@8% IE! ! C.$%($&%+$-0:'),1(%905)%(1)%,9315$%$J6$55,A$%'49,(,5)+'),A$%*0+4$(5%'(4%615)5%1(% *05,($55$5B%&.,6.%&10:4%.'A$%'%4$)+,9$()':%,93'6)%1(%,((1A'),1(8%% x L+,A'6@%:'&5%905)%(1)%*$%4$5,-($4%)1%,(/+,(-$%031(%/+$$%53$$6.%'(4%/+$$419%1/%).$% 3+$558% ! 5%'-',(5)%-1A$+(9$()5B%,(/1+9'),1(%5@5)$95B%,(405)+@B%*'(>5%'(4% *05,($55B%'5%&$::%'5%,(4,A,40':5B%$93.'5,5$%).$%($$4%/1+%'6),1(%)1%3+$A$()%'(4%'4$K0')$:@% +$'6)%)1%4'(-$+105%'))'6>58% C.$% 05$% 1/% 6@*$+53'6$% /1+% 6+,9,(':% '6),A,),$5% 1+% $53,1('-$% ,5% 50*;$6)% )1% +'3,4:@% $A1:A,(-% )$6.(1:1-,6':% 4$A$:139$()58% C.$% +$5,:,$(6$% 1/% ($)&1+>5% '(4% 6@*$+% 5$60+,)@% 5@5)$95% 4$3$(45%1(%'(%'4$K0')$%:$A$:%1/%3+$3'+$4($558%% x #$%($$4%)1%.'A$%$K0'::@%,((1A'),A$%'(4%/:$J,*:$%+$531(5$5B%+'(-,(-%/+19%50331+)% /1+% 6+155% *1+4$+% 6@*$+% ,(A$5),-'),1(5% '(4% ).$% )+',(,(-% 1/% 31:,6$B% )1% :$-,5:'),A$% 9$'50+$58%% x P113$+'),1(% '(4% ).$% $J6.'(-$% 1/% $J3$+),5$% '(4% ,(/1+9'),1(% '91(-% ).$% Q$9*$+% R)')$5%'(4%*$)&$$(%).$%30*:,6%'(4%).$%3+,A')$%5$6)1+5%.'5%)1%*$%,(6+$'5$48% x #$%($$4%)1%5)+$(-).$(%).$%$406'),1(%1/%).$%&,4$+%30*:,6%+$-'+4,(-%).$%6.'::$(-$5% 1(% 6@*$+% 53'6$% '(4% ).$% +'3,4% )$6.(1:1-,6':% 6.'(-$5% &$% /'6$B% &.,6.% '-',(% &,::% 61()+,*0)$%)1%,(6+$'5$4%6@*$+%5$60+,)@8%% 7=.!%*.,&'()!(C!,!%(--()!%'A'@',)!&,DT!C(*%.! G)% ,5% 3155,*:$% )1% 3+1A,4$% /1+% '% 61991(% 6,A,:,'(% )'5>% /1+6$H% ,)% &10:4% *$% 91+$% $//$6),A$% ,(% $(50+,(-%).')%.09'(,)'+,'(%6+,5$5%'+$%9'('-$4%,(%'%611+4,(')$4%&'@%'(4%&10:4%5@9*1:,5$% ŝŶƚŚĞĞLJĞƐŽĨ ƵƌŽƉĞĂŶĐŝƚŝnjĞŶƐ͕ĂƐǁĞůůĂƐǁŽƌůĚǁŝĚĞ͕ ƵƌŽƉĞ͛ƐĂďŝůŝƚLJƚŽďĞƵŶŝƚĞĚĂŶĚ -,A$%$J3+$55,1(%)1%'%61991(%.13$H%51:,4'+,)@%'91(-5)%('),1(58% I!! ! #"$<"!$6:!J7$S5[57Y!56!$!O[9S$[5J":!P98[:! ! $%&')+!&(+.&=.*!&(!E*(-(&.!(B*!A,@B.D!,)F!')&.*.D&D! 20+13$%.'5B%91+$%).'(%'(@%1).$+%61(),($()B%5.'3$4%).$%&1+:4%,(%&.,6.%&$%:,A$8%Y0)%)14'@B%,)% ,5%1($%1/%9'(@%3:'@$+5%'(4%31&$+%6$()+$5%'+10(4%'%-:1*$%1(%&.,6.%3$13:$B%6'3,)':%'(4%,4$'5% )+'A$:%/'5)$+%'(4%91+$%/+$K0$():@%).'(%$A$+%*$/1+$8%G(%).,5%&1+:4B%).$%20+13$'(%D(,1(%($$45% )1%+$3+$5$()%).$%,()$+$5)5%1/%,)5%6,),7$(5B%'(4%')%).$%5'9$%),9$%5)+,A$%)1%'6.,$A$%).$%*$5)%/1+% .09'(>,(48% G(% '% ),9$% &.$(% &$% '+$% ,(6+$'5,(-:@% ).+$')$($4% *@% -:1*':% 61(6$+(5B% 506.% '5% ,()$+('),1(':% )$++1+,59B% &$'31(5% 3+1:,/$+'),1(B% /',:$4% 5)')$5B% 6:,9')$% 6.'(-$B% (')0+':% 4,5'5)$+5%'(4%9'55%9,-+'),1(B%).$%2D%905)%+$'//,+9%,)5%A':0$5%,(%).$%$@$5%1/%).$%&1+:4%'(4%41% $A$+@).,(-% ,(% ,)5% 31&$+% )1% 4$/$(4% '(4% 3+191)$% ).$98% /Ŷ ƚŽĚĂLJ͛Ɛ ŐůŽďĂůŝ5$4% &1+:4B% ('),1(% 5)')$5%'6),(-%':1($%&,::%(1)%*$%6'3'*:$%)1%4$/$(4%10+%A':0$5%'(4%,()$+$5)58% N*(-!,!D')+@.!-.DD,+.!&(!%(--()!,%&'()! C.$%2D%905)%5)+$(-).$(%'(4%,(6+$'5$%).$%$//,6,$(6@%1/%).$%20+13$'(%2J)$+(':%?6),1(%R$+A,6$% ĂƐŝƚƐŵŽƐƚŝŵƉŽƌƚĂŶƚĨŽƌĞŝŐŶƉŽůŝĐLJŝŶƐƚƌƵŵĞŶƚ͘dŚĞ ƵƌŽƉĞĂŶWĂƌůŝĂŵĞŶƚ͛ƐƐĐƌƵƚŝŶLJ 1/%).$% P1991(%S1+$,-(%'(4%Z$/$(6$%L1:,6@%5.10:4%*$%$J3'(4$4%,(%1+4$+%)1%,(6+$'5$% 4$916+'),6% '6610()'*,:,)@8%T(:@%&,).%'%5)+1(-%20+13$'(%S1+$,-(%'(4%R$60+,)@%L1:,6@%&,::%&$%*$%'*:$%)1% 3+191)$% 10+% A':0$5% '(4% ,()$+$5)5% ,(% '% +'3,4:@% 6.'(-,(-% &1+:48% R)+1(-$+% :$'4$+5.,3% ')% ).$% .$'4%1/%).$%22?R%&,::%61()+,*0)$%)1%$(.'(6,(-%6113$+'),1(%*$)&$$(%).$%2D%'(4%).$%Q$9*$+% R)')$5B%,(6+$'5,(-%).$%;1,()%+$531(5,*,:,)@%1/%).$%2D%/1+$,-(%31:,6@%'91(-%).$%Q$9*$+%R)')$5B% &.,6.%&,::%,(%)0+(%/'6,:,)')$%).$%6+$'),1(%1/%'%61991(%20+13$'(%9$55'-$8%% J&*.)+&=.)')+!&=.!";͛Ɛ!E*.D.)%.!')!'&D!'--.F',&.!).'+=H(B*=((F! T0+% ,99$4,')$% ($,-.*10+.114% ,5%'% 510+6$% 1/% 6.'::$(-$5B% ($&% 1331+)0(,),$5%'(4% 31)$(),':% ).+$')5%).')%&$%&,::%(1)%*$%'*:$%)1%)'6>:$%'(4%1A$+619$%&,).10)%'%61(5,5)$()%2D%3+$5$(6$%,(% ).$5$%610()+,$5%'(4%'%6:$'+%1*;$6),A$%)1%4$A$:13%6:15$+%+$:'),1(5%&,).%).$9%,++$53$6),A$%1/% &.$).$+%1+%(1)%'%610()+@%,5%'%31)$(),':%2D%9$9*$+%5)')$8%C.$%$(:'+-$9$()%1/%).$%20+13$'(% D(,1(% ,5% ':51% 1($% 1/% ,)5% 5066$55% 5)1+,$5% *$6'05$% ,)% '::1&$4% ).$% 2D% )1% 53+$'4% /+$$419B% 4$916+'6@B% 3$'6$B% 5)'*,:,)@% '(4% ).$% +0:$% 1/% :'&% ).+10-.10)% 10+% 61(),($()8% #,).% ).$% :'5)% $(:'+-$9$()%+10(45B%).$%2D%.'5%9'('-$4%)1%$9*+'6$%915)%3'+)5%1/%).$%61(),($()8%G(%).$% /0)0+$B%,)%.'5%)1%*$%6:$'+%).')%*$619,(-%'%9$9*$+%1/%).$%20+13$'(%D(,1(%+$K0,+$5%(1)%1(:@% ).$%/0:/,::9$()%1/%31:,),6':%'(4%$61(19,6%6+,)$+,'%*0)%':51%).$%6'3'6,)@%1/%).$%2D%)1%,()$-+')$% I"! ! 905)%*$%)'>$(%,()1%'6610()8%C.$%,4$(),)@%'(4%).$%6'3'6,)@%1/%).$%2D%)1%'6)%.'A$%)1%+$9',(% ,()'6)8%! S*.,&=')+!).>!@'C.!')&(!(B*!*.@,&'()D!>'&=!&=.!P.D&.*)!S,@T,)!%(B)&*'.D! Y'+$:@% )&$()@% @$'+5% '-1B% ).$% Y':>'(5% &$+$% '% 3:'6$% 1/% 50//$+,(-% &'+% '(4% *:1145.$48% C.$+$/1+$B%).$%2D%905)%61(),(0$%)1%-,A$%'%.,-.%3+,1+,)@%)1%3$'6$B%5)'*,:,)@%'(4%+$61(6,:,'),1(% ,(%).,5%+$-,1(8%L+1-+$55%.'5%*$$(%9'4$H%P+1'),'%*$6'9$%).$%"]).%2D%Q$9*$+%R)')$%:'5)%@$'+\% 9$9*$+5.,3% ($-1),'),1(5% .'A$% 5)'+)$4% &,).% Q1()$($-+1% '(4% ).$@% &,::% 511(% *$-,(% &,).% R$+*,'B%/1::1&,(-%).$%:'(49'+>%2D _1&$A$+B%,(%519$%610()+,$5B%?:*'(,'B%S=NTQ%'(4%Y15(,'%'(4%_$+7$-1A,('B%).$%2D%3+$5$(6$% 905)% *$% 91+$% $//$6),A$% '(4% ,)5% 31:,6@% 91+$% /1605$4% 1(% /'6,:,)'),(-% 31:,),6':% 4,':1-0$% '(4% 61(5$(505% *0,:4,(-B% &.,6.% '+$% 1/)$(% 0(4$+9,($4% *@% ,()$+<$).(,6% )$(5,1(5% '(4% 9,5)+05)% *$)&$$(%61990(,),$58%C.$5$%4,A,5,1(5%+$3+$5$()%'%).+$')%)1%:1(-<)$+9%31:,),6':%5)'*,:,)@8%C.$% 3+153$6)% 1/% 2D% '66$55,1(% ($-1),'),1(5% 3+1A,4$5% :$A$+'-$% &.,6.% 9'@% *$% 05$4% )1% /15)$+% 31:,),6':B% $61(19,6% '(4% 516,$)':% +$/1+95% '(4% )1% +$5)+',(% ('),1(':,5)% )$(4$(6,$5% ,(% ).$% #$5)$+(% Y':>'(58! N$-,1(':% 6113$+'),1(% '(4% '%/0::% 6199,)9$()%)1%).$%-114% +$:'),1(5% &,).% ($,-.*10+5%'+$%$55$(),':%$:$9$()5%1/%'6.,$A,(-%).$5$%1*;$6),A$58% 8.3@,B)%=')+!&=.!",D&.*)!#,*&).*D='E! Z$5,-($4% '5% '% 9$'50+$% )1% 50331+)% $'5)$+(% 4$916+'6,$5B% ).$% 2'L% b2'5)$+(% L'+)($+5.,3d% ,5% *'5$4%1(%'%61990(,)@%1/%A':0$5%'(4%3+,(6,3:$5%1/%/+$$419B%4$916+'6@B%+$53$6)%/1+%.09'(% +,-.)5% '(4% /0(4'9$()':% /+$$4195B% '(4% ).$% +0:$% 1/% :'&8% ?:).10-.% ).$% 2'L% 610()+,$5% .'A$% 6199,))$4% ).$95$:A$5% )1% ).$5$% A':0$5B% 4,//$+$(6$5% '+$% $9$+-,(-% &,).,(% ).$% -+103% 1/% 2'L% 610()+,$5% 40$% )1% ).$9% 30+50,(-% 4,//$+$()% 1*;$6),A$5% '(4% /',:,(-% )1% 6199,)% /0::@% )1% 6:15$+% +$:'),1(5%&,).%).$%2D8% Q1+$1A$+B%).$5$%2'L%610()+,$5%'+$%0(4$+%61(5)'()%3+$550+$%/+19%N055,'B%&.,6.%,5%'))$93),(-% )1%0(4$+9,($%5$+,105:@%).$%2'L%,(%1+4$+%)1%+$5)1+$%,)5%,(/:0$(6$%1A$+%/1+9$+%R1A,$)%610()+,$5% ).+10-.%).$%$5)'*:,5.9$()%1/%'%P05)195%D(,1(%'(4%20+'5,'(%D(,1(8% C.$%2D%905)%+$9',(%6199,))$4%)1%50331+),(-%/+'-,:$%$'5)$+(%4$916+'6,$5H%% II! ! x C.$%2D%.'5%)1%4$A$:13$%'%($&%5$)%1/%,(6$(),A$5%'(4%5)+$(-).$(%).$%61()$()%1/%).$% 2'5)$+(%L'+)($+5.,3%&.,:$%1//$+,(-%'%6:$'+%3+153$6)%1/%/0+).$+%,()$-+'),1(%)1%).$5$%2'L% 610()+,$5%&,::,(-%)1%6199,)%).$95$:A$5%)1%).$%2DB%'(4%'6)%'661+4,(-:@8% x C.$% 2D% 905)% *$619$% 91+$% ,(A1:A$4% ,(% 5$$>,(-% '% +$51:0),1(% /1+% ).$% 3+1)+'6)$4% 61(/:,6)5% ,(% ).$% 2'L% 610()+,$5% bC+'(5(,5)+,'B% V'-1+(1 9CC.*')+!,!).>!A'D'()!C(*!&=.!M.F'&.**,).,)! Y1).% 5,4$5% 1/% ).$% Q$4,)$++'($'(% 5.'+$% '% 61991(% 4$5),(@8% C.$% +$-,1(% 1//$+5% )+$9$(4105% 1331+)0(,),$5B%*0)%':51%3+$5$()5%9'(@%6.'::$(-$58%C.$+$/1+$%,)%9$+,)5%53$6,':%'))$(),1(8! C.$%2D%905)%.'A$%'%61(6+$)$%A,5,1(%/1+%).,5%+$-,1(%'(4%3+1315$%($&%5)+')$-,$5%/1+%R10).$+(% Q$4,)$++'($'(%610()+,$58%C.,5%5)+')$-@%9'@%,(6:04$%:'0(6.,(-%3+1315':5%/1+%).$%D(,1(%/1+% ).$% Q$4,)$++'($'(% '(4% 4$)$+9,(,(-% .1&% )1% 1A$+619$% ).$% :,9,)5% 1/% ).$% *0+$'06+'),6B% )$6.(,6':%'(4%A'-0$%'33+1'6.%1/%).$%60++$()%20+13$'(%V$,-.*10+.114%L1:,6@%/1+%).$%R10).8% C.$%2D%&'5%(1)%'*:$%)1%'(),6,3')$%).$%?+'*%03+,5,(-5B%*0)%905)%'6),A$:@%50331+)%4$916+'),6% 4$A$:139$()5%,(%).$%+$-,1(8%T(:@%).$%3+19,5$%1/%5.'+$4%3+153$+,)@%6'(%+'::@%).$%50331+)%1/% ).$%&,4$+%30*:,6%,(%).$%+$-,1(8%C.$%1*;$6),A$%1/%6+$'),(-%'%3+153$+105B%4$916+'),6%'(4%5)'*:$% ($,-.*10+.114%905)%+$9',(%).$%>$@%3+,1+,)@%1/%).$%2D%,(%'::%1/%,)5%,()$+'6),1(5%&,).%610()+,$5% ,(%).$%R10).$+(%Q$4,)$++'($'(8%% IF! ! C.$%Q,44:$%2'5)%L$'6$%L+16$55%905)%':51%*$%'%3+,1+,)@%1/%).$%2D͛Ɛ%510).$+(%31:,6@8%C.$%2D% 905)%*$%91+$%'6),A$%'(4%91+$%A,5,*:$%,(%).$%5$'+6.%/1+%'%3$'6$/0:%5$)):$9$()%*@%61()+,*0),(-% )1%).$%,93:$9$()'),1(%1/%'%)&1<5)')$%51:0),1(%/1+%G5+'$:%'(4%L':$5),($8% C.$%+$6$()%4$A$:139$()5%,(%).$%2'5)$+(%Q$4,)$++'($'(B%3'+),60:'+:@%,(%R@+,'%'(4%,(%2-@3)B% 0(4$+:,($%).$%,931+)'(6$%1/%P@3+05%'5%'%20+13$'(%3,::'+%1/%5)'*,:,)@%,(%).$%+$-,1(8%G(%:,-.)%1/% ).$% ,931+)'()% 1,:% '(4% -'5% 4,561A$+,$5% ,(% ).$% 2'5)$+(% Q$4,)$++'($'(B% P@3+05% ':51% 3:'@5% '% ĐĞŶƚƌĂůƌŽůĞŝŶďŽůƐƚĞƌŝŶŐ h͛ƐĞŶĞƌŐLJƐĞĐƵƌŝƚLJ͘dŚĞƐĞĚĞǀĞůŽƉŵĞŶƚƐƵŶĚĞƌůŝŶĞƚŚĞŶĞĞĚ%/1+%'% 6193+$.$(5,A$%5$)):$9$()%1/%).$%P@3+05%K0$5),1(%*'5$4%1(%DV%R$60+,)@%P10(6,:%+$51:0),1(5% '(4%1(%).$% 3+,(6,3:$5% 1(% &.,6.%).$% 20+13$'(%D(,1(% ,5% /10(4$48% C.$+$/1+$B% C0+>$@% 5.10:4% )'>$%'::%($6$55'+@%5)$35B%,(6:04,(-%).$%&,).4+'&':%1/%)+1135B%)1%'A1,4%'(@%>,(4%1/%).+$')%1+% '6),1(%'-',(5)%'%Q$9*$+%R)')$%1+%510+6$%1/%/+,6),1(%1+%'6),1(5B%&.,6.%610:4%4'9'-$%-114% ($,-.*10+:@% +$:'),1(5% '(4% ).$% 3$'6$/0:% 5$)):$9$()% 1/% 4,530)$5H% ,93:$9$(),(-% ).$% ?(>'+'% L+1)161:B%.'(4,(-%1A$+%S'9'-05)'%)1%,)5%:'&/0:%,(.'*,)'()5B%+$53$6),(-%).$%51A$+$,-(%+,-.)5%1/% 2D% Q$9*$+% R)')$5% )1% $J3:1+$% '(4% $J3:1,)% ).$,+% (')0+':% +$510+6$5% ,(% '661+4'(6$% &,).% ,()$+('),1(':%:'&B%,(6:04,(-%).$%DV%P1(A$(),1(%1(%).$%`'&%1/%).$%R$'8% $!@.,F')+!*(@.!C(*!"B*(E.!')!,!C,D&!%=,)+')+!+@(H,@'G.F!>(*@F! G(%).$%61()$J)%1/%-:1*':%6193$),),1(%'(4%,()$+('),1(':%).+$')5B%'(4%')%'%),9$%&.$(%?9$+,6'%,5% 3:'6,(-% '% -+$')$+% $93.'5,5% 1(% 1).$+% +$-,1(5% 1/% ).$% &1+:4B% 20+13$% .'5% *$619$% 91+$% +$531(5,*:$%).'(%')%'(@%),9$%5,(6$%).$%R$61(4%#1+:4%#'+%/1+%,)5%1&(%3+153$+,)@%'(4%5$60+,)@8% C.$+$/1+$B%,)%905)%*$%91+$%'6),A$%,(%3+191),(-%'(4%3+1)$6),(-%).$%,()$+$5)5%1/%20+13$'(58% C.$% 2D% &,::% 1(:@% *$% '*:$% )1% 41% ).,5% ).+10-.% $(-'-,(-% ,(% 5)+')$-,6% 3'+)($+5.,35% '(4% *@% 4$A$:13,(-%'%($&%20+13$'(%5$60+,)@%5)+')$-@8% $!D&*()+!";3;J!E,*&).*D='E! C.$%2D%905)%9',()',(%'(4%4$A$:13%'%5)+1(-%)+'(5'):'(),6%3'+)($+5.,3%&,).%'%/+$$%'(4%/',+% 9'+>$)%*0,:)%1(%61991(%A':0$58%C1-$).$+B%).$%2D%'(4%).$%DR%6'(%'5509$%-:1*':%:$'4$+5.,3% ,(%4$A$:13,(-%5)+')$-,$5%)1%'44+$55%-:1*':%).+$')5%'(4%6.'::$(-$58%?%C+'(5'):'(),6%C+'4$%'(4% G(A$5)9$()%L'+)($+5.,3%bCCGLd!5.10:4%*$%).$%/,+5)%5)$3%)1&'+45%'%)+'(5'):'(),6%/+$$%9'+>$)B% &.,6.%5.10:4%$A1:A$%)1%,(6:04$%':51%`'),(%?9$+,6'(%610()+,$5%,(%).$%/0)0+$8%% C.$%CCGL%&,::%61()+,*0)$%)1%,(6+$'5$4%-+1&).B%&.,6.%&,::%6+$')$%91+$%;1*5%'(4%3+153$+,)@8%G)% &,::% ':51% '6)% )1% 5)+$(-).$(% ).$% -$131:,),6':% 5)'(4,(-% 1/% ).$% )+'(5'):'(),6% 61990(,)@8% IW! ! _1&$A$+B% ).$% ($-1),'),1(5% 1(% ).$% CCGL% 905)% )'>$% ,()1% '6610()% ).$% ,931+)'(6$% 1/% 5'/$-0'+4,(-%,931+)'()%$:$9$()5%1/%).$%2D͛Ɛ%,4$(),)@%'(4%3+1)$6)%.,-.%5)'(4'+458%% :.C.)F')+!C*..!&*,F.!,)F!(E.)!-,*T.&D!! 20+13$%+$3+$5$()5%!E8[f%1/%).$%-:1*':%3130:'),1(%'(4%IE8Ff%1/%-:1*':%MZL8%T).$+%+$-,1(5%1/% ).$%&1+:4%&,::%61(),(0$%)1%-',(%,(/:0$(6$%'(4%31&$+8%% T3$(% 9'+>$)5% '+$% '% 3+$+$K0,5,)$% /1+% $(50+,(-% 6193$),),A$($55% '(4% ).$% 4$A$:139$()% 1/% 20+13$'(% 6193'(,$5% '5% -:1*':% :$'4$+58% S+$$% )+'4$% '(4% '66$55% )1% -:1*':% 9'+>$)5% '+$% ,931+)'()% 6')':@5)5% /1+% ;1*% 6+$'),1(% '(4% -+1&).% '(4% '+$% 4$6,5,A$% /'6)1+5% ,(% $('*:,(-% 20+13$'(% 6193'(,$5% )1% *$619$% -:1*':% :$'4$+58% C.$% /+$$% )+'4$% '-$(4'% ($$45% ($&% 919$()09% ,(% ).$% /1+9% 1/% *,:')$+':% '(4% 90:),:')$+':% /+$$% )+'4$% '-+$$9$()5B% ,(6:04,(-% ).$% 6193:$),1(% 1/% ).$% Z1.'% N10(48% _09'(% '(4% :'*10+% +,-.)5B% '5% &$::% '5% $(A,+1(9$()':% 5)'(4'+45B%905)%*$%,(6:04$4%,(%'::%)+'4$%'-+$$9$()5%&,).%10+%3'+)($+58% dŚĞƌĞĨŽƌĞ͕ƚŚĞ h͛ƐƚƌĂĚĞƉŽůŝĐLJƐŚŽƵůĚďĞďĂƐĞĚŽŶ*':'(6,(-%13$(%9'+>$)5%&,).%).$%($$4% /1+% /',+% 6193$),),1(B% /',+% '(4% $K0,)'*:$% )+'4$% '-+$$9$()5% '(4% 505)',('*:$% 4$A$:139$()8% Y'++,$+5%)1%)+'4$%5.10:4%*$%$:,9,(')$4B%'(4%5)'(4'+45%.'+91(,5$48%#$%905)%+$5,5)%3130:,5)% )$93)'),1(5% /1+% 91+$% 3+1)$6),1(,59% '5% ,)% &10:4% $(4'(-$+% 3+153$+,)@B% *1).% ,(% 20+13$% '(4% '+10(4%).$%&1+:48%G93+1A$4%9'+>$)%'66$55%/1+%2D%6193'(,$5%905)%*$%-0'+'()$$4%,(%$'6.%1/% ).$%4,//$+$()%)+'4$%($-1),'),1(5%60++$():@%0(4$+&'@8%% `'),(%?9$+,6'%5)'(45%10)%'5%'%+$-,1(%&.,6.%5.'+$5%9'(@%A':0$5%'(4%,()$+$5)5B%.,5)1+@%'(4B% ,(6+$'5,(-:@B%$61(19,6%),$5%&,).%).$%2D8%?%(09*$+%1/%`'),(%?9$+,6'(%610()+,$5%'+$%5)+')$-,6% 3'+)($+5%1/%).$%2DB%5.'+,(-%61991(%1*;$6),A$5%1(%,550$5%506.%'5%6:,9')$%6.'(-$B%5$60+,)@B% -:1*':%-1A$+('(6$B%$61(19,6%,550$5B%4$A$:139$()B%$406'),1(B%).$%/,-.)%'-',(5)%31A$+)@%'(4% ,($K0':,)@8% C.$% 2D% 5.10:4% 61(),(0$% $(610+'-,(-% '(4% '55,5),(-% ).$% 3+16$55$5% 1/% +$-,1(':% ,()$-+'),1(% '(4% 6113$+'),1(8%Q1+$1A$+B% ).$% 2D%5.10:4% $(.'(6$% ,)5% $61(19,6% '(4% 31:,),6':% $(-'-$9$()% &,).% Q$J,61B% P.,:$B% P1:19*,'B% L$+0% '(4% P$()+':% ?9$+,6'% '(4% )+@% )1% -,A$% '% +$($&$4%,93$)05%)1%'%*':'(6$4%'(4%'9*,),105%'5516,'),1(%'-+$$9$()%&,).%Q2NPTRDN%51% ).')%($&%-+1&).%'(4%;1*5%6'(%*$%6+$')$4%1(%*1).%5,4$58% P.,('% ,5% '(% ,931+)'()% $61(19,6% 3'+)($+% '(4% 1($% 1/% ).$% -+$')$5)% $9$+-,(-% 31&$+5% ,(% ).$% &1+:48%C.$%+$6$():@%:'0(6.$4%)+'4$%)':>5%',9$4%')%6+$'),(-%'(%,(A$5)9$()%'-+$$9$()%&,).% P.,('% &,::% 6+$')$% 9';1+% 1331+)0(,),$5% /1+% 20+13$'(5% *05,($55$58% ?:).10-.% :,9,)$4% ,(% ,)5% I[! ! 5613$B%).,5%3'A$5%).$%&'@%/1+%($&%56$('+,15%,(%10+%)+'4$%+$:'),1(5%&,).%$9$+-,(-%31&$+58%?)% ).$%5'9$%),9$B%).$%2D%.'5%)1%5$)%.,-.%.$':).B%516,':%'(4%$(A,+1(9$()':% 5)'(4'+45%'(4%*$% $J)+$9$:@%A,-,:'()%,(%,)5%+$:'),1(5%&,).%P.,('B%3'+),60:'+:@%,(%+$:'),1(%)1%.09'(%+,-.)58% <()D&*B%&'A.!*.@,&'()D!>'&=!8BDD',! #,).%+$-'+4% )1% N055,'B%% ).$%% 2De5%% *,--$5)%% ($,-.*10+,(-%% 610()+@%% ,(%% ).$%% $'5)B%% ,)%% ,5%% ,931+)'()%% )1% 4$A$:13%6:15$%+$:'),1(5%,(%1+4$+%)1%6113$+')$%1(%,550$5%1/%61991(% ,()$+$5)%506.%'5%5)'*,:,)@%*$@1(4%).$% h͛Ɛ%$'5)$+(%*1+4$+B%$($+-@%5$60+,)@%'(4% ,()$+('),1(':% '//',+58%`,>$&,5$B%10+%+$:'),1(5%'+$%4$/,($4%*@%$61(19,6%,()$+<4$3$(4$(6$B%,(6+$'5,(-%6+155< *1+4$+% )+'//,6%'(4% :'+-$:@% 5.'+$4% 60:)0+':% +11)58% C.$+$/1+$B% '(% 13$(% '(4% 3+'6),6':% 4,':1-0$% 5.10:4%*$%61(406)$4%&,).%N055,'%,(%+$:'),1(%)1%'%+'(-$%1/%,931+)'()%,550$58%% x N$53$6)% /1+% .09'(% +,-.)5% '(4% /0(4'9$()':% /+$$4195% 5.10:4% 61(),(0$% )1% /,-0+$% 3+19,($():@%1(%).$%'-$(4'8%% x #$%&'()%N055,'%)1%4$A$:13%,()1%'%914$+(%610()+@B%31:,),6'::@%'(4%$61(19,6'::@8%#$% ':51% &,5.% )1% 50331+)% ,)5% *':'(6$4% ,()$-+'),1(% ,()1% ).$% 20+13$'(% '(4% ,()$+('),1(':% $61(19@8%% x dŚĞ ĚĞƉƚŚ ĂŶĚ ǁŝĚƚŚ ŽĨ h͛Ɛ ƌĞůĂƚŝŽŶƐ ǁŝƚŚ ZƵƐƐŝĂ ǀĞƌLJ ŵƵĐŚ ĚĞƉĞŶĚ5%1(% N055,'͛Ɛ &,::,(-($55%)1%/0:/,:%,)5%,()$+('),1(':%1*:,-'),1(5%)1%9',()',(%4$916+'),6%5)'(4'+45%'(4% ).$%+0:$%1/%:'&B%*0)%':51%1(%,)5%$61(19,6%1*:,-'),1(5%0(4$+%#CT%)+'4$%+0:$58%% x #$%5)+,A$%/1+%'%($&%3'+)($+5.,3%'-+$$9$()%*$)&$$(%).$%20+13$'(%D(,1(%'(4%N055,'B% '(%,()$(5,/,6'),1(%1/%).$%6113$+'),1(%*$)&$$(%).$%+$53$6),A$%6,A,:%516,$),$5B%'%50+A$@% 1/%A,5'%+$-0:'),1(5%,(%).$%:,-.)%1/%).$%4$A$:139$()%1/%2D ! ! IX! ! #*(-(&')+!=B-,)!*'+=&D!,)F!C'+=&')+!E(A.*&?!')!&=.!F.A.@(E')+!>(*@F! C.$% 2D% 5.10:4% +$/1+9% '(4% ,93+1A$% ,)5% 4$A$:139$()% 31:,6@% ,(% 1+4$+% )1% ,(6+$'5$% ,)5% $//$6),A$($55% '(4% '6610()'*,:,)@8% C.,5% ($&% 31:,6@% 905)% *$% *'5$4% 1(% ).$% 3+,(6,3:$5% 1/% 50*5,4,'+,)@%'(4%516,':%9'+>$)%$61(19@8%C.$%3+,A')$%5$6)1+%'(4%6,A,:%516,$)@%5.10:4%*$619$% /0::@%+$61-(,5$4%'5%3'+)($+5%,(%4$A$:139$()%':1(-5,4$%-1A$+(9$()58% _09'(%+,-.)5%'(4%).$%/,-.)%'-',(5)%31A$+)@%'+$%6$()+':%/'6)1+5%,(%4$A$:139$()%31:,6@8%C.$%2D% '(4% ).$% Q$9*$+% R)')$5% 5.10:4% 4$$3$(% ).$,+% 611+4,('),1(% ,(% 3:'((,(-B% 91(,)1+,(-% '(4% $A':0'),(-% 4$A$:139$()% 3+1;$6)58% C.$% 5)+$(-).$(,(-% 1/% '6610()'*,:,)@% '(4% )+'(53'+$(6@% ,(% -1A$+(9$()%,(5),)0),1(5%,5%,(4,53$(5'*:$%)1%).$%+0:$%1/%:'&%'(4%)1%).$%6+$'),1(%1/%3+153$+,)@% ,(%4$A$:13,(-%610()+,$58%C.,5%6'(%*$%*$5)%'6.,$A$4%*@%$931&$+,(-%6,A,:%516,$)@%'(4%'55,5),(-% ,(%,(5),)0),1(%*0,:4,(-8%L'+),60:'+%'))$(),1(%905)%*$%3',4%)1%$406'),1(B%5,(6$%$406'),1(%*0,:45% ).$% /10(4'),1(5% /1+% 505)',('*:$% '(4% ,(6:05,A$% -+1&).8% L+13$+)@% 1&($+5.,3B% RQ25% '(4% ).$% 3+,A')$% 5$6)1+% ,(% -$($+':% 5.10:4% *$% 50331+)$48% Z$916+'6@% '(4% .09'(% +,-.)5% '+$% ).$% /10(4'),1(%*:16>5%/1+%4$A$:139$()%'(4%-114%-1A$+('(6$8%% C.$% h ŵƵƐƚ ƉƌŽŵŽƚĞ͕ ĚĞĨĞŶĚ ĂŶĚ ƉƌŽƚĞĐƚ ǁŽŵĞŶΖƐ ĂŶĚ ĐŚŝůĚƌĞŶ͛Ɛ ƌŝŐŚƚƐ͕ ĞƐƉĞĐŝĂůůLJ ŝŶ 61(/:,6)%1+%315)%61(/:,6)%71($5%'(4%610()+,$58%C.$%2D%905)%/,-.)%A,1:$(6$%'-',(5)%&19$(%'(4% -,+:5%'(4%)'6>:$%.,-.%9')$+(':%91+)':,)@8%C.$%2D%($$45%)1%)+'(59,)%,)5%$J3$+),5$%*@%5.'+,(-% *$5)% 3+'6),6$5% '(4% *@% $931&$+,(-% &19$(8% P1::'*1+'),1(% &,).% VMT5% ).')% 3+191)$% ).$% '0)1(19@%1/%&19$(%,(%).$%311+$5)%610()+,$5%($$45%)1%*$%+$,(/1+6$4B%/1+%).$%5'>$%1/%).$% 4$A$:139$()%1/%).$5$%610()+,$58% G(% ).$% @$'+5% )1% 619$B% -:1*':% /114% 5$60+,)@B% '66$55% )1% /114% '(4% 5)'*:$% /114% 3+,6$5% '+$% '% 6.'::$(-$%/1+%*1).%4$A$:13$4%'(4%:$55%4$A$:13$4%610()+,$58%Y$6'05$%1/%).$%-+1&).%1/%).$% &1+:4%3130:'),1(B%).$%4$9'(4%/1+%/114%&,::%,(6+$'5$%4+'9'),6'::@B%&.,:5)%+'3,4%0+*'(,5'),1(% '(4%6:,9')$%6.'(-$%&,::%4,9,(,5.%5033:,$58%C.$5$%,9*':'(6$5%&,::%315$%'%).+$')%1/%+$($&$4% /'9,($B%*0)%).$@%&,::%':51%1//$+%'(%1331+)0(,)@%/1+%,(6+$'5$4%$93:1@9$()%'(4%,(619$%,(%).$% +0+':%'+$'5%1/%).$%&1+:48%C.$+$/1+$%4$A$:139$()%31:,6,$5%5.10:4%3+191)$%+0+':%4$A$:139$()% '(4%'-+,60:)0+':%3+1406),1(8%?)%).$%5'9$%),9$%).$%P1991(%?-+,60:)0+':%L1:,6,$5%1/%).$%2D% 5.10:4% ':51% *$% +$/1+9$4% ,(% ).$% :,-.)% 1/% 3155,*:$% ($&% 56'+6,),$5% &,).10)% +$51+),(-% )1% 3+1)$6),1(,59%1+%4093,(-8% I]! ! L1A$+)@%,5%(1)%1(:@%'%9'))$+%1/%,(619$B%*0)%':51B%91+$%/0(4'9$()'::@B%'%9'))$+%1/%*$,(-%'*:$% )1%:,A$%'%:,/$%,(%4,-(,)@%'(4%$(;1@%*'5,6%.09'(%+,-.)5%'(4%/+$$41958%C.$%2D%Q$9*$+%R)')$5% '(4%).$%2D%5.10:4%5),6>%)1%).$,+%3+19,5$5%'5%:',4%41&(%,(%).$% Q,::$((,09%Z$6:'+'),1(%'(4% 53$(4% ')% :$'5)% E8Xf% 1/% MZL% 1(% 4$A$:139$()% ',4% ,(% 1+4$+% )1% /,-.)% -:1*':% 31A$+)@8% C.$% 2D% 5.10:4% ':51% 61()+,*0)$% )1% '(% '9*,),105% /1::1&<03% 1/% ).$% 60++$()% Q,::$((,09% Z$A$:139$()% M1':5%3+1-+'99$8% $!-(*.!.CC.%&'A.!"B*(E.,)!F.C.)%.!E(@'%?!! #$%($$4%'%/+$5.%5)'+)%/1+%'%20+13$'(%4$/$(6$%31:,6@%).')%,5%4$5$+A,(-%1/%).$%('9$8%20+13$%,5% /'6$4% &,).% 1:4% ).+$')5% '(4% ($&% +,5>5% ,(% '% K0,6>:@% 6.'(-,(-% 5)+')$-,6% $(A,+1(9$()8% T0+% ?9$+,6'(%'::,$5%'+$%6:$'+:@%)$::,(-%05%).')%&$%905)%'5509$%).$%+$531(5,*,:,)@%)1%)'>$%6'+$%1/% ŽƵƌŽǁŶƐĞĐƵƌŝƚLJŝŶƚŚĞ h͛ƐŶĞŝŐŚďŽƵƌŚŽŽĚ͘ŶĚDĞŵďĞƌ^)')$5%'+$%61(),(0,(-%)1%9'>$% 0(611+4,(')$4%60)5%,(%4$/$(6$%53$(4,(-%&.,:$%.$5,)'),(-%)1%05$%).$%31)$(),':%1/%).$%`,5*1(% C+$')@%)1%9'>$%5$+,105%3+1-+$55%,(%$5)'*:,5.,(-%'%61991(%4$/$(6$%5)+')$-@8%% x G(%).$%($J)%/,A$%@$'+5B%).$%2D%905)%0(4$+)'>$%906.%91+$%5$+,105%$//1+)5%)1%311:%'(4% 5.'+$%,)5%Q$9*$+%RƚĂƚĞƐ͛ĚĞĨĞŶĐĞĐĂƉĂďŝůŝƚŝĞƐ͘% x G(%).$%5.1+)%)$+9B%,)%5.10:4%6'++@%10)%'%+$A,$&%1/%('),1(':%6'3'*,:,),$5%'(4%0+-$():@% 4$A$:13%*$))$+%&'@5%)1%:,(>%6,A,:,'(%'(4%9,:,)'+@%5)+06)0+$5%'(4%3$+51(($:8%% x G(% ).$% 9$4,09% )$+9B% ).$% 2D% ($$45% )1% 5$)% 03% '% 5)+')$-,6% 9,:,)'+@% '(4% 6,A,:,'(% .$'4K0'+)$+58%G)%5.10:4%:'0(6.%'%#.,)$%Y11>%1(%R$60+,)@%'(4%Z$/$(6$%&.,6.%4$/,($5% 10+%,()$+$5)5%'(4%5$)5%10)%5$60+,)@%3+,1+,),$5%'(4%1*;$6),A$58%C.,5%&,::%.$:3%)1%3+1A,4$% 91+$%'(4%*$))$+%/,))$4%6,A,:,'(%'(4%9,:,)'+@%3$+51(($:%,(%).$%5$+A,6$%1/%9,55,1(5%0(4$+% ).$%P1991(%R$60+,)@%'(4%Z$/$(6$%L1:,6@8%% x G(% ).$% :1(-% )$+9B% ).$+$% 5.10:4% *$% +$-0:'+% /1+9':% P10(6,:% 9$$),(-5% 1(% 20+13$'(% 4$/$(6$B%'%51:,4%20+13$'(%,(405)+,':%*'5,5%/1+%4$/$(6$%'(4%)$6.(1:1-@B%'(4%5)'(4*@% /1+6$5%0(4$+%2D%6199'(48%% ?::%).,5%&,::%.$:3%)1%9'>$%).$%2D%'%+$-,1(':%5$60+,)@%3+1A,4$+%'(4%')%).$%5'9$%),9$%'%5)+1(-% 20+13$'(%3,::'+%1/%).$%V1+).%?):'(),6%?::,'(6$8% C.$% 3'+),6,3'),1(% 1/% ).$% 2D% ,(% ,()$+('),1(':% 6+,5,5% 3+$A$(),1(B% ).$% 50331+)% 1/% 4$916+'6@% &1+:4&,4$B%).$%/,-.)%'-',(5)%)$++1+,59%'(4%&1+>,(-%)1%+$51:A$%,()$+('),1(':%61(/:,6)5%905)%*$% 6$()+':%$:$9$()5%1/%'%/0)0+$%20+13$'(%S1+$,-(%L1:,6@8%P1991(%R$60+,)@%'(4%Z$/$(6$%L1:,6@% IU! ! 5.10:4% *$% *'5$4% 1(% 61(A,(6,(-% 4,3:19'6@B% '% 510(4% $61(19,6% *'5$% '(4% '4$K0')$% '+9$4% /1+6$58% C.,5% $()',:5% ).$% 6+$'),1(% 1/% ($&% )11:5B% 506.% '5% ).$% $5)'*:,5.9$()% 1/% '% 3$+9'($()% 13$+'),1(':%6,A,:,'(%'(4%9,:,)'+@%.$'4K0'+)$+5%/1+%*$))$+%611+4,('),1(B%3:'((,(-%'(4%61(406)% 1/% 13$+'),1(5B% '5% &$::% '5% *$))$+% $K0,39$()% 3+160+$9$()% ).+10-.% ).$% 20+13$'(% Z$/$(6$% ?-$(6@8%G)%':51%+$K0,+$5%).')%).$%2D%')%1(6$%$J3+$55$5%).$%31:,),6':%&,::%)1%)'>$%'4A'()'-$%1/% ).$%/0::%+'(-$%1/%$J,5),(-%5)+06)0+$5B%(1)'*:@%).$%Y')):$%M+10358%% C.$%1(:@%&'@%)1%'6.,$A$%).,5%,5% *@%4$A$:13,(-%20+13$'(%9,:,)'+@%6'3'*,:,),$5%).+10-.%615)< $//$6),A$%51:0),1(5%*@%311:,(-%'(4%5.'+,(-%+$510+6$58%G(%1).$+%&1+45B%'%91+$%6193$),),A$%'(4% $//,6,$()%2D%4$/$(6$%'(4%5$60+,)@%5$6)1+%,5%($$4$48% C.$%2D%Q$9*$+%R)')$5B%&.,6.%'+$%&,::,(-%)1%6113$+')$%6:15$:@B%905)%9'>$%/0::%05$%1/%).$% `,5*1(%C+$')@%3+1A,5,1(%,(%6+$'),(-%).$%L$+9'($()%R)+06)0+$4%P113$+'),1(B%,(%&.,6.%(1)%'::% Q$9*$+%R)')$5%.'A$%)1%3'+),6,3')$8%Q1+$1A$+B%).$%4$/$(6$%9'+>$)%905)%*$%,()$-+')$4%,()1% ).$%R,(-:$%Q'+>$)8% FE! ! ! 62 ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! 20-6E'.='+,-./*01'!.C4034868! ! ! ! "#$!,*'0B!(7!%&'()$*+!C(=.*-.202!Y,%CZ!F'.+>2!0(>$0#$'!@V!C(=.*-.20S!C(=.*-!G$/(='*0.=!*+8!E*F(&'! ,*'0.$2!(7!0#$!%&'()$*+!N+.(+!*+8!+$.>#F('.+>!=(&+0'.$2?!"#$!,%C!%&'()$*+!,*'-.*/$+0!$-$=0.(+! =*/)*.>+!6.--!)&0!)$()-$!*0!.02!=('$!*+8!'$7-$=0!0#$!,%C!=(//.0/$+0!0(!0#$!=(//(+!5*-&$2!(7! 8$/(='*=BS!$[&*-.0BS!2(-.8*'.0B!*+8!2(=.*-!\&20.=$?!R+!0#$!'&+Q&)!0(!0#$!%&'()$*+!$-$=0.(+2S!0#$!,%C! 6.--!2)$*'#$*8!*!]=(//(+!=*+8.8*0$1!=*/)*.>+!0(!>.5$!)$()-$!*!2*B!.+!6#(!0#$!+$^0!%&'()$*+! I(//.22.(+!,'$2.8$+0!2#(&-8!F$?!"#$!,%C!6.--!)'(5.8$!.+7('/*0.(+!*+8!=(+0*=02!0(!.02!/$/F$'! )*'0.$2!*+8!6.--!8'*70!*!2./)-$!0$+!)(.+0!/*+.7$20(!0(!]7'*/$1!0#$!$-$=0.(+?! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:; 63 64 !"#$%&'($()*#(+,%"-* PES MANIFESTO Adopted by the PES Election Congress in Rome on 1 March 2014 European Parliament elections 22 - 25 May 2014 Party of European Socialists 98, rue du Tône, B-1050 -Brussels AISBL - BBCE - N°0897.208.032 Parti Socialiste Européen T +32 2 548 90 80 F + 32 2 230 17 66 [email protected] www.pes.eu www.pes.eu The Manifesto received fi nancial support from the European Parliament. Sole liability rests with the author and the European Parliament is not responsible for any use that may be made of the information contained therein. Towards a new Europe - PES MANIFESTO Adopted by the PES Election Congress in Rome on 1 March 2014 We strongly believe that the European Union must change. This May, in the European Parliament elections, your vote will give us the opportunity to deliver the EU that you deserve. A Europe that progresses, a Europe that protects, a Europe that performs. Our political family of parties across 28 countries will dedicate themselves to fi ghting for a secure future for you. The right wing has created a Europe of fear and austerity. During 5 years of an EU conservative majority, we have fought for a strong, socially just and democratic Europe. But now it is time to lead from the front. To do that we need your support, your help, your vote. Our programme for the next 5 years of the European Union will bring back job creation, a productive economy, a sense of community and respect for people. We want to put you as a citizen and as a voter back in charge and bring back hope to Europe’s youth. This May for the fi rst time you will have a say in who runs Europe. Your vote will decide who the next President of the European Commission is. To change the right-wing majority in the European Union, the only vote that counts is a vote for European Socialists, Social-Democrats, Labour, Democrats and progressives. 65 66 Towards a new Europe - PES MANIFESTO Adopted by the PES Election Congress in Rome on 1 March 2014 02 It is time to relaunch the economy A Union that progresses Austerity-only policy has harmed the Eurozone that understands the our economies and punished those social effects of those decisions I. least responsible for causing the on your community. The European crisis. To create jobs and relaunch Parliament and national Parliaments the economy, we will prioritize must keep their sovereignty and It is time to put jobs fi rst innovation, research, training and be fully involved in the exercise of 01 a smart reindustrialization policy, the democratic control over these so that amazing breakthroughs policies. The legacy of the Troikas in This is our fi rst and main priority: to social dumping, by ending the discovered in European laboratories this regard is a clear failure. After the Europeans, women and men, must practice of exploiting workers and and universities can be translated end of the Troika missions, another have a decent job that allows a precarious contracts that harm many into more jobs for workers in Europe. model within the framework of the good quality of life. Yet here is the Europeans. We want to promote Our solution is more room for EU Treaties should be established, legacy of the economic policies of social justice. We will insist on manoeuvre for investments through which has to be democratic, socially “Europeans, the last fi ve years, in stark fi gures: strong rules to guarantee equal national budgets that expand rather responsible and credible. We will be nearly 27 million Europeans who pay for equal work, the protection than shrink our economy. While the tough guardians of public money, women and want to work cannot fi nd a job, of workers’ rights and quality crisis has demonstrated that the Euro enhancing the quality of public including nearly a quarter of our jobs; on reinforcing trade unions’ canact as an effective buffer, the last spending, cutting out waste and men, must young people. 120 million in Europe rights, social dialogue and anti- 5 years have shown that the European directing expenditure to get the are at or under the poverty threshold. discrimination legislation; improving Economic and Monetary Union’s best value for Europe’s people. The Creating jobs for young people is a the protection of workers posted in construction is still incomplete. It has fi ght against tax fraud, tax evasion have a challenge which will defi ne us, for a different country by revising the shown the importance of mutualising (which represents about €1 trillion this generation and the next, and Posting of Workers Directive; and responsibility and rights within every year) and tax competition are decent job.” will remain a key priority for us as promoting better cooperation at the Eurozone. We will bring down key priorities for a just tax system. part of our long-term commitment to European level on labour inspections. defi cits in a sustainable and fair way Halving tax evasion by 2020, and full employment. Central to our job We will introduce decent minimum and manage public debt in Europe cracking down on tax havens are our strategy is the full implementation of wages across Europe, established with new instruments. We want to key priorities. We will also promote our Youth Guarantee plan. To make either by law or through collective put in place a real coordination of tax rules that ensure transparency it successful, we will substantially bargaining. The jobs we create must the economic and fi scal policies in and prevent tax dodging. increase its budget and extend it allow all our citizens to participate to everyone under the age of 30. in the economy as proud equals. All To create jobs, we will introduce trade agreements, including the one Putting the fi nancial sector at the service of the an ambitious European industrial currently under negotiation with the citizens and the real economy policy and will support our Social United States, must be bound to 03 Economy and our Small and Medium the protection of people´s human Enterprises. We will promote and social rights, decent work, Europeans had to pay for the of taxpayers’ money. Over 5 years, innovative green technologies and environmental standards, culture as mistakes and irresponsibility of an the fi nance sector has said that it improve the performance of our well as corporate social responsibility unregulated fi nancial sector. The has learned from its mistakes. We economies. We want to put an end and fair trade. rescue of banks has cost €1.6 trillion will make sure that never again will Towards a new Europe - PES MANIFESTO Adopted by the PES Election Congress in Rome on 1 March 2014 banks gamble with citizens lives. between Commercial and Investment Instead we must actively put in place Banking. We will cap bankers’ bonuses A Union of equality and women’s rights the framework that will make the and will speed up the introduction of 05 fi nancial sector work for the real the Financial Transaction Tax that we The principle of equality must be Violence against women must be economy and contribute its fair share have been supporting for years as a fair at the heart of what it means to be ended. Reconciling professional and to society. Regulation will force banks contribution of the fi nancial sector to a European citizen. We all benefi t family life must mean promoting to serve your communities instead society. We will insist on the creation of from living in a more equal society. balance not sacrifi ce, and promoting of stripping them. Investors should an independent and public European Ensuring, promoting and enhancing women’s free choice and access to take responsibility for the losses of credit rating agency. We will continue women’s rights and gender equality sexual and reproductive rights, must banks, not only for their gains. We our efforts to build a robust Banking remains one of our highest priorities. be urgently and vigorously protected will further regulate the banking Union that is designed to protect We need a binding commitment to in the face of a conservative backlash. sector, curb fi nancial speculation European citizens and to give equal end the gender pay and pension gap. We will be relentless in our fi ght and implement adequate fi rewalls and fair access to credit in Europe. “We will fi ght Towards a Social Europe 04 A Union that protects for a Europe II. that respects The right wing has used neoliberal targets on employment, education policies to cut provisions that and social cohesion are essential. everybody’s have helped people bounce back Social policy objectives must be against all forms of racism, sexism, We will safeguard the rights and well- after tough times. We will fi ght respected in all European policies. homophobia, transphobia and being of children, and ensure that no for a Europe that leaves no one We need to ensure that the EU is intolerance. We stand for the values person is denied a job, a position, a rights and behind. A decent income, the quality a real Social Union as much as it of equality and of non-discrimination future or any other fundamental right and affordability of education, of is an Economic Union: economic and promote that women and men because of the colour of their skin, obligations.” housing, including social housing, of freedoms cannot outweigh social must equally share work, share power, sexual orientation, identity, religion, healthcare, childcare and elderly care, rights. We will give opportunities for share time and share roles, both in age, gender, disability, political opinion as well as the adequacy of pensions Europeans to develop their potential the public and in the private realms. or any form of discrimination. are crucial components of our by investing in education, skills, societies. To achieve these aims, the childcare provision, life-long learning, EU must support Member States in culture, student mobility, research, the effective and fair redistribution and knowledge. A Union of diversity of wealth and opportunities. Binding 06 Against rising extremism, we will the societies they are living in. “We will fi ght for a Europe that fi ght for a Europe that respects Freedom of movement is a right everybody’s rights and obligations, and a founding principle of the not one that is based on prejudice, EU. The rights of citizens and their leaves no one behind.” hate and division. Everybody legally recognised families must must have a real opportunity to be respected, while we must fi ght participate and contribute to against fraud and abuse. 67 68 Towards a new Europe - PES MANIFESTO Adopted by the PES Election Congress in Rome on 1 March 2014 True solidarity among all EU member right mechanisms to share the states has to be shown in migration responsibilities. We want effective and asylum policy to avoid more integration and participation human tragedies, and suffi cient policies, assistance to the countries A Union that performs resources allocated. In order to save migrants have left. The fi ght against lives, Europe and its Member States human traffi cking must be reinforced. III. More democracy and participation must act in solidarity and have the 08 For the fi rst time in EU history, you a prominent role for the European A Safe and Healthy life for all will have a direct say to designate Parliament that has legislative, 07 the President of the European budgetary and control powers, as Commission. We are proud to the EU institution representing its lead this real step towards a more citizens. Decisions must be taken European citizens deserve to the digital agenda and guarantee democratic Europe, and to have paved at the most appropriate level, be it live a safe and healthy life. broad access to the internet. the way that other political parties local, regional, national or European, We want stronger rules that give We need solid EU legislation on the now also follow. The European Union in the interest of European citizens. consumers power. We will protect protection of citizens’ personal data is a political union which ensures All policies must be effi cient, respect Europeans’ right to enjoy safe food, and access to information. Striking the equality of its citizens, and democratic values, fi ght corruption safe products and a safe living the right balance between privacy, the equality of its states. European and serve citizens in an open and environment. We recognize the freedom, and security is vital. The EU citizens, civil society, and social transparent way. We will put in place strategic role of agriculture and should guarantee citizens’ right to actors must have full democratic effective European responses to fi sheries for our societies, and want security by promoing cooperation participation and control in European breaches of fundamental rights, to promote a sustainable and thriving in the fi ght against organised and Union decisions. We will promote democracy and the rule of law. rural development. The EU must crossborder crime. adapt to new challenges, especially 09 A Green Europe The EU must regain global energy effi ciency. We will promote “For the fi rst time in EU leadership on the protection of the implementation of Project nature and natural resources and Bonds to fi nance good investments history, you will have a direct the fi ght against pollution and in the green economy, renewable climate change. This requires both energy and technology. Production, close cooperation with our global consumption and mobility patterns say to designate the partners and leading by example. We must change and the use of recycling will support clean technology and must improve. This way we will reduce President of the European environmentally friendly production. pressure on scarce natural resources As we approach the 2020 deadline, and help citizens to reduce their Commission.” we will therefore support further energy bills and their ecological binding targets on the reduction of footprint. We will fi ght energy carbon emissions, the increased use poverty and will guarantee minimum of renewable energy and improved access to energy for everyone. Towards a new Europe - PES MANIFESTO Adopted by the PES Election Congress in Rome on 1 March 2014 Promoting Europe’s infl uence in the world 10 The European Union must carry the support the people struggling universal principles of democracy, for democracy, social justice, peace and respect for human rights, non- discrimination and freedom including women’s and children’s against any form of occupation rights. In a globalised and changing everywhere in the world. We will world, with confl icts and growing support the Eastern Partnership inequalities, Europe must be a as an important instrument to global player. We must build strong bring countries closer to EU and alliances to respond to common will promote strong relations with challenges. We want Europe to have the Mediterranean region. We must a strong voice and the proper tools to maintain support for European lead in promoting peace, democracy, enlargement. Fundamental rights and shared prosperity throughout and European values must continue the world. Europe combines defence, to be respected unequivocally in development, trade and diplomacy any future accession. We must fi ght “Together, we efforts to maximize the positive global imbalances and poverty effects in its foreign policy. The EU by promoting policy coherence will change must be an effective agent of peace for development and making the abroad and an effi cient promoter Millennium Development Goals and Europe.” of defence cooperation. We must the UN post 2015 agenda a success. With these 10 projects we, Socialists, Social Democrats, Labour, Democrats and Progressives, will change Europe over the next 5 years. We count on your vote and we will act tirelessly on your behalf. Together, we will change Europe. 69 ! 70 ! ! ! ! ' ' ' ' ' ' ' ' $33401C*'.='F4G*-038'01>'H*5.C-068'=.-'+,-./*! ! ! ! "#$!D--.*+=$!(7!E.F$'*-2!*+8!G$/(='*02!7('!%&'()$!YDEG%Z!,*'0B!.2!0#$!)*'0B!7('!-.F$'*-!8$/(='*0! 5*-&$2!.+!%&'()$?!_.0#!/('$!0#*+!@@!-.F$'*-!/$/F$'!)*'0.$2!*='(22!0#$!=(+0.+$+0S!.0!.2!0'*+2-*0.+>! 0#$!)'.+=.)-$!(7!7'$$8(/!.+0(!)(-.0.=2S!$=(+(/.=2!*+8!*--!(0#$'!*'$*2!(7!2(=.$0B?!!L(&+8$8!.+!;WUX! F$7('$!0#$!7.'20!%&'()$*+!$-$=0.(+2S!.0!6*2!$20*F-.2#$8!*2!0#$!7.'20!0'&$!0'*+2+*0.(+*-!)(-.0.=*-!)*'0B! .+!;WWV?!"#$!DEG%!,*'0B!)'(5.8$2!*+!.+='$*2.+>-B!5.0*-!-.+T!F$06$$+!=.0.`$+2!*+8!0#$!%N!.+20.0&0.(+2S! *+8!=(+0.+&$2!0(!>'(6!.+!2.`$!*+8!2.>+.7.=*+=$?! ! ! ! ! ! ! ! ! ! ! ! !! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:; 71 A EUROPE THAT WORKS EUROPEAN LIBERALS ARE THE FIRST TO ADOPT ELECTION MANIFESTO In 2014, we will have the opportunity to shape the future of Europe at a crucial time in the history of our continent. In this election, the choice you make can weaken Europe or make it stronger. European Liberals are committed to building a stronger Europe to defend our common interests and values. We want a Europe with authority on the world stage. We want a Europe that boosts the economy and creates jobs. We want a Europe that is more transparent and accountable. A Europe that protects the safety and security of its citizens. A Europe of tolerance and equality, with strong civil rights and liberties. A Europe based on genuine democracy and the will of its citizens. A Europe that takes the lead in fi ghting climate change. A Europe that works for us all. Liberals want a Europe which inspires trust, not fear; promotes prosperity and unity, not division. Civil liberties and freedom are the foundations of a liberal Europe and explain the attraction of the European model for the world. Civil liberties are the very foundations of our wealth and we need to defend them when they are threatened. We want a Europe that respects and encourages individual choices and keeps its promise that everyone has the opportunity to improve their own life. 72 2 Our priority is to better address the serious economic challenges we face throughout Europe. The recession and record unemployment, including youth unemployment, threaten the long-term future of our communities. A stable and prosperous Europe needs to be built on better policies. We believe in a Europe that is answerable to you and works for you. European Liberals have a strong track record of making Europe more accountable, more transparent and more effective. We will continue to pursue strategies and take action that will lead us out of the current crisis and will create long-term growth. We believe in competition, removing obstacles to trade and effective regulation of the market. We will continue to fight protectionism and government interference where they undermine job growth and hinder prosperity at regional, national and EU level. Creating jobs and opportunities Liberal policies have proven to create jobs and improve peoples’ lives. We can do more with your support. We believe in the power and success of the European single market, which has created millions of jobs. We will prioritise the completion and expansion of the single market, not least in services, identify and create new opportunities for economic growth and greater innovation, and boost the EU’s competitiveness. Eliminating excessive national rules and regulations as well as border controls, and ensuring free movement of workers, have helped businesses to be stronger and more competitive. However, much more can and should be done to complete the single market and simplify doing business in Europe. We will reinforce the single market in energy, the digital market, financial services, transport and healthcare sectors, while further facilitating the free movement of services and workers. We will work for an EU-US free trade agreement that could boost the European economy by over 100 billion euros annually. We will also strive for free trade agreements with other major economic regions. Small and medium-sized enterprises (SMEs) drive prosperity in Europe. We will facilitate the creation of more jobs through easier access to finance, simpler rules for investment funds to support new, innovative businesses across Europe, and opportunities for young entrepreneurs. 73 3 The EU must become a leader in start-ups and in new innovative technology companies. The digital economy is vital to jobs. We will work to create a modern economy that simplifies life through more e-services, and stimulates e-commerce by improving faster internet access, guaranteeing an open internet, fighting for net neutrality and creating a genuine single market in telecommunications, including the phasing out of mobile phone voice and data roaming charges by 2016, and unjustified prices for calling or texting across borders. We support the establishment of favourable financial and taxation frameworks to encourage the setting up of new businesses. Investment must be welcomed in Europe. We believe that the greatest social and economic crisis now facing Europe is unemployment, especially among young people. These European elections must be about identifying opportunities through employment, education and training and this is the top priority for those elected as ALDE Members of the European Parliament. Apprenticeship diplomas and university diplomas must be freely recognised across borders. Dual training, university and enterprise across borders must be strengthened. We support the notion of a ‘fifth freedom’: the free movement of knowledge – including greater mobility for students, academics and researchers – between member states, so as to encourage inventions and discovery. Transitioning into sustainable development through a resource-efficient and low-carbon economy with a stronger emphasis on renewable energy will create new jobs and make us less reliant on energy imports. We will work for a functioning emission trading system to reduce CO2 emissions, and will work to strengthen it as a driver for innovation and energy-efficient solutions. An effective and well-functioning carbon market is a key tool to reduce greenhouse gas emissions cost-effectively. This includes investment in a pan-European electricity grid and building even more upon renewable energy sources. We will promote a long- term and stable policy framework to promote energy and resource efficiency. This must include member states and the European Union working together to increase energy efficiency, decarbonise energy generation, develop carbon capture and storage technology, promote recycling, reuse and efficiency in the use of natural resources, and phase out environmentally harmful subsidies, including those for fossil fuel production and consumption. We will support the shift of EU support under structural and cohesion funds towards research and investment into future oriented sectors such as the renewable energy sources sector. 74 4 In the process of creating these new jobs, we will also ensure environmental and ecological sustainability for future generations. Setting new priorities We need to rethink the whole budget process. We believe in a larger strategic objective to determine how our money is best spent. We call for an extensive reform of the financial system of the Union, both revenues and expenditure, ensuring that no countries contribute disproportionally. Budget decisions should take into consideration how best to increase the number of jobs and improve people’s lives and the welfare of our communities. The budget must be growth-oriented. We need to focus on innovation, research and development and support better education. Liberals are committed to making better use of your money by continuing to cut administrative budgets and lead the fight for a single seat for the European Parliament. The original goal of improving people’s lives has been overshadowed by bureaucratic bookkeeping. Wasteful subsidies must be abolished. We will work towards a real and fundamental shift in the next EU budget so that you will benefit more. EU money must be spent on creating jobs and not to subsidise income. We want to reduce and simplify EU rules so that they are easier to apply and enforce in order to avoid waste and error. Member states should provide declarations that EU money is not only spent legally but also provides added value. EU structural funds must be directed towards job creation, particularly for youth, and greater innovation. EU funds should also be directed towards research, which adds value and gives tools to researchers, PhD students and universities. Access to funds intended to improve people’s lives must be time-limited, with entitlement lost if goals are not met within a specified period. We will work for a sustainable economy that respects the natural environment. Over 40 billion euros are spent on agricultural subsidies every year. Agricultural subsidies in other countries distort the level playing field for European farmers. We want an international reduction of support and a further modernisation of the Common Agricultural Policy towards efficiency and more market orientation. 75 5 As Liberals we support a continuous CAP reform. However, we stress that the general rules prohibiting state aid to national industries, companies and products should also apply to the Common Agricultural Policy, thus preventing a renationalisation of agricultural subsidies. We aim to ensure a more transparent and less bureaucratic CAP implementation. EU money must be spent on creating jobs and maintaining food security and safety in all member states. We support agricultural policy that is balanced between all three pillars of sustainability: economic, environmental and social. This will help farmers to produce more with less. We will make sure that family farmers and people in rural areas who preserve the landscape and encourage environmentally-friendly tourism benefit fairly from the Common Agricultural Policy. We will shift EU support from agricultural subsidies to modern and environmentally- friendly agricultural technologies to maintain food production and sustainable livestock farming while helping local communities. We support investment in research, modern technologies and their translation into practice in all sectors of agriculture, fisheries and rural development. European Liberals have led the reform of the common fisheries policy, notably to end discards and to decentralise decision-making. Restoring stable finances Just as European citizens are expected to balance their household budgets and live within their means, we must ensure healthy public finances. We want a Union in which the criteria of the Stability Pact are adhered to by both the Union and its member states. The currency union can only be sustained if solidarity is combined with solid fiscal responsibility. Fiscal solidarity depends on fiscal discipline which avoids moral hazard and does not reduce economic incentives for sound public finance. Agreeing to these principles is not enough. We will continue to lead efforts to hold accountable those who flout the rules. We will work for the rapid implementation of a banking union in the Eurozone with a common legal basis for supervision and resolution of banks. We will establish a common mechanism to wind down insolvent banks in order to avoid costs for the taxpayer. We will create better control mechanisms and more automatic sanctions when the stability and growth pact is broken. 76 6 We want both Eurozone and non-Eurozone countries to remain fully involved in the Union’s decision-making on economic issues of common concern, as our economic futures are inextricably bound together. While we are committed to the principle of tax competition, we are convinced that we need to do more to fight tax avoidance and evasion. Stronger in the world and safer at home While some want to highlight and exploit our differences, we believe our shared values and unity allow us to defend our common interests in the world and individual rights at home. Our strength will help us create jobs and improve people’s lives both within Europe and beyond our borders. We will promote human rights and protect the vulnerable both within the EU and beyond our borders. For Liberals EU enlargement remains an essential instrument of common foreign and security policy. We will enhance EU cooperation and strengthen EU policy in the field of justice and home affairs, in particular to fight organised crime. While we welcome the new Common European Asylum System, we will further work to create legal and safe routes to the EU for asylum seekers through resettlement and humanitarian visas, in order to eliminate the market for human traffickers and prevent tragic deaths in the Mediterranean. We will also work for a Europe open to talents and ideas from people willing and able to contribute to job growth and prosperity on the one hand, and on the other hand enforce a system to prevent irregular migration. We will strive for a common cybersecurity policy, which will improve the ability of our member states to protect our privacy and economy. Our ability to promote the rule of law and individual liberties effectively abroad depends on our ability to guarantee the same rights for those here at home. We will continue the fight for full protection of all human rights and we will remain at the forefront of fighting discrimination of any kind. We will work for the creation of a mechanism to monitor violations of fundamental rights and civil liberties in the EU and enforce sanctions, on the basis of objective criteria, free from political interference. 77 7 Europe should lead the world in data privacy. Access to the private data of European citizens should always be subject to proper judicial process. In a globalised world, no EU country can tackle the threats and challenges we are facing today on its own. EU citizens expect the EU and its Member States to stand together, to act together and to play an effective role in global affairs. The world is becoming ever more complex and unstable. Europe will need to depend more on its own military and security resources. A better pooling and sharing of those capabilities is needed to put them to much better use. This would allow faster responses to international crises, as the fight against piracy has successfully shown. We work for much closer cooperation between the EU and NATO. We will continue to support democratic and economic reforms in neighbouring countries. Healthier democracies on our borders ensure a safer European Union. We strongly support the new emphasis on human rights in EU foreign policy. We want to increase the influence of the EU in international affairs by establishing an additional European seat in the UN Security Council and other organisations, as well as by teaming up the Eurozone member states as a single constituency in the IMF. We believe that the EU should further strengthen its crisis civilian management capabilities and use its experience to guarantee stability, the rule of law and principles of good governance. For an effective and transparent Europe The financial crisis has caused the EU to stretch the Treaty of Lisbon. Within the lifetime of the next European Parliament we will support the calling of a Convention to develop the Union further in a democratic direction. By improving accountability for European politicians, we believe they can deliver more effective and efficient results for you. The EU and its institutions need more transparency and less bureaucracy. We will continue our efforts to simplify EU rules and make them less burdensome. We advocate that decisions should be taken at the appropriate local and regional, national or EU level that serves citizens best and most directly. With the Lisbon Treaty national parliaments have been included to a greater extent in policy negotiation. In order to strengthen the principles of subsidiarity even further, ALDE proposes an annual subsidiarity check, whereby the European Parliament assesses the Commission’s Work Programme to ensure that the principles of subsidiarity and proportionality are being respected. 78 8 We want to make the European Commission more efficient by substantially reforming working methods at the College, and by reducing the areas of portfolios. We support the ongoing restructuring of certain parts of the EU administration, such as the Committee of the Regions, in order to ensure that all parts contribute significantly to the decision-making process and the transparent, smooth and efficient running of the Union. We want to maintain the option of abolishing administrative structures which do not fulfil these criteria, such as the Economic and Social Committee. We call for an audit of all existing EU agencies. Those that do not deliver significant added value should be abolished. We recognise that differentiated integration does not pose a threat to the coherence of the EU as long as further integration remains open to other countries, allowing them to join if and when they choose. The European Parliament should have one seat only. We support a reinforcement of the democratic nature of the European Union, with a greater involvement of the European and national parliaments in decision-making, and with greater transparency of negotiations and voting within the Council. The European Union needs to be stronger, simpler and more democratic. We ask for your vote to help us achieve this. 79 ! 80 ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! I-**18! ! ! ! "#$!%&'()$*+!H'$$+!,*'0B!.2!*!)(-.0.=*-!7('=$!0#*0A2!=-$*'-B!.8$+0.7.*F-$!0#'(&>#!(&'!=(//.0/$+0!0(! $+5.'(+/$+0*-!'$2)(+2.F.-.0BS!.+8.5.8&*-!7'$$8(/S!.+=-&2.5$!8$/(='*=BS!8.5$'2.0BS!>$+8$'!$[&*-.0BS! >-(F*-!2&20*.+*F-$!8$5$-()/$+0!*+8!+(+Q5.(-$+=$?!4&'!/$/F$'2!*'$!/*8$!&)!(7!H'$$+!)*'0.$2! 7'(/!%&'()$*+!=(&+0'.$2!Y*-0#(&>#!+(0!+$=$22*'.-B!7'(/!%&'()$*+!N+.(+!/$/F$'!20*0$2Z?!4&'! =(//.0/$+0!0(!*!/('$!)*'0.=.)*0('B!%&'()$!/$*+2!0#*0!6$!*'$!0#$!7.'20!%&'()$*+!,*'0B!0(!#(-8! *+!()$+!)'./*'BS!0#$!H'$$+!,'./*'BS!0(!2$-$=0!(&'!-$*8.+>!=*+8.8*0$2!7('!*!%&'()$*+!$-$=0.(+?! ! ! ! ! ! ! ! ! ! ! ! !! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:;+?$&'()$*+>'$$+2?$&P! ! ! 81 CHANGE EUROPE, VOTE GREEN. GREEN COMMON MANIFESTO EUROPEAN ELECTIONS 2014 EUROPEANGREENPARTY ! EUROPEAN GREEN PARTY 82 TABLE OF CONTENTS Introduction For a more vigorous democracy Europe is now at the crossroads Without gender equality there is no democracy " *& Crisis creates anxiety and anger – we want to build hope and security Citizens as European decision makers " *& Your vote matters – let us fight for a European alternative Strengthen the role of parliaments # *' It is your choice Fight corruption and fraud $% *' More own resources for the EU budget *( A digital bill of rights Europe needs a Green New Deal *( Solidarity, solidity and sustainability Uphold the rule of law $& *+ Laying the foundations of a social Europe A Green democratic reform of the EU $& *+ Bringing the financial industry under control $' Public finances: Fair and e!ective taxation Members of the European Green Party $( "$ Rise: Renaissance of industry for a sustainable Europe $( One planet, our home! European climate and energy law )% Sustainability is the key )$ Priority for Green transport )$ Protect health and safety )) Food not fuel )) Better food, better lives )* Greening agriculture )* No to GMOs )& More fish in the seas )& Animal protection )' Europe in the world Human rights and poverty eradication )" Domestic security policy )" Working for peace )# Fighting for fair asylum and immigration policies *% Taking the lead on climate change *% Pursuing a coherent enlargement and neighbourhood policy *$ For a fair trade policy *$ # COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY " EUROPEAN GREEN PARTY 83 84 THE GREEN COMMON MANIFESTO In a common process representatives of the EGP’s member parties within the European Union worked on dra,ing the EGP’s common manifesto for the European elections. At the EGP’s Electoral Convention in Brussels on )) February )%$& the present delegates from the EGP member parties adopted the )%$& Manifesto unanimously. & COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY % INTRODUCTION EUROPEAN GREEN PARTY DEAR EUROPEAN CITIZEN We want to invite you to participate in the European Par - liament elections on !!nd – !"th May !#$%. And we want you to vote Green. This year sees the $##th anniversary of the start of the First World War and is "& years since the Treaty of Rome marked the founding of what is now the European Union. European unification has freed the continent from centu - ries of antagonism and war. It has inspired the removal of dictatorships and authoritarian regimes. It has enabled the economic reconstruction of its member states in a spirit of social justice, and is making us a pioneer of environ - mental sustainability. Each enlargement has enriched our cultures, enabled us to recognise each other, making us all part of the same challenging project. There is no doubt about it that the building of the European Union has been an historic achievement. ( COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY ' EUROPEAN GREEN PARTY 85 86 EUROPE IS NOW AT CRISIS CREATES ANXIETY YOUR VOTE MATTERS THE CROSSROADS AND ANGER — WE WANT TO — LET US FIGHT FOR A BUILD HOPE AND SECURITY EUROPEAN ALTERNATIVE We Greens believe that Europe is our common home and our Neo-liberal deregulation has created financial markets We want you to join us in the fight for an economic, political any other pretext. Gender equality is a fundamental principle future. Yet, that future is under threat. If the EU’s achievements solely driven by short–term greed, resulting in the global and social transformation that will build future prosperity of the European Union. There is however a huge gap between are to be preserved and enhanced, now is the time for a financial crisis that is still with us today. The crisis has on the basis of sustainable development and a Green the recognition of a right, what legal progress it achieves fundamental political reorientation and for a democratic threatened or destroyed many social, democratic and renaissance of our industry. With coherent and sustained and its implementation. Greens support a dual approach renewal of the European Union. To safeguard our common economic achievements and as a consequence the concept policies, new investment and many Green jobs can be created, for promoting gender equality and women’s empowerment: future we want to change Europe to strengthen it. That is why of the European Union is now being challenged by a growing constituting good and decent work, equal pay, workers’ rights, gender main-streaming and clear and binding targets in we stand for more solidarity, sustainability and justice. If we sense of frustration, fear, and even anger. The medicine of increased economic mobility, regional development and order to achieve gender equality at all levels. give room for populism, nationalism or economic chauvinism, austerity that has been prescribed to countries in crisis for better opportunities for small and medium-sized enterprises We need a digital bill of rights to guarantee our inherited then no region, no country, no part of Europe will remain or several years now has increased social division and injustice, or social businesses. We insist on a European energy policy liberties in the digital age. We helped defeat the ‘Anti- become prosperous on its own. In a globalised world, it is jeopardised the well-being of many of our fellow citizens, which will mitigate climate change: Yes to renewables and Counterfeiting Trade Agreement’ ( ACTA), that threatened our only by acting together that we stand a chance of meeting undermined the capacity of our societies to prosper, and energy e!iciency; yes to phasing-out nuclear and coal and freedom. We defended the right to water against privatisation the daunting social, environmental, economic and security crucially, weakened democracy. Today, )'% of Europeans no to shale gas. All this is part of our Green New Deal. pressure. Such fights touch on Europe’s core values. challenges ahead. We need fair economic cooperation that are at risk of poverty or social exclusion; )+ million are Greens remain reliable advocates of environmental Greens want to re-vitalise European democracy which has respects our ecological responsibilities. We need solidarity unemployed, including almost one in five young Europeans! responsibility. Help us take a strong stance against those been weakened by the strength of lobbies, by the narrow within and between our nations. We need a strong democracy. The most fragile end up paying the heaviest price for the on the right or on the le, and from the lobbies who want to defence of their own interests by national governments, We must live our values, upholding freedom and liberties crisis. It is not surprising that this injustice is stirring fear block progress. We demand more sustainable agricultural by the power given to technocrats without democratic domestically and internationally. and anger across our continent. Whilst we share that anger, policies and have played a strong role in reforming the EU’s oversight, and by the simplistic blame-game of populists. we want to turn it into hope. fisheries policy. We advocate for more transparency and The European Parliament must be strengthened and given Our economic model is not sustainable. The environmental corporate responsibility. We have consistently promoted control over the policies which the European Commission, crisis persists. The continued failure to reach a global consumer and citizens’ rights. Environmentalism is also a the International Monetary Fund ( IMF) and the European agreement at the climate conferences demonstrates how social responsibility. If the environment is destroyed, so is Central Bank pursue within the so-called troika. Citizens far we are from avoiding catastrophic climate change. Short- the basis of our economy and well-being. must be better heard and have a more active say through termism and the narrow interests of lobbyists continue to Greens mobilise under the banner of social justice against direct democracy. The EU must act wherever a common prevail. Europe is essential for building the more sustainable, social exclusion, of sustainability against austerity. We want voice is needed, whilst not taking decisions further away democratic and equal society we are calling for. Think of to live our lives as people for whom security and opportunity from citizens. This includes pushing back against excessive it: taming the forces of financial markets and of global are not just tales from yesteryear. Here, without doubt, the lobbying. We also want more gender democracy: more corporations, effectively fighting tax fraud and evasion, EU must change direction! We want to fight against youth women in Europe’s institutions and in the boardrooms of transforming Europe’s energy supply to combat runaway unemployment, against homelessness, against poverty and EU companies. climate change. These are all examples of urgent actions hopelessness. Where member states individually refuse or We should not shy away from sharing our sovereignty, that are beyond the capabilities of even the largest of our fail to deliver, we can overcome that together as European where this is the only way of keeping it: as with the banking member states. We need cooperation within the EU to deal citizens. Let us build a social Europe. union, the financial transaction tax, and the struggle for e!ectively with these issues. The transformation we advocate We see individual emancipation, freedom and liberties tax justice and against tax evasion and tax havens. The must go hand in hand with a democratic re-foundation. for all as very much under threat. Think of private and state- EU should pursue a policy of good neighbourliness on our We want a European Union that pioneers a more direct organised mass surveillance or the infringement of human borders and abroad. This includes sharing culture, having and participative democracy. Executive bodies such as rights of minorities like immigrants, the LGBT+ community joint education projects, and means keeping the door on the European Commission and Central Bank must be held or the Roma. We must not tolerate discrimination based on enlargement open. We promote global justice, fair trade, accountable for their actions. The EU must be an e!ective any ground, such as sex, race, colour, ethnic or social origin, the protection of human rights, civil conflict prevention and multi-level democracy, respecting subsidiarity and making genetic features, language, religion or belief, political or any multilateral conflict solutions. Europe must be a fair haven its diversity one of its best assets. other opinion, membership of a national minority, property, for refugees, not a ‘Fortress Europe’. A Europe of global birth, disability, age, sexual orientation, gender identity, or responsibility benefits the world and ourselves. ) COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY $ INTRODUCTION EUROPEAN GREEN PARTY IT IS YOUR CHOICE As the directly elected voice of European citizens, the European Parliament is the joint lawmaker, together with national governments, on topics that influence your daily lives from workplace safety to innovation and new jobs, from consumer protection to environmental policy, from food safety and animal protection to data privacy to gender equity. It also helps finance local and regional projects for sustainable development and social inclusion. Greens make a di!erence in the European Parliament. We want to continue this with greater strength. For this we need your support, your vote. Help change Europe, vote Green! !* COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY !! INTRODUCTION EUROPEAN GREEN PARTY 87 88 EUROPE NEEDS In the present crisis the European Union has not delivered on its promises to a great number of its citizens. And it has been everything but unified on how to change for the better. A GREEN This is why Greens propose a new strategy. We Europeans should combine our strengths, which is what sovereignty means, in order to shape our own future. Instead of socially deaf and environmentally blind austerity, NEW DEAL we propose three coherent avenues to sustainability: fighting unemployment, poverty and all forms of social injustice; transforming our economies with innovation and eco-e !icient solutions to tackle climate change and environmental degradation; re-regulating the financial industry so it serves the real economy. We call this a European Green New Deal. !# COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY !" EUROPEAN GREEN PARTY SOLIDARITY, SOLIDITY LAYING THE FOUNDATIONS BRINGING THE FINANCIAL AND SUSTAINABILITY OF A SOCIAL EUROPE INDUSTRY UNDER CONTROL We do not want the EU and its member states to rely on Europe must be built on a foundation of social justice and to free movement. The Greens wish to see new instruments Five years a,er the outset of the financial crisis, our system a level of debt that is excessive and burdens citizens and yet, for an increasing number of people, social hardship developed to mitigate larger di!erences in economic cycles remains dominated by banks that are too big or too future generations. That includes bringing financial debt, be has become the reality. European Greens believe in policies including unemployment rates. We promote the emancipation interconnected to fail and therefore too dangerous. Bank it public or private, back to sustainable levels and making that tackle growing levels of inequality and are adamant of women in society and in the economy. ‘Equal payment bailouts have cost billions to European taxpayers; this should sure it funds sustainable value-creating investments. This that there should be no second-rate citizens in the EU. It is for equal work’ must be a standard all over the EU, as well never happen again. We want to ensure a properly sized, will require cases of restructuring public and private debt. therefore essential that social impacts such as inequality as equal representation of women in company boards. diverse and resilient financial sector that serves society and Equally, we must address social debt: reducing unemployment, and poverty are taken into account. Having a family or sharing care should not be obstacles to helps mobilise sustainable investment in the real economy. poverty and inequalities, improving health and education. Widespread unemployment, particularly youth a successful career for either men or women. To counter We propose stringent rules for the separation of banking This requires strong investment e! orts. Last but not least, unemployment and old age poverty are key elements of age-discrimination, Greens oppose any age limits on access activities into those which are essential to society and it requires addressing environmental debt: tackling climate injustice. Political measures that promise relief, such as the to public services and we stand for the implementation those which are not. Greens have contributed strongly to change, the exhaustion of finite resources and the erosion of European Youth Guarantee Scheme, will not be successful of reliable basic standards in the pension models of all ensuring that financial products and activities which produce biodiversity. We need a living countryside, with sustainable unless they are adequately funded and above all underpinned member states. We consider that the rekindling of social no benefit for the real economy and have the potential to agriculture and economically and socially vibrant rural by a strong policy of job creation. Member states must Europe is closely related to a reinvigorated social dialogue destabilise the financial system can be banned and taken areas as well as abundant fish stocks to support coastal continue to tackle child poverty through evidence-based where federations of employers and trade unions assume o! the European market. European authorities should make communities. preventative early intervention investment. The EU must their responsibilities. Cross-border collective agreements use of this possibility. Only financial products and activities By becoming world leaders in inventing and delivering put an end to social dumping, to zero-hours contracts, to for European transnational companies should be promoted. which demonstrate benefits for society must be authorised. solutions that make a good life possible for everyone while low-pay jobs and to unfair internships. Greens advocate Our initiatives have outlawed naked speculation on sovereign respecting the limits of our planet, we will find the key to a fair and gradually improving minimum social standards in debt; curbed bankers’ bonuses; forced banks to disclose new economic dynamic for jobs and prosperity. We reject Europe in accordance with national conditions and labour activities in tax havens; and submitted the European Central the so-called pact on competitiveness as this would entail market models—particularly in terms of job quality and Bank’s banking supervision to more democratic accountability. wage cuts, the reduction of social welfare schemes and the security, of wages, of public health, and of pensions. We Greens are proud of achievements in this domain. privatisation of public goods. Fiscal sustainability must go want to move towards better portability of social benefits Now we need to build on these successes. We want to hand-in-hand with equally strong social and environmental through the introduction of a European social card, with ensure consumers receive good, independent advice on sustainability; stronger shoulders must carry more of the high and binding privacy standards, which streamlines all financial services. Financial services legislation must burden. Austerity as imposed in the recent economic crisis administrative processes across countries and which makes not support further concentration of market power to takes us in the opposite direction. a genuine European citizenship more concrete. the detriment of small sustainable banks. We advocate We want the European Central Bank (ECB) to include a European Banking Union, combining a strong common macroeconomic and financial stability among its policy oversight of our banks, a common authority and fund to objectives, including employment promotion. Moreover, restructure failing banks and a common system of insurance to boost employment in Europe we need to work further for deposits up to €$%%.%%% or equivalent. EU institutions to make the project of the single market fully operational, must also contribute to tackling financial short-termism particularly in the area of free movement of workers and that limits the level of sustainability ambition in strategic services. investment decisions. We advocate the inclusion of a social progress clause in European law, which would emphasise the priority of building a social Europe. Social balance across Europe must address the threat of a brain-drain—especially of young people— away from crisis-stricken regions and the exploitation of migrant workers, while respecting the fundamental right !& COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY !% EUROPE NEEDS A GREEN NEW IDEAL EUROPEAN GREEN PARTY 89 90 PUBLIC FINANCES: RISE: RENAISSANCE OF FAIR AND EFFECTIVE INDUSTRY FOR A TAXATION SUSTAINABLE EUROPE At the moment, the tax burden weighs disproportionally on We want to transform our European economy into a global low and medium income earners and on small and medium champion of energy and resource e!iciency, based on less enterprises, while an estimated €$.%%%bn annually escapes energy-intensive technologies and renewable energies through evasion and fraud. Our goal is to restore tax justice and on improving the way we manage, use, re-use, recycle, and e!iciency. We want to reduce the tax burden on labour substitute and value resources. We want resource-e !iciency and move towards taxing pollution and waste. We will do our and eco-innovation to underpin policies and investment in utmost to enact a financial transaction tax despite powerful all sectors of the economy. This Green o! ensive will create lobbies opposed to this plan. As we want large corporations many new quality jobs for high-skilled as well as low-skilled and wealthy individuals to contribute their fair share, we workers in a variety of industries, and it will enhance working advocate a more common European approach to corporate conditions and workers health. It will also enhance future and wealth taxation, including minimum rates. Last but not economic resilience. Industry should not follow false leads least, we advocate a common o !ensive against tax evasion, like drilling for shale gas or converting food to fuel. Rather tax fraud and tax havens, starting by putting an end to bank it should become a key partner in this innovation-oriented secrecy. On the expenditure side, Greens explicitly fight Green transformation by promoting eco-design rules, public wasteful and ecologically harmful spending such as fossil fuel procurement, state aid rules, private investment, small and subsidies or nuclear programmes such as the International medium sized enterprises and cooperatives, better funding Thermonuclear Experimental Reactor (ITER). Managing legacy for research, development and education, promotion of public debt together, by setting up a debt redemption fund entrepreneurship, and in particular social entrepreneurship, and gradually issuing common debt instruments (Eurobonds) good industrial relations, workplace democracy and fighting under clearly defined and realistic common fiscal discipline corporate vested interests. These must all be elements of rules are key moves in order to ensure the sustainability of our effort. We want to strengthen trade unions and the public finances. In order to revive economies in crisis and right of male and female workers to participate equally in preserve the monetary union, we advocate an increase in decision-making processes. Trade policy should support the EU budget, primarily funded by own resources, and the a sustainable industrial renaissance in Europe and show creation of financial solidarity instruments aimed at helping respect and solidarity for our global partners. One project to finance the economic recovery. of particular relevance in this context will be creating a European Renewable Energy Community to help break our addiction to fossil fuels. !( COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY !' EUROPE NEEDS A GREEN NEW IDEAL EUROPEAN GREEN PARTY ONE GETTING SERIOUS ABOUT CLIMATE CHANGE AND THE PLANET, ECOLOGICAL CRISIS Climate change and biodiversity loss pose threats to societies across the world. The ecological crisis has been OUR overshadowed by the current economic crisis but the situation is becoming more and more acute, with the potential collapse of ecosystems putting our way of life at risk. In )%$* we consumed more of the Earth’s resources by HOME! August than can be renewed in a year. There is no longer any doubt about mankind’s role in causing climate change and about the catastrophic consequences of inaction. The planet is close to tipping point and, without a radical change in energy consumption and production patterns, damaging climate change can become irreversible. However, there are solutions that will deliver massive environmental, economic, social and health benefits. !) COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY !$ EUROPEAN GREEN PARTY 91 92 EUROPEAN CLIMATE AND SUSTAINABILITY IS PRIORITY FOR GREEN ENERGY LAW THE KEY TRANSPORT We want comprehensive EU climate and energy legislation Nuclear power is expensive and risky, increases the danger Sustainability must be put at the heart of every major Aviation and road transport are major sources of greenhouse consistent with our fair share of global efforts, built on of spreading of nuclear weapons and has no part to play in economic decision. We want to see environmental and gases, air pollution and noise. The current volume of fossil legally binding emission targets and sanctions to ensure Europe’s energy mix. We will continue to say ‘Nuclear? No biodiversity protection and sustainable development given fuels used for the transport sector not only has a strongly that climate goals will be met. This will create incentives thanks!’ and renew our engagement to phase-out nuclear international priority. We propose the creation of a World negative impact on public health and the environment towards sustainable economic transformation and averting energy in Europe while making sure this does not increase Environment Organisation by combining and expanding but also makes the EU dependent on energy imports and dangerous climate change. The UN climate summit in Paris carbon emissions. We must shut down the most risky power the role of the di!erent disjointed agencies that already exposed to rising prices. We need to shift to safer and in )%$' (COP )$) must deliver a binding global agreement. plants immediately, end direct and indirect subsidies and exist within the United Nations. We cannot measure the less environmentally-damaging modes like sustainable The clock is ticking and the EU, together with member states, insist that existing operators bear full liability for the damage quality of life only in coarse monetary terms: we need new waterways, cycling, public-collective transport and rail. need to play a leading role in negotiations to secure binding and fall-out from nuclear accidents. indicators to complement and extend the Gross Domestic Special emphasis needs to be put on fair competition between commitments from all negotiating parties. This also means Product (GDP) as a measure of sustainable prosperity and di!erent modes of transport. A European railway network increasing its existing outdated greenhouse gas emissions well-being. should therefore close missing links on both regional and reduction target for )%)% from )%% to *%% from their $##% The diverse natural environment in Europe is beautiful and long-distance connections, in a way that urban and regional levels, and setting a target to further reduce these emissions has a value beyond money. The Greens know that sustainable agglomerations can easily be reached. Existing cross-border by at least ''% from their $##% levels by )%*% in order to development means managing natural resources wisely so rail connections must be prioritised over roads and aviation, reach a carbon-neutral society by )%'%. that our children and our children’s children will still have especially for the movement of goods. Improving the energy Legally binding restrictions remain the most e! ective a viable planet to live on. We are living way beyond our e!iciency of cars helps cut the fuel bills of European citizens measure for decreasing pollution and polluting practices. means by consuming natural resources at a rate at which and improves air quality. We also want to spur innovation by The EU’s Emission Trading Scheme (ETS) must be radically they cannot be renewed, and by polluting the air, soil and making electric bicycles, tramways and trains, electric cars, reformed in order to become an e! ective tool. Unless that water with hazardous substances. We want to reduce our all bases on renewable sources, more attractive options. can be achieved, Greens will advocate national carbon floor ecological footprint and resource consumption and ensure pricing. Public institutions, businesses, and especially the that goods are fit for re-use, repair and recycling in place financial sector, must be encouraged to divest from climate- of the designed-for-the-dump approach. The ultimate goal damaging assets. Public subsidies for and investments in should be a closed-loop society, where non-hazardous waste fossil fuels should be ended. We want to invest in European from one sector becomes an input for another. energy networks connecting renewable energy production in di!erent parts of the continent, increasing energy security and cutting costs. A coherent energy policy, based on energy savings, energy e!iciency and renewable energy is the only way to achieve a nearly fully renewables-based economy by )%'%. Therefore, further national binding targets on energy e !iciency and renewable energy are essential. Energy consumption must be reduced by &%% over the next $' years and at the same time, renewable energy, excluding agrofuels, must be boosted to provide &'% of our energy consumption by )%*%. This is not only essential for limiting global warming to below )°C above pre-industrial levels, but also makes economic sense, through stimulating economic activity, creating jobs and reducing Europe’s dependence on costly imports of fuels. #* COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY #! ONE PLANET, OUR HOME EUROPEAN GREEN PARTY PROTECT HEALTH FOOD NOT FUEL BETTER FOOD, GREENING AGRICULTURE AND SAFETY BETTER LIVES Together with Civil Society Organisations, Greens have Fuel made from food crops is not a sustainable solution to Our food chain is malfunctioning. Industrial agriculture, based The European Parliament now has equal responsibility for successfully driven the environmental and public health the climate, energy and poverty crises. Feeding crops into on pesticides, monocultures and an overuse of antibiotics, the EU’s Common Agricultural Policy. It is time to make agendas in the European Parliament, shaping for instance cars, combined with financial speculation on essential food is thriving at the expense of our health, the environment our farming climate-smart, sustainable, fair and ethically safety rules for chemicals, pesticides and biocides. We commodities, has forced up food prices, results in land and increased animal su!ering. Recurring food scandals sound. We want resilient, biologically diverse, healthy and support measures to reduce air pollution which is a major grabbing and threatens the food security of millions in the have made consumers justifiably insecure about what we robust agro-ecosystems that not only adapt to climate cause of premature death. We are pushing hard for better developing world whilst having a negative climate impact. are eating and where it comes from. change but mitigate it. controls of electronic and hazardous waste, drug and In particular, biodiversity-rich tropical rainforests are being The Greens want to promote sustainable, healthy, tasty, We want to see a system which allows for a much fairer pesticide residues discharged into our water systems and slashed and burnt to make way for palm oil plantations diverse and ethical food, not standardised, tasteless food distribution of public funds, including more support for the use of nanotechnology in cosmetics, medicines, food intended for fuel and food ingredients. designed simply to look good on supermarket shelves. This small farmers, for organic farming, for conventional farmers and biocides, as well as for reduced exposure to substances The EU should not be further exacerbating these trends means encouraging local production chains, organic farming who want to green their production methods and for that negatively a!ect our hormonal system. by promoting the use of agricultural land for fuel. We and fair trade products from developing countries. We have local production and sale, which brings farmers closer to We will continue our campaign against the dangerous have to abandon the use of food crops for fuel altogether. succeeded in fighting several misleading practices, and in consumers. Farmers deserve a decent price for their products and damaging practice of shale gas extraction, and the Instead we need to focus on more sustainable transport improving country of origin and nano-ingredients labelling. and corporate buyers should not be allowed to drive down extraction of other unconventional fossil fuels. It is time to models, including better e!iciency for cars and fuels from We will continue to demand improved transparency in farm-gate prices below sustainable levels. ban shale gas and therefore we call for an immediate ban waste products. food labelling. With Europe throwing away #% million tons We need to increase soil fertility, drastically cut the inputs of on hydraulic fracturing (‘fracking’). Fracking contaminates of food annually, we also want action to cut down on food pesticides and synthetic fertilisers, eliminate harmful export our water supplies and our environment with chemicals waste. We have launched a food revolution, increasing subsidies and move away from intensive industrial farming. used in fracking fluids. Methane leakages during extraction public awareness, personal engagement and participative We will continue our campaign for fair and unrestricted of shale gas add to climate change. Moreover, the economic democracy in determining and improving food policies access to plant breeding material and against the patenting benefits have been grossly exaggerated, with production throughout Europe. of plants and animals. We oppose the further privatisation rates dropping rapidly a,er the first year of fracking, causing of seeds and plant material in EU rules on seeds and we boom-and-bust economies in local communities. We will will keep fighting against the corporate control of the seed work to establish fracking-free regions throughout Europe, industry which makes farmers reliant on seed designed following the successful GMO-free model. specifically for use with chemical fertilisers and pesticides, instead of allowing them to save and breed their own seed and adapt their crops to changing local conditions. Biodiversity loss and excessive pesticide use has meant habitat destruction and led to a massive decline in bee and other insect populations, which disturbs the natural pollination of many plants and crops. If we want healthy local fruit and vegetables, we must ‘give bees a chance’. ## COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY #" ONE PLANET, OUR HOME EUROPEAN GREEN PARTY 93 94 NO TO GMOs MORE FISH IN THE SEAS ANIMAL PROTECTION We have been consistent in our opposition to genetically- The Greens have played a lead role in pushing for a more We are well-known for our commitment to animal protection modified organisms (GMOs) in food and farming and in our sustainable Common Fisheries Policy. The policy of throwing and Greens in the European Parliament are at the forefront support for a GMO-free Europe. Greens will continue to lead unwanted fish back into the sea was a massive waste of food of legal and political moves to provide ever increasing the fight for GMO-free food and against cultivating GMOs and income and will now be curtailed. Fish stocks will be standards of well-being for all sentient beings. We urgently here, together with a ban on importing GMOs for animal better managed and the capacity of the fishing fleet better need to move away from factory farming, with its horrendous feedstu!s. We must insist on the right to make our own rules regulated. Consumers will now be able to see not only where record on animal welfare and its intensive use of antibiotics. and impose mandatory GMO labelling. European consumers their fish comes from but how it was caught. Much remains We have led the fight against excessive animal testing have the right to know what their food is composed of and to be done to implement these reforms and to ensure that and will continue to do so. We want to significantly reduce where it comes from. Any research on GMOs should be loopholes are not exploited. We will continue to fight for animal transport times and to end live animal exports. At limited to impact assessments including gene flow and better controls over intensive fish farming, which is highly the international level, the EU must be more energetic in cross-contamination. polluting and for fairer treatment for small-scale, local combating wildlife tra!icking, protecting marine mammals fishing inside and outside Europe. and defending its ban on seal products. We support a ban on fur farming. #& COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY #% ONE PLANET, OUR HOME EUROPEAN GREEN PARTY EUROPE IN THE The EU has o,en been a reluctant player in global politics, reacting more than acting, and facing many di!iculties in WORLD defining common positions. We want the EU to establish a value-driven common foreign policy and to play an important international role, to address the structural causes of poverty, promoting global justice and solidarity, peace, and the defence of global common goods. In today’s context of shi,ing global power, rising global inequalities and questioning of the universality of human rights, passivity is however not an option. We want the EU to have a common voice on foreign and security policy. We have had positive signs in this direction on the issue of Kosovo-Serbia, and of Iran. The EU should pursue strong and fair partnerships with countries of the global south, aiming at reducing inequalities within and between societies through development cooperation. The EU and its partners need to work together to find common answers to problems like climate change, nuclear proliferation and regional conflicts around the world, as well as the unacceptable pillage of natural resources in many countries, particularly in the global south. That cooperation will not be credible if it is not democratic, accountable, transparent, and based on universal principles. We want the EU to support a multilateral global governance, strengthening and reforming the role of the UN, the rule of law, and the responsibility to protect. We consider the adoption of the ‘Responsibility to Protect’ concept by the UN as progress, but the EU needs to make its contribution to further refine and tighten the rules for its application. Priority must always be given to civilian conflict management. Over the last years energy security has become one of the main priorities of EU foreign policy. Over-reliance on gas and oil makes the EU corruptible and is playing into the hands of those autocrats that control Europe’s hydrocarbon supplies. We must cut o! this dangerous and toxic link. #( COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY #' EUROPEAN GREEN PARTY 95 96 HUMAN RIGHTS AND DOMESTIC SECURITY POLICY WORKING FOR PEACE POVERTY ERADICATION Following Green pressure, an EU Special Representative for There is a need to improve police and judicial cooperation, This year we are commemorating the centenary of the beginning against freedom movements and civil protests. Human Rights was appointed to enhance the visibility of the especially tackling terrorism, organised crime, including of the First World War. The EU was created to ensure peace a,er Extra-territorial targeted killings outside of an armed European Union’s human rights policy. The EU institutions mafia associations, environmental and economic crime. devastating wars, replacing confrontation with cooperation. conflict by drones or other means have broken the barriers should mainstream human rights in their external policies, In doing so the EU and its member states should however Greens want the EU to actively promote non-violence and a of the established rule of law. We want to see the EU engage including trade. We must live up to our promises on human prevent the stigmatisation of migrants and minorities. culture of dialogue, mediation, reconciliation and cooperation. with other UN members to achieve a worldwide ban on rights when we are asked to help with disaster relief. This Checks and balances need to be strengthened so that law The EU has played and can continue to play an important role such acts as crimes under international humanitarian and includes a strong commitment to the basic humanitarian enforcement and intelligence services stick to the necessary in conflict prevention, civil conflict-resolution, disarmament, human rights law, and to stop the use of fully automated principles: humanity, impartiality, independence and and proportionate action required of them to keep European arms control, peace-building and peacekeeping. The EU lethal weapons systems. neutrality. The EU must become more e!icient, more vocal citizens safe. should also strengthen its humanitarian role, for example in the defence of the rule of law, freedom and human rights, when it comes to the deployment of temporary hospitals including socio-economic and environmental rights within to help alleviating civilian su!ering in situations like civil and outside its borders. In particular, the EU shall be at the wars. The concept of human security must lie at the heart forefront of setting-up legally binding rules on Corporate of the EU’s external action. We also believe that the EU Social Responsibility. should help the UN to be empowered with more e !icient The EU and the member states must come to terms tools of de-escalation and—if needed —peace enforcement. with their complicity in secret detention and extra-judicial It is now important to strengthen parliamentary control of killings, including full accountability for the human rights EU military operations by giving the European Parliament violations committed in the CIA rendition programme. The a role in the decision-making. ‘war on terror’ must be formally ended. All member states Thanks to the Greens, a much larger part of the EU budget should ratify the amendments to the International Criminal is to be spendt on conflict prevention through the Instrument Court’s statutes, which would allow the prosecution of state for Stability and Peace. We have also supported the idea of leaders who start wars of aggression. an EU Peace Corps and the creation of an EU Institute for The EU has not done enough to implement the Millennium Peace. We are opposed to financing military research from Development Goals (MDG), which highlight the fight against the EU budget, such as for the development of European poverty, hunger, environmental destruction and exclusion drones, or for Europe being a nuclear warehouse. of women. We must work to support the strong new We will continue to fight for nuclear disarmament both sustainability goals set by the Rio+ )% Conference, which globally and in Europe and for concrete steps towards merged the MDG review and the Sustainable Development a Middle East Weapons of Mass Destruction Free Zone. Goals process into a single comprehensive framework and Greens also want to ban weapons such as depleted uranium gave a new set of goals to eradicate poverty and promote ammunition and white phosphorus. Investments by European sustainable development after )%$'. We urge member banks, pension funds, insurance companies and others in states to fulfil their commitments to spend %.+% of GDP on companies which produce land-mines and cluster munitions development cooperation. Likewise, an overriding priority have to be banned too. European trade in arms, including of the EU’s development agenda should be the fight against surveillance technology, is exporting insecurity to regions corruption, money laundering, tax havens, illicit flows of such as the Middle and Far East. Greens want to cut down capital and harmful tax structures. on this trade and prevent arms exports that could be used #) COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY #$ EUROPE IN THE WORLD EUROPEAN GREEN PARTY FIGHTING FOR FAIR ASYLUM TAKING THE LEAD ON PURSUING A COHERENT FOR A FAIR TRADE POLICY AND MIGRATION POLICIES CLIMATE CHANGE ENLARGEMENT AND NEIGHBOURHOOD POLICY The United Nations High Commissioner for Refugees (UN- For many years the European Union has played a positive Greens stick to the policy of EU enlargement. The EU should In trade the EU is a global power. The European Parliament HCR) estimates that in )%$* there were almost &%.%%%.%%% role in international climate negotiations, but recently, be open to new members, provided they fulfil the membership plays an important role in Europe’s trade relations, because displaced persons in the world, of which almost half are this role has dwindled. It is one of our prime Green foreign criteria. We support an EU A ccession perspective for all the it can veto trade agreements, as it did for ACTA. But we need refugees outside their own country. The UN indicates that policy concerns to make Europe once again a leading actor countries of the Western Balkans. Greens want to speed up more transparency during trade negotiations and e !ective )%%.%%% of these refugees urgently need to be resettled every in the fight against climate change and environmental fair and credible negotiations with Turkey. The European cooperation between the European and national parliaments year, but only half of them find a new home; more worryingly degradation. Climate change already causes damage and Union has to play a vital role in its immediate neighbourhood on these issues. Greens are in favour of a multilateral trade only &.'%% are resettled in the European Union - compared su!ering all over the world. Many people have to leave their in order to strengthen stability and democracy. We want order, but trade should support, not hinder, the development to "%.%%% per year in the USA. Thousands of people die land and become climate refugees, because of desertification, to strengthen the Eastern Partnership and specifically of poorer countries and the transition to a green, social, on Europe’s external borders every year, because of ever soil erosion, heavy rainfall or rising sea levels. We want our engagement with countries like Ukraine, Georgia and equitable and democratic development model. This includes stricter controls and because the means of legal entry into to see the concept of climate refugees incorporated into Moldova. This means the EU asserting itself as a principled opening EU markets for less developed countries, substantial the EU remain limited. The EU has a duty to ensure that international law. The EU must therefore play a leading and honest partner with our neighbours. reform of the WTO to make it more development-friendly these people can seek protection. We need more e! orts to role on climate migration in international institutions and The EU should work with civil society, granting asylum and subordinating trade rules to human rights, social and establish an asylum system worth its name. The European at home. It must enhance its support for climate mitigation and support to defenders of freedom and democracy and environmental rights. Trade must be fair and it should not Border Agency, FRONTEX, is the wrong agent for that and and adaptation. Climate financing plays a key role for granting scholarships to the youth of our neighbouring undermine the EU’s social model. member states are violating human rights in their border developing countries and Greens will hold the EU to its countries. We want the EU to focus on the transformation Presently, many bilateral EU trade deals are being negotiated, policies. We need greater e!orts by the EU as well as by promises and its responsibility. Such financing must be of the neighbourhood in the Mediterranean and in Eastern in particular the Transatlantic Trade and Investment member states and more coordination for ‘rescues at sea’, new and additional to existing development aid. We also Europe and to e!ectively support reform e!orts in these Partnership (TTIP) with the United States. Greens contest the and we need legal and safe ways for entry, for example advocate mainstreaming environment into development countries. Moreover, the EU should strengthen its partnerships lack of transparency of these negotiations, where important with humanitarian visas. We have to get rid of the current projects to promote an e!ective climate change mitigation with other existing regional organisations from Africa, Asia democratic choices are on the agenda. Greens not only rules (the ‘Dublin Regulation’) that force refugees to apply and adaption strategy. and Latin America. defend our environmental, health, agriculture and food, for asylum only in the country where they first entered the consumer and labour standards, public interests and data EU. We should, in our foreign relations as well as our trade protection, but also the possibility of strengthening them to and development policies, address the issues which force implement the Green New Deal. We oppose biotech and toxic people to migrate. Greens have been successful in the fight financial products marketed in the US being automatically for the creation of an EU Joint Resettlement Programme as approved for the EU. We draw clear red lines against any well as for funds for emergency resettlement of refugees weakening of EU legislation. We refuse, through the inclusion facing a humanitarian crisis. EU member states must do of international investor-state dispute settlement in trade everything they can to make full use of these funds and agreements, to allow private companies to sue democratically show solidarity, not only amongst each other but also with elected governments in order to protect corporate interests troubled neighbouring regions. against social or environmental reforms. We will mobilise against any trade agreement that does not honour these principles and therefore we oppose TTIP in its current form. "* COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY "! EUROPE IN THE WORLD EUROPEAN GREEN PARTY 97 98 FOR A MORE VIGOROUS More democracy, not less, is the answer to the crisis. Structures such as the troika are fundamentally undemocratic. We believe that a shi, towards more citizens’ participation, DEMOCRACY accountability and transparency is crucial to gain legitimacy for future European cooperation. This means that we Greens are working for increased transparency in the entire decision-making process from the Commission via other EU—institutions to member state governments. Even more importantly, we work for the right of citizens to determine the future of the Union by increasing their choices throughout the law-making process. "# COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY "" EUROPEAN GREEN PARTY WITHOUT GENDER CITIZENS AS EUROPEAN STRENGTHEN THE ROLE FIGHT CORRUPTION EQUALITY THERE IS DECISION MAKERS OF PARLIAMENTS AND FRAUD NO DEMOCRACY Gender democracy means that women are part of the public We want to strengthen the opportunities for EU’s citizens to By choosing the Members of the European Parliament, The EU needs a stronger anti-corruption policy and more life of our societies and take decisions in institutions and influence decisions. We want to work for more participatory citizens have a say in how crucial issues of our times will be e!ective instruments against organised crime to strengthen companies on an equal footing with men. The Greens believe democracy. Greens helped introduce the European Citizens’ tackled, from climate change to bank regulation, from the democracy and the rule of law, and also to strengthen the that the EU’s response must be to mainstream gender issues Initiative (ECI) which allows for EU citizens to call on the policy on refugees to youth unemployment. We want to give European economy. Corrupt behaviour by EU o!icials or at all policy levels. We support the Commission in its work on European Commission to make legislative proposals. Now it the European Parliament a stronger role, particularly in EU parliamentarians in their relations with lobbyists must be legally binding quotas for women in corporate boardrooms. is time to take the next step. We want to broaden the scope crisis management and economic policy making. It should met with very strong reactions. Big business still influences However, at the present pace it would take more than '% of the ECI and make it more e! icient and citizen-friendly. be empowered to co-decide on the priorities of economic the Commission too much. Almost "%% of all stakeholders years until &%% of all boardroom members of European We also want to create a legal basis for EU-wide referenda. policy coordination. We want to lower the voting age to $( appointed by the Commission represent corporate interests, companies are women. Therefore, we demand a quota to Where citizens are being deprived of their rights in an EU for elections to the European Parliament and to additionally despite a commitment to change. Greens also fight to tackle achieve this objective by )%)% . member state without remedy from that country’s judicial introduce pan-European lists with transnational candidates. the problem of “revolving doors” where top bureaucrats and To reach equality, we believe that the EU should adopt system they should have the possibility of taking collective The growing influence handed to the European Parliament politicians in European institutions join private organisations a more comprehensive policy approach against gender- legal action in the EU’s Court of Justice. We will continue by the Lisbon Treaty must be exercised responsibly and not which they were previously responsible for regulating. We based violence, including EU legislation in the form of a to fight hard against the well-established and well-funded be undermined by lobby interests. More transparency and want to safeguard democracy from corruption by introducing directive proposing measures to address violence against lobbies like the agro-chemical industry or the giant seed accountability is needed in the Council of Ministers of the robust regulation and transparency for the financing of women based on policy, prevention, protection, prosecution, companies. We are calling for food democracy, where European Union, for example by publishing all voting results. political parties, candidates and election campaigns. We provision and partnership. The EU Convention on Human citizens reclaim control over what they eat and can create To get a broader and more open debate it is necessary want to provide the Court of Justice of the EU and the Rights requires all EU member states to define rape and fair and sustainable food production and supply systems. that the national parliaments take more responsibility by European Court of Auditors with stronger tools to control sexual violence against women within marriage and intimate imposing better control over their governments’ actions in the way in which EU resources are spent and to act against informal relationships as a crime. European a!airs. We also want to strengthen the national corruption both within the EU institutions and in the case parliaments’ opportunities to react when the EU exceeds of serious problems within the member states. its authority by not following the rules on subsidiarity. National parliaments should also have more avenues of cooperation with the European Parliament. At all levels of governance, from the local to the regional, the national to the European, we call for strengthened interactions and synergies in order to better articulate European policies and their implementation within regional and territorial realities. "& COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY "% FOR A MORE VIGOROUS DEMOCRACY EUROPEAN GREEN PARTY 99 100 MORE OWN RESOURCES FOR A DIGITAL BILL OF RIGHTS UPHOLD THE RULE OF LAW A GREEN DEMOCRATIC THE EU BUDGET REFORM OF THE EU The EU budget must be increased and must principally be The Greens in the European Parliament are at the forefront of The European Union is founded on the values of respect Democracy is never finished or complete. Climate change based on a system of own resources, for instance a carbon the fight for digital rights. We helped stop the Anti-Counterfeit for human dignity, freedom, democracy, equality, the and globalisation are two challenges that have to be met by and/or energy tax, to reduce the dependency on national Trade Agreement (ACTA) and we are fighting for strong rule of law and respect for human rights. Greens do not improved common decision-making. European Greens are contributions. Intergovernmental negotiations too o ,en protection of personal data, for the right to privacy and for compromise on human rights. Pluralism, non-discrimination, convinced that the current EU institutional setting is not up to overlook the common interest as was the case in the )%$* strict net neutrality. Now it is time to defend and protect tolerance, justice, solidarity and equality between women the problems the EU faces. The development of the Eurozone budget negotiations which failed to come up with e! ective both European citizens and the internet from pervasive and men must prevail. There is a great lack of women in EU and the banking union means we need adequate democratic policies for fighting the crisis. Greens have been fighting corporate and governmental surveillance and to safeguard institutions and in many member states too many people reforms which strengthen the legitimacy, transparency a tough fight for greater accountability and transparency fundamental rights in the digital age. Personal data belongs are being discriminated against under all kinds of excuses. and e!iciency of European decision-making in these areas in budget-making. Here we are also suggesting more to individual citizens, not to companies or governments. Greens will push for e!ective anti-discrimination policies to too. Greens call for a reshaping of the competences among participation: citizens could be given the right to sign up Privacy must be respected. The data retention law, which overcome such injustice and are long-standing advocates the di!erent levels of governance in the EU. This means, for pilot-project initiatives to be approved by the Budget obliges telecom providers to store data about whom of the extension of the anti-discrimination directives to for example, that the EU should have some competences Committee of the European Parliament. citizens communicate with, is a serious mistake and must become a fully-fledged Equalities Directive. concerning tax policy and social policy where the European be abolished. Governments have to abide by their own laws. For our democratic rights to be upheld and recognised, Parliament would be co-legislator. Whilst national security is important, personal freedoms we need to keep the integrity of the rule of law both at Our demands for more democracy, more transparency and and liberties must not be overridden. Governments must the EU and national level. The EU lacks tools for e!ective more accountability at the EU level require clear changes in ensure that national security agencies work for all citizens monitoring and sanctions when there are violations of the functioning of the EU. The European Parliament should to secure freedom and liberty for everybody. our values in the member states. This is why Greens have have the right to initiate legislation. Europe cannot just wait been pioneers in demanding the creation of a Copenhagen for the EU heads of state and government to take limited Commission in accordance with the EU treaties and the initiatives that will only lead to more technocratic control. European Convention on Human Rights to make sure that A most simple example: the European Parliament wants to the democratic demands that are put upon candidate have a say about its seat and to stop the travelling circus countries when applying for EU accession are not followed between Brussels and Strasbourg. Greens share that demand, by backsliding into authoritarianism and cronyism once a as do most European citizens. The European Parliament member state has joined the EU. needs more legislative co-decision powers while national The impressive list of guarantees and protections from veto-rights should be diminished. Some decisions must, on the Charter of Fundamental Rights should be realised better the other hand, be taken at levels much closer to the citizens. in practice in our everyday life. Sexual and reproductive The mandate and responsibilities of European institutions rights are essential elements of human dignity. We Greens representing the regional and local authorities and socio- defend the right of self-determination over our own bodies. economic actors and civil society should be strengthened. Therefore we want a new democratic convention, with strong parliamentary and civil society participation with fully transparent procedures, or a constituent assembly, to determine the future of European integration. European citizens should indeed be able to decide on the future of Europe — and have a final say through an EU -wide referendum. "( COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY "' FOR A MORE VIGOROUS DEMOCRACY EUROPEAN GREEN PARTY THE EUROPEAN GREEN PARTY The European Green Party (EGP) was the first political family to evolve from a federation to a party at the European level, in )%%&. Our members are &' national Green parties from across Europe – both within the EU and beyond – supporting each other to strengthen Green politics across the continent. The European Green Party’s member parties (full members, associate members and candidate members) within the European Union as of March )%$&: Die Grünen, Ecolo, Groen, Zelena Partija Bulgaria, Zelenite, Cyprus Green Party, Strana Zelenych, ORaH, Socialistisk Folkeparti / SF, Eestimaa Rohelised, Vihreät - De Grö - na, Europe Ecologie - Les Verts, Bündnis #%/Die Grünen, Ecologoi-Prasinoi / Ecologist Greens, Lehet Más a Politika / LMP, Zöld Baloldal, Comhaontas Glas, Federazione dei Verdi, Latvijas Zala Partija / LZP, Déi Gréng / Les Verts / Die Grünen, Alternattiva Demokratika – the Green Party, Groen - Links, De Groenen , Miljøpartiet De Grønne, Zieloni, Partido Ecologista – Os Verdes, Partidul Verde, Strana Zelenych, Stranka mladih - Zeleni Evrope / SMS-Zeleni, Iniciativa per Catalunya Verds / ICV, EQUO, Green Party of England and Wales, Scottish Green Party ") COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY "$ THE EUROPEAN GREEN PARTY EUROPEAN GREEN PARTY 101 &* COMMON MANIFESTO !"#$ EUROPEAN GREEN PARTY 102 ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! $33401C*'.='+,-./*01'J.18*-;064;*8'01>'%*=.-54868! ! ! ! "#$!D--.*+=$!(7!%&'()$*+!I(+2$'5*0.5$2!*+8!J$7('/.202!YD%IJZ!F'.+>2!0(>$0#$'!)*'0.$2!7'(/!*='(22! %&'()$!0#*0!F$-.$5$!.+!)$'2(+*-!-.F$'0BS!)*'-.*/$+0*'B!8$/(='*=BS!+*0.(+*-!2(5$'$.>+0BS!20'(+>! 7*/.-.$2S!-(6!0*^$2S!2(&+8!/(+$BS!7'$$!0'*8$!*+8!0#$!'&-$!(7!-*6?!_$!=(/)'.2$!I$+0'$QJ.>#0!)*'0.$2! 7'(/!%N!*+8!+(+Q%N!=(&+0'.$2S!*--!(7!6#(/!#*5$!$[&*-!20*0&2!&+8$'!(&'!'&-$2?!_$!6('T!*-(+>2.8$! 0#$!%IJ!H'(&)!.+!0#$!%&'()$*+!,*'-.*/$+0S!0#$!M$6!G.'$=0.(+!0#.+TQ0*+TS!0#$!%&'()$*+!a(&+>! I(+2$'5*0.5$2!*+8!*--.$8!>'(&)2!(+!%&'()$A2!(0#$'!.+0$'+*0.(+*-!*22$/F-.$2?!_$!6('T!6.0#!*--.$8! )*'0.$2!(+!(0#$'!=(+0.+$+02!*+8!*'$!7&--!/$/F$'2!(7!0#$!R+0$'+*0.(+*-!G$/(='*02!N+.(+?! ! ! ! ! ! ! ! ! ! !! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:; 103 !"#$%&'()*+%$,-./&01.%2,34&5&*6(7% March 21, 2014 The AECR, at its Council Meeting in Brussels today, has unanimously adopted the Reykjavík Declaration. The Reykjavík Declaration ! The Alliance of European Conservatives and Reformists (AECR) brings together parties committed to individual liberty, national sovereignty, parliamentary democracy, the rule of law, private property, low taxes, sound money, free trade, open competition, and the devolution of power. ! AECR believes in a Europe of independent nations, working together for mutual gain while each retaining its identity and integrity. ! AECR is committed to the equality of all European democracies, whatever their size, and regardless of which international associations they join. ! AECR favours the exercise of power at the lowest practicable level – by the individual where possible, by local or national authorities in preference to supranational bodies. ! AECR understands that open societies rest upon the dignity and autonomy of the individual, who should be as free as possible from state coercion. The liberty of the individual includes freedom of religion and worship, freedom of speech and expression, freedom of movement and association, freedom of contract and employment, and freedom from oppressive, arbitrary or punitive taxation. ! AECR recognises the equality of all citizens before the law, regardless of ethnicity, sex or social class. It rejects all forms of extremism, authoritarianism and racism. ! AECR cherishes the important role of civil associations, families and other bodies that fill the space between the individual and the government. ! AECR acknowledges the unique democratic legitimacy of the nation-state. ! AECR is committed to the spread of free commerce and open competition, in Europe and globally. ! AECR supports the principles of the Prague Declaration of March 2009 and the work of the European Conservatives and Reformists in the European Parliament and allied groups on the other European assemblies. http://www.aecr.eu/aecr-adopts-reykjavik-declaration/! 104 ECR LEADERS' SUMMIT Brussels, 20 March 2014 COMMUNIQUÉ The Leaders of the ECR, meeting in Brussels for their second Summit, considered the need for substantial economic and political reform of the European Union. They discussed the crisis in Ukraine, energy policy, and the implications of developments in the euro-area for the wider EU. The Leaders of the ECR were updated by Martin Callanan, Chairman of the ECR Group, and by Jan Zahradil, President of the Alliance of the ECR member parties, on progress in widening and deepening the work of the ECR. They looked forward to further expansion of both the Group and the Alliance, particularly in the context of the forthcoming European Parliamentary elections in May. I. REFORM IN EUROPE We believe it is in the national interests of both its Member States and their neighbours that the European Union is a success but it currently faces enormous challenges which must be urgently addressed if it is not to fail. Economically, the steady loss of global competitiveness must be reversed and the euro area crisis must be overcome in order to re-establish growth and prosperity. Politically, the out of date centralising vision of some, that has damaged the European Union¶s standing and legitimacy in the eyes of too many of our citizens, must be rejected in favour of new direction which has the support of public opinion. These objectives can only be achieved by a sustained commitment to substantial economic and political reform. II. ECONOMIC REFORM: EUROPE'S GLOBAL COMPETITIVENESS We support a growth strategy that ensures that the right policy framework is in place to allow businesses and entrepreneurs to thrive, creating employment, generating wealth, and raising living standards. We believe this policy framework must ensure that both services and manufacturing sectors are able to thrive in Europe and we oppose policies which will result in the export of jobs, particularly in manufacturing, to other parts of the world because of high costs or over-regulation. We therefore stress the crucial importance of cutting red tape, and call for greater use of impact assessments of new regulatory proposals. We believe that by establishing a more business-friendly regulatory environment including support for innovation, lower jobs taxes, and labour market flexibility, we can also encourage re-shoring - bringing jobs back to Europe. The development of vibrant SMEs is vital to the economic future of Europe and so particular attention should be paid to ensure their efforts to take advantage of globalization are not hampered by excessive tax or regulatory burdens. 1 105 We believe that the single market must be developed further to fulfil its full potential, particularly in services and the digital economy. We believe that there is great potential in developing closer trade and economic links throughout the Mediterranean area and that progress in this direction will help underpin the progress of the Arab Spring and relieve the pressure for emigration. European economic interests throughout the Maghreb and indeed throughout Africa need to be developed in the face of global economic competition. III. POLITICAL REFORM: INSTITUTIONAL RENEWAL We are committed to significant institutional reform of the European Union to ensure it focuses on the areas where it can deliver added value. We believe that this should involve changes to the treaties to improve the terms of membership for all its Member States. We oppose the abuse of existing treaty arrangements to advance further European integration. The ECR will therefore not nominate an individual to stand as a candidate to be the next President of the European Commission as part of the campaign for the election of the next European Parliament as no such electoral procedure is envisaged in European law. IV. EUROPE'S DEMOGRAPHIC CHALLENGE In order to boost Europe¶s global competitiveness a new strategy aimed at tackling the enormous demographic challenges that we face needs to be developed. Dealing with this demographic challenge should therefore become a new policy priority for all European countries. A crucial element of such new initiatives must be more focus on supporting demographic renewal through improved support for families and especially children. V. ENERGY POLICY Recent events in Ukraine have shown that energy security is a core strategic interest for Member States of the European Union. Our long term goal should be real energy security for the Member States of the European Union as a whole. This would mean that EU Member States would no longer be vulnerable to external pressure. And this bold ambition ± to make full use of our indigenous energy resources, to have a single integrated energy market across the whole EU, to have the maximum diversity of supply ± would mean cheaper prices for consumers and make our industries more globally competitive. It is the right European project at the right time. VI. THE EU BUDGET We reaffirm our belief that the EU budget must be based upon the concept of European added value and guided by the principles of efficiency, effectiveness, value for money, and subsidiarity. We reaffirm our commitment to achieving equal payments for farmers across the EU. The cost of holding meetings of the European Parliament in more than one location cannot be justified and so we support the principle that the Parliament should have the right to decide on a single seat. VII. EURO AREA CRISIS The on-going euro area crisis has had a significant adverse impact on the whole European Union. To mitigate the economic and financial crisis and in response to structural shortcomings in the architecture of the economic and monetary union, it is essential that all members of the European Union and particularly members of the euro area pursue economic reform, re-establish sound public finances, safeguard financial stability, and improve economic governance as the basis for long-term recovery and a return to prosperity. 2 106 Whilst a limited strengthening of some aspects of the architecture of EMU may be necessary to ensure the single currency is able to return to stability, we consider that the European Union and EMU cannot be democratically sustainable without a decentralisation of powers. Progress towards further integration of the euro area must not infringe on the prerogatives of national parliaments of euro area members, especially whenever any transfer of sovereignty is envisaged, and should fully respect the wish of those non-members of the euro area that have an opt-out from future membership to retain their respective national currencies. Given that the terms and conditions of membership of the euro area have changed so significantly since its creation and continue to evolve, the commitment to join the euro in the future - given by most European Union members who are not yet members of the euro area - should be reviewed as part of any future Treaty change. VIII. INTERNATIONAL ISSUES Ukraine We support the people of Ukraine and their desire to choose their own future. We welcome the efforts of the new Ukrainian Government to re-establish democracy and the rule of law. We utterly condemn Russia's illegal violation of the sovereignty and territorial integrity of Ukraine. The referendum in Crimea was illegal and illegitimate and so will not be recognised internationally. We call on Russia to uphold international law, to respect its agreements with Ukraine, and to begin a dialogue with the Ukrainian Government in order to re-establish peace and good relations in the region. Whilst hoping that the situation can be de-escalated quickly and that normal relations with Russia can be quickly re-established, we agree that additional measures will need to be taken progressively to ensure Ukraine's sovereignty is respected by Russia. Eastern Partnership We welcome the initialling of Association Agreements including a Deep and Comprehensive Free Trade Area with Georgia and Moldova during the Eastern Partnership Summit in Vilnius and we underline the importance of signing and implementing these agreements as soon as possible. We reaffirm our support for democratic opposition and human rights defenders active in Belarus. Persecution of Christians We reiterate our support and commitment to freedom of thought, freedom of conscience, and freedom of religion or belief. We are alarmed by the rising number of cases of intolerance, repression and violence directed against Christian communities in many parts of the world particularly in Africa, Asia and the Middle East. We call on all Member States and the European Union to work closely with the relevant national authorities to ensure the rights of Christian minorities are respected. Middle East Peace Process We welcome the resumption of peace talks between Israel and the Palestine Authority as we believe that direct negotiations between the two sides are the only way to secure long-term stability and political reform in the Middle East. We reiterate our support for a two-State solution, to be agreed and respected by the Israelis and the Palestinians, and based on 1967 borders with agreed land for peace swaps. Arab Spring With conflict in Syria and the on-going humanitarian crisis, continuing political unrest in Egypt, and the fragility of new governments in countries such as Libya, it is clear the early hopes of the Arab Spring are far from being realised. We believe that the Arab Spring represented the start a long process rather than an instant solution and so we reaffirm our support for the efforts of those governments which are committed to democratic political, social and economic reforms. We call on all parties in the Arab world to show the leadership and vision needed to ensure a peaceful transition to democracy within the rule of law. Iran The threat of nuclear proliferation in the Middle East is one of the greatest dangers to the peace and security of the world. We therefore support the efforts of six major world powers to reach an agreement with Iran on its nuclear ambitions and welcome the recent international agreement as an important first step which must be fully implemented. In order to secure a comprehensive and final settlement that fully addresses the concerns of the international community, we believe that sanctions must in the meantime be enforced robustly. 3 107 IX. GLOBAL CRIME AND TERRORISM Crime is increasingly a cross-border phenomenon, with a global reach and organisation. We reaffirm our support for the fight against international terrorism and organised crime through the use of inter- governmental and EU cooperation, and agreements with our international partners. We are concerned about the growth of cybercrime and the linkage between online and offline criminal activities, such as child pornography. We support efforts to combat cybercrime, including the establishment of the European Cybercrime Centre, and by Member States increasing the security of information networks. We deplore to the scourge of human trafficking. The European Union encompasses source, transit and destination countries and the open borders across much of the continent present law enforcement authorities with specific challenges. We re-affirm our support for efforts by lawmakers and public authorities to prioritise the fight against this heinous crime. 4 108 ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ()*'20-6E'.='6)*'+,-./*01'F*=6! ! ! ! "#$!,*'0B!(7!0#$!%&'()$*+!E$70!&+.0$2!8$/(='*0.=!)*'0.$2!(7!0#$!*-0$'+*0.5$!*+8!)'(>'$22.5$!E$70!(+! 0#$!%&'()$*+!=(+0.+$+0!0#*0!20'.5$!7('!0#$!=(+2.20$+0!0'*+27('/*0.(+!(7!0(8*BA2!2(=.*-!'$-*0.(+2#.)2! .+0(!*!)$*=$7&-!*+8!2(=.*--B!\&20!2(=.$0B!(+!0#$!F*2.2!(7!0#$!8.5$'2.0B!(7!(&'!2.0&*0.(+2S!(&'!#.20('.$2! *+8!(&'!=(//(+!5*-&$2?!!L(&+8$8!(+!0#$!W0#!K*B!9::2.8$!0#$! )(-.0.=*-!7(&+8*0.(+!"'*+27('/b!%&'()$S!2(=.*-!/(5$/$+02!*+8!0'*8$Q&+.(+2?! ! ! ! ! ! ! ! ! ! !! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:;P! ! ! 109 !" EL Programmatic Platform for 2014 European Elections Escaping from austerity, rebuilding Europe It is a certainty that Europe is going through a deep crisis. The very great power left in the hands of financiers, the consequences of austerity policies and the setbacks to democracy endanger the very idea of a European "union". Anger is high among the European peoples, and it is legitimate. The European treaties as they exist, based on the principles of competitiveness, competition, deregulation and liberalization, the role of the European Central Bank and the euro, at the exclusive service of the financial markets and the power of big capital do not allow social progress in Europe. The financial crisis was the pretext fort going further into ultraliberalism, for imposing barbaric austerity plans, social and democratic regressions. In country after country, we see the "Troika" landing, these experts of the International Monetary Fund, the European Central Bank and the European Commission. With the complicity of our governments, they lower our wages and pensions, slash public services, privatize and plunder everything. The result is rocketing unemployment and precariousness; life is becoming harder. Today, the proposed transatlantic market with the United States and Canada, built by and for multinational companies is a new threat against work, quality standards, culture and democracy on our continent. We are more and more numerous to feel the need to rebuild Europe. Letting Europe sink into the path of social and democratic regression would be criminal. But letting Europe break up to return to the war of nations and peoples, to fall back into nationalism and xenophobia would not be the solution either. We propose another way: that of a refoundation of Europe on a new basis. Our goal is to open up hope, a new ambition of cooperation and solidarity at a European level in the service of our peoples and the peoples of the world. The programmatic platform presented today by the Party of the European Left seeks to trace the outline of a Europe refounded on a democratic, solidarity-based, social, ecological and peaceful basis. It is the result of a joint elaboration. We propose the big axes of transformation and the concrete steps to immediately improve the lives of Europeans. Resisting austerity and putting social development at the centre of European policies, regaining power over finance and building democracy, increasing the rights of everyone: it is around these areas that we propose to all workers in Europe, to all citizens on the left, to trade unionists and social movements in Europe that struggle against austerity and capitalism, for democracy and peace, to unite our forces. This platform is a starting point. We want to enrich it with meetings with the forces that, like us, are looking for a positive way out of the crisis. These forces are numerous, as was demonstrated by the signatures by more than 100 organizations in an "Altersummit” in Athens in June 2013, of a "Manifesto of the peoples", including many proposals similar to those we propose today. In our countries, platforms, programmes, the demands of associations, unions, networks and political activists of the left and ecologists prove it as well. The European elections in May 2014 will be a crucial time for the future of the peoples. It is this hope, that of a new Europe that we will be the bearer of, against both the defenders of liberal Europe and the extreme right that rejects the idea of solidarity between peoples. Pierre Laurent – EL President 110 #" Short version with main axes" " 1. - Resist austerity, for a new model of social development a) The debt is not a national problem. We need to find a European solidarity solution. The EL will organize a conference on the issue of restructuration of public debt b) Stop austerity plans in order to prevent human and humanitarian catastrophe. c) Relaunch economic activity to meet social needs while respecting the environment and fight against precariousness and unemployment, especially among young people and women. No to privatization d) The budgets must be turned towards solidarity, aid to individuals and countries in difficulty. They should aim to reduce social, regional and gender inequalities. e) Reform the Common Agricultural Policy! ! 2. - A new model for ecological development a) Localising and converting industrial production in Europe, developing short production and consumption circuits in order to minimize the use of ressources. b) Fighting against climate change by developing true renewable energies and energy savings, development of public transport. Fight against carbon emission market c)Ensuring food sovereignty by developing economical and ecological sustainable agriculture d) protecting the sea and make a non-explorative use of marine ressources e) reject the privatization of natural ressources and make public the ressources, production and distribution of energy" " 3. - Give power to the people, for a citizens’ revolution A socially and environmentally sustainable, democratic and solidarity-based Europe cannot be built on the existing European Union Treaties. We need to rebuild Europe to win power for the people, workers and citizens. a) Regain power over finance b) Respect popular sovereignty c) Facilitate citizens’ involvement in EU decision- making d) Workers’ rights, trade union freedoms e) Ensure the independence of European countries towards the USA and ȃǹȉȅ 4 - For a social Europe, for a Europe of rights Our goal is to guarantee the fundamental human rights of all Europeans, men and women, by universal access to these rights, through public services and social security systems, managed by the public. The fundamental rights of citizens are not dependent on the markets; they should not be left in the hands of private companies and financial markets. Their goal is human emancipation and not profits. Also, we think they should be at the heart of public investments by EU funds, state budgets, local authorities, contributions systems. a) Right to decent work, increase the wages b) Right to health care and health protection c) Universal right to public education d) Ensure access to common goods e) Right to social services, and care for disabled people f) Rights and freedoms g) LGBT rights h) Women's rights i) Migrants’ rights j) Right to culture. k) Rights of disabled people l) Old people's rights, rights to pensions 111 $" 5. - For fair trade with the world. Refuse the big transatlantic market a) Refuse the big transatlantic market. This market could organise the deregulation of society and loss of progress of European civilization. We want to unite all sectors and citizens threatened by the Treaty, in agriculture, industry, audiovisual broadcasting, in the world of work in general, the environment, culture. We demand a public campaign of information and a referendum about the transatlantic market in every country where it is possible. We want to immediately stop the negotiations on the treaty. b) We will put means of inquiry and struggle in place against the spy networks. This is in order to preserve the independence of European states against the USA and NATO. c) The EL demands the suspension of the Israel/EU Association Agreement as long as Israel violates international human rights. d) The EL demands Mediterranean cooperation and agreements for the benefit of ordinary people. The Union for the Mediterranean, whose declared aim is to promote peace, stability and prosperity, has contributed to destabilizing the region. e) Renegotiate the free trade agreements with Latin America and the Caribbean on bases that serve mutual interests and benefit the people. 6) For a Europe of peace We defend peace and political dialogue against violence and military coercion. The EL is the choice of peace between persons but also between peoples and societies. We defend internationalism, contrary to imperialism, which creates divisions between countries and peoples in an artificial way; we want to unite against the neoliberal and capitalist crisis which victimizes a great number of people, workers and society. a) Defend the values of peace b) On the military treaties and their consequences for the EU c) On armament policy d) Act on the on-going conflicts, in order to pursue peace in the world ! ! 112 %" EL Programmatic Platform 1 - Resist austerity, for a new model of social development a) On the debt issue The starting point of our proposal is our confrontation with the core of the debt crisis in Europe: the neoliberal policy that minimizes the contribution of capital in financial needs, imposes austerity programs, leads to the termination of democracy and working rights and to an unprecedented humanitarian crisis in a series of EU member-states. The European Central Bank (ECB), as an institution, aggravates this problem rather than solving it. Our proposals, therefore, do not concern only the countries of the South; instead they are designed within the framework of a European policy meant to tackle the debt issue, including reliable and definitive settlement. - A European conference on the Eurozone debt crisis, for the implementation of a sustainable solution, based on the London Conference in 1953, which settled the debt of postwar Germany. - We fight for the abolition of a large part of the public debt, the freezing of its repayment and the introduction of a "growth clause" for the remaining part of it. At the same time, we fight for a radical change of the role and the function of the ECB, so that it becomes a lender of last resort and offer loans directly to over-indebted member- states. - At the same time, austerity programs must be terminated, because they lead to more unemployment and to deeper recession and, consequently, to the increase of public debts, because of the constant need for new loans. What Europe needs is public investment programs, to fund stable job creation and sustainable development projects, taking advantage of increased funds by the European Investment Bank. These immediate measures that the EL proposes may not resolve the debt issue once and for all. They are the first steps for a viable solution to the debt crisis, which must be followed by fundamental changes in the economic and financial sphere, based on a radically different economic model that will serve social needs instead of capitalist interests. b) Stop austerity plans to prevent human and humanitarian catastrophe." " c) Relaunch economic activity to meet social needs while respecting the environment and fight against precariousness and unemployment, especially among young people and women. -We reject the Competitiveness Pact -We propose the creation of a European public bank of social and solidarity-based development. In contrast to the European Stability Fund, it would distribute funding for projects on the basis of social and environmental criteria. Funded from the ECB, a share of the EU budget and the taxation of financial transactions and revenues, it would free public investment from the financial markets and would in this respect disarm speculators. - Aim at the public and democratic control of the strategic sectors of the economy in Europe. 113 &" - Relaunch and change industrial production in Europe for social and environmental reasons. It is necessary to produce as close as possible to the place of consumption in Europe. - Produce better and in cooperation rather than by making economic war. We propose a critical evaluation of the way we produce today and to redefine our production targets. Taking into account the social usefulness of production, its environmental impact, and the way the decisions are taken within the enterprises. - We propose European industrial plans for strategic industries and a European recovery plan. - Relocate industrial production in Europe through the institution of European protection and social and environmental norms, against the pressure of capital and low- cost production on globalized markets. With for example: Concerted national taxes on the re-importation into Europe of relocated production. A “mileage” tax in order to decrease the preventable transport of goods. d) Budgets must be turned towards solidarity, aid to individuals and countries in difficulty. They should aim to reduce social, regional and gender inequalities. -We reject budgetary cuts in aid to poor people. -We are fighting for a fair redistribution of wealth, a fair tax system in the member states and in Europe. -We want the rich and the revenues of capital to contribute more. -We propose a European tax on large fortunes in order to finance a European economic recovery plan. -Taxation of financial transactions -ȉȠ fight against fiscal dumping, we are in favor of harmonisation of corporate taxation in Europe. -We are in favor of banning!the provision of public subsidies to companies that lay off while making profȓts. -We propose to condition and adjust the allocation of public aid IJȠ companies, based on the creation of decent jobs and on social and environmental criteria. e) Ensure food sovereignty, reform the Common Agricultural Policy Europe must guarantee the sovereignty and food security of its people and enable farmers to live with dignity from their work. Agricultural Europe must initiate a development model that respects people and territories. We must undertake an ecological transition in agriculture. - Establish an international protection clause when the lands, water (fishing) of a country are threatened by speculation and diversion of food production. - Develop tools to regulate agricultural markets, buffer stocks and measures against speculation. ǹ first step could be the creation of an international convention on the non-speciation of food products (a campaign where the NGOs have already put the banks on the back foot) - Relegitimize taxes on imports and exports which destabilize local markets, in order to finance the relocalisation of production. - Stop supporting the production and imports of biofuels, which threaten food production and destroy forest resources - Implement the community preference and the suspension of bilateral free-trade agreements negotiated by the European Union (Mercosur). - The affirmation of food sovereignty by the constitution of European security stocks. 114 '" - The introduction of economic tools regulating margins and practices of the agrifood giants and the big retailers. - Faced with the climate risk, we propose that Europe establishes a tool of protection of living activities such as land, sea and forest (Mutual Insurance Calamities’ Scheme)" " For a new model of ecological development Our ambition is to situate environmental issues and the growth model in an economy based on an ecological framework. We also want to be active against global warming. To mitigate climate change, we must save energy, switch mainly to renewable energy supply, provide for an effective carbon tax and binding international agreements. Through ecological restructuring of the economy, reducing the arms race and limiting capitalist profit-making, which emphasizes unilaterally the quantitative growth, we can protect the natural environment in a manner that is respects both employment and social justice." " a) Localising and converting industrial production in Europe, developing short production and consumption circuits in order to minimize the use of ressources." " b) Fighting against climate change by developing true renewable energies and energy savings, development of public transport. Fight against carbon emission market" " c) protecting the sea and make a non-explorative use of marine ressources d) reject the privatization of natural ressources and make public the ressources, production and distribution of energy 2. - Give power to the people - for a citizen's revolution A socially and environmentally sustainable, democratic and solidary Europe cannot be built on the existing European Union Treaties. We need the rebuild Europe to gain the power to the people, workers and citizens a) Regain power oȞer finance: - Democratic control of the ECB and re-orientation of bank credit. The ECB should use its power of monetary creation to fund projects that create decent jobs (in industry, research, new modes of production) and public services at national and European level. -The European Central Bank will be allowed to directly lend money to estates at low (or null) rate without any political or economic conditionality. If the European Central Bank lends money to states directly, then speculation against public debt will stop immediately. - In case recapitalization of banks is necessary, (it must be democratically controlled) these banks must be placed under democratic control through social ownership. This can lead to public banks subject to supervision by the state. - Block capital movements between the EU and tax havens outside of the Union. - Eradicate tax havens within the EU itself. -We do not accept the neo-liberal criteria of the Economic and Monetary Union and demand that employment, social development and democracy should be given the priority. 115 (" -Public control of banks, creation of a public banking pole, separation of commercial and investment banks -Fight against tax evasion - End of banking secrecy, which protects big capital, and tax avoidance - Promote the development of mutual funds and non-profit cooperatives" " b) Respect popular soȞereignty -We demand the abolition of the TSCG and the «6 pack» and all similar measures. -We will emancipate ourselves from Lisbon Treaty which leads to austerity and takes sovereignty away from the people. The Lisbon Treaty contains all previous treaties and concentrates in itself all the dead ends of contemporary capitalism. It demands free and fair competition at the expense of social rights won by the democratic workers’ struggles of the last century. It promotes free trade at the expense of the environment and social justice. It maintains the authoritarian drift of the European Union by concentrating power in the hands of unelected institutions. It is necessary to overcome the Treaty of Lisbon so as to deal with the social emergency, fight the ecological disaster, solve the democratic crisis and rebuild another Europe. - Authority must reside with elected assemblies on the national and European levels. - Budgetary power must be given to the national parliaments. They should also be able to control and participate in EU decision-making. -Strengthen the powers of the European Parliament and national parliaments against the European Commission. We question the monopoly of legislative initiative granted today ȚȠ Brussels. - The European institutions are subject to opaque and antidemocratic lobbies. Beyond an obligatory register, we will forbid all the lobbies and give their power back to the elected representatives. - For a better representation of the European Parliament we want to generalize the proportional election system, on national lists, in countries where this is not the case. - Gender parity should be a principle enshrined in the Treaties c) Facilitate citizens’ inȞolȞement in EU decision-making -We want to create real power of citizens' involvement. This could start with a simplification of the procedure of the European Citizens' Initiative which is today littered with obstacles, especially treaties which forbid it to serve human progress, and by real consideration of proposals from NGOs. This implies a questioning of the place reserved today for lobbying. -We propose the organization of European public debates leading to the consultation of the people on major issues affecting them, with a referendum in as many countries as possible (with a referendum wherever the fundamental laws allow that). We ask that this proposal be applied immediately Ƞn the proposed transatlantic market. d) Workers’ rights, trade union freedoms We want to give new powers to workers enabling them to act on the direction and organization of their work, to organize themselves within companies and at European Works Councils level, including European posted workers, who are often used by employers as instruments of dumping. For social control of the means of production. -Encouragement of women's participation and election of women in trade union bodies. 116 )" - Workers and their representatives in the management bodies of companies must haȞe veto rights on speculative projects, on restructuration or relocation. In case the project fails, the right to a buyout by a co-operative or other self-managing means is crucial. - We want tools allowing workers to fight against precariousness in their company. Rights of users must be enlarged, as well as access to the right to strike by private or public workers, including for political purposes. - We stand for the restoration of collective agreements. - We want to restore the framework for negotiation with trade unions and fight against the anti-union repression e) Ensure the independence of European countries towards the USA and ȃǹȉȅ, refusal of the Swift program, Prism, etc. 3 - For a Europe of rights Our goal is to guarantee fundamental human rights of all Europeans, men and women, by universal access to these rights, through public services and social security systems, managed by the public and/or in cooperation with associations and non-profit organizations. The fundamental rights of citizens are not dependent on the markets; they should not be left in the hands of private companies and financial markets. Their goal is human emancipation and not profits. Also, we think they should be at the heart of public investments by EU funds, state budgets, local authorities, contributions systems, etc. a) Right to work, salaries - Enough of competition between workers, which forces down wages and undermines rights! We want wage increases all over Europe, equality of wages between men and women and the creation of a European minimum wage enforced by law or through collective-agreements, to be introduced progressively, adapted to the cost of living in the different countries. - We want to increase work security and educational training as fundamental principles of the right to work and of collective agreements in the countries of Europe. A leveling upwards of labour legislation could prevent social dumping. - We are in favor of a reduction of work time without decrease in wages, progressively and taking into account the realities of the different countries, heading towards the 35 h week. This is also a means of combating unemployment. b) The right to healthcare and health protection -Fight against the growing inequalities in health issues and against exclusion and the imposition of individual forms of payment of services and treatments by ensuring universal access to health care. -Fairness, integrity and the public character of national health systems. Re-appropriation of the management and the objectives of health services. Public resources should be destined for public health. -Ensuring sexual and reproductive rights, such as the right to free contraception, free - not penalized - abortion and free child-bearing, through the public health system. -We want to develop a new culture of health, on a human scale, in favour of prevention and health promotion and against the interests of the big bio-pharma-medical industry. Only public intervention can guarantee medical research that is independent of markets and the interests of firms. 117 *" -We aim for a public health policy, for the development of all the actions in the social determinants of health: work and conditions of work, housing for all, universal education, clean environment, sufficient and proper food, sufficient pensions and social rights. - Block privatization and reestablish public health services freed from speculation and the markets. c) Universal right to public education - A free, secular school, completely financed by the state, which welcomes all children and which gives the citizens of tomorrow the means of mastering their future and participating in the collective decisions concerning their company, their country and the world. - The development of inclusive measures in public schools to fight inequalities throughout Europe. - The development of national public services of education, higher education and research so as to allow anyone to accede to long studies, free of charge, and to succeed in them. - Education facing the challenge of new knowledge in a spirit of cooperation and of service to the community. - To liberate education, higher education and research from financial pressure and the short-term needs of companies so that educational systems contribute to the free development of knowledge in the service of emancipation and progress. - Compulsory schooling with the same duration in the whole European Union, which is necessary to raise the level of knowledge, culture, diplomas and qualifications for all young people, for the whole population. - An education which is not limited to compulsory schooling and the training period, but which provides the possibility of continuing education for personal growth and for autonomy of thinking. - Working conditions for teachers and school staff which make possible a positive atmosphere and, consequently, the quality of teaching. - To ensure secularism, no public funds should finance private schools, private early childhood facilities or cultural associations. - The public university must have sufficient public budgets to enable any qualified and willing person access to higher level training. Serving the community and society and not the needs of companies and capitalist markets. It should ensure human and humanitarian training alongside technical training, and not see students as instruments of "human resources" at the service of the markets. -The purpose of education must be human emancipation. - Students' income must be guaranteed. -A true co-education based on non-sexist or male-centered values, challenging gender stereotypes. -Elimination of early school dropout. Special measures against school dropout among girls related to premature and/or forced marriages. d) Ensure access to common goods Water and energy must be considered as common goods of humanity. Indeed, they are crucial to life. Nobody must be deprived of them. -Right to water and energy, by publicly-run systems or public services. -Free of cost first brackets and progress billings to limit waste. 118 !+" e) The right to social services, and care for disabled people. - Provision of structural funds to rescue people at risk of social exclusion. - Priority to integration or social reintegration, including in the world of work, whenever this is possible. - Right to public transport. - Right to communication, to culture. - Right to insurance/unemployment benefits. - Right to professional training. f) Rights and Freedoms - Every citizen must be able to exercise their civil and democratic rights regardless of their origin, ethnicity, social status, gender, ideology. We defend individual freedoms. We will not tolerate any form of racism. -Secularism: social secularism as a principle and opposition to any religious discrimination. No religion should affect gender equality. -Protection of computer and online freedoms: rejection of ACTA -Protect citizens against the illegal spying of the USA g) LGBT LGBT people are being targeted under the premise of conservative discourses about health, “normal” family, heteronormative and conservative models. In many countries in Europe, LGBT people are being physically persecuted, suffering from bullying in the workplace or school, denied medical treatments, with the complacency of the state authorities. We stand for equality of rights, prevention / sanctions against any kind of discrimination. h) Women's rights -Demand all social, economic and labour rights, as well as sexual and reproductive rights. -Equal pay for women and men -Elimination of violence against women, including domestic violence, sexual harassment, rape, sexual exploitation and forced prostitution. Endorsement of supporting social structures. -Provide directives and policy measures aiming at real actual sharing of domestic and family responsibilities. -Provide consultative status with the European institutions for women’s and feminist organizations. - Right to abortion and free contraception - not penalized and free, included in public health care. - A secular Europe, where equality between women and men is not related to religion. - Work towards gender parity in the institutions of the European Union i) Migrants’ Rights - Abolition of the inhuman and ineffective Frontex program. Europe shall not be a fortress. - Defense of the rights of migrant women, who are in a situation of extreme vulnerability. - Struggle for legislation and educational measures to create awareness against the business of trafficking and sexual exploitation of women and girls. 119 !!" j) Right to culture - Culture shall not be a product of enterprises, pure entertainment without discernment. - Access to culture has to be a universal right. For this, public investment and thus sufficient budgets are needed. - Defence of European cultural diversity. - Equal access for men and women to available time for cultural activities and leisure, which supposes equal gender distribution of housework and care work. -Promotion of popular education, a real factor of emancipation of workers. -Promotion of cultural products that challenge gender stereotypes. Defense of women against the commercialization of the female body. k) Rights of disabled people - Achieving accessibility of buildings - Educational accompaniment. - Professional integration. - Replacement income equal to the minimum wage for people recognized unable to work - Disabled people are disabled only because of a particular organization of society. Society must adapt and take into account the specificity of this part of the population. l) Old people rights The elderly suffer an infamous attack on their dignity and survival. Now that scientific advances are extending the possibility of life, hover over this layer of a triple vulnerable population pressure: lengthening of working hours, the reduction of pension levels, and the decrease of public health care aid and to the growing and inevitable personal dependence. This is where the capitalist logic of elimination leads the “non-productive” populations. - implementation of the European Declaration of rights concerning old people - guarantee the right to pension: No increase in the retirement age. We demand adequate pension provision and other social protection for all. Low pensions must be increased. We are in favor of adequate social public pension systems and the phasing out of private pension funds. 4) For fair trade with the world. Refuse the big transatlantic market a) Refuse the big transatlantic market. The big transatlantic market threatens social rights, small enterprises, product quality and European identity itself. Deregulation of society and loss of progress of European civilization. More generally, the EU agreements with other countries of the world threaten the rights of all. We want to unite all sectors and citizens threatened by the Treaty, in agriculture, industry, audiovisual broadcasting, in the world of work in general, the environment, culture. - We demand a public campaign of information and a referendum about the transatlantic market in every country where it is possible. - We will immediately stop the negotiations on the agreement. Especially since the USA have once again demonstrated their vision of “free and unfettered competition” and “partnership” while spying on states and European leaders. 120 !#" b) We will put in place means of inquiry and struggle against the spy networks. So, in order to preserve the independence of European states against the USA and NATO, we will refuse and put an end to the Swift, Prism etc. programmes. Envisage means to apply sanctions against countries which use these practices in Europe." " c) The EL demands the suspension of the Israel/EU Association Agreement as long as Israel violates international human rights. " " d) Renegotiate the free trade agreements with Latin America and the Caribbean on bases that serve mutual interests and benefit the people" " e) In the Mediterranean: reconsideration of Euromed. 5) For a Europe of peace We defend peace and political dialogue against violence and military coercion. The EL is the choice of peace between persons but also between peoples and societies. We defend internationalism, contrary to imperialism, which creates divisions between countries and peoples in an artificial way; we want to unite against the neoliberal and capitalist crisis which victimizes a great number of persons, workers and the society. a) The values of peace - Defend the culture of equality, justice and solidarity. Introduce education for peace as a specific subject. The EL will organize events in different European countries in 2014 RQWKHWKDQQLȞHUVDU\RIWKH)LUVW:RUOG:DU - Reform of the UN, transforming it into a democratic organ which guarantees world peace. - The introduction of an International Tribunal for climate justice - An ecological crime is a serious infringement to that common good which is the environment. The severity of such a crime is appreciated in the light of the endangering of the ecosystem and its consequences on human rights, and the proven responsibility of criminals. These crimes are crimes against humanity. They shall be punished. - Support of participation in international organs of defense of peace, such as the WPC (World Peace council) and women's organizations and grass roots women's movements. Take preventive measures (including lessons and instructions to soldiers and officers) on violence against women, rape and trafficking in military conflicts. Judicial punishment for those who commit such crimes, according to international law. b) On the military treaties and their consequences on the EU - Review military, commercial and strategic treaties, in particular with the USA. - Immediate exit of the EU and member states from ȃǹTO. Dismantling of ȃǹȉȅ bases in Europe. Dissolution of ȃǹȉO. Europe must not be militarized and connect with NATO through crisis management and rapid reaction forces. - The EU will not participate in "preventive" wars, nor in “humanitarian" interventions without a UN resolution. - The status of non-aligned countries must be respected. 121 !$" c) On armament policy - Act in favour of a reduction of armament expenses in all EU countries and in the whole world. - Elaboration of a code of conduct connected to the selling of arms. - Multilateral destruction of weapons of mass destruction, including nuclear weapons, banning of explosive mines and chemical weapons. - Promoting nuclear-free zones. d) Act on the on-going conflicts, in order to pursue peace in the world - The EU has to commit to the unification of Cyprus, demanding that Turkey respect international rights. - The EU has to act for the recognition of the Kurdish people in Turkey and for the end of repression. For us this is a condition for an eventual entry of Turkey into the EU. - Palestine: The EU has to recognize Palestine and work for the sovereign rights of the Palestinian people, revising its agreements with Israel. We are in favor of a free Palestinian state. We condemn the Israeli colonization of Palestinian territory and advocate a return to the borders of 1967. We demand the destruction of drones. - The right to self-determination of the Sahraouian people has to be an objective for the EU. We want to nullify the favourable treaties between Morocco and the EU. The EU has to act for decolonization all around the world where people still suffer from this situation. - The EL collaborates with the Platform for Peace in Colombia and will undertake an effort to explain that this peace is fundamental for Latin America and the Caribbean. - Abandon the Common Position on Cuba. Against the blockade. - Promote relations between the EU and the Bolivarian Alliance for the Americas." " Proposals of Latin America Working Group The EU policy towards the countries of Latin America is the extension of those implemented against the peoples of Europe, based on free and unfettered competition in the name of competitiveness. The EU proposes to countries in Latin America "free trade agreements" or "association agreements" in search of new markets, sources of energy and cheap labour. In the end, it is always a relation of domination that is offered to the peoples of this region. The ELP proposes a new relationship, based on cooperation and complementarity between the peoples of the EU and America, a relationship that respects the choice of development strategies of countries governed by progressive forces. The ELP rejects bilateral investment treaties that punish countries which dispute the stranglehold of the transnationals over the wealth and economies of Latin America. The EU has much to offer to the peoples of Latin America with a real political cooperation which develops public services and provides transfers of technology. Political cooperation means working together for dialogue and action in favour of a new international order with a reformed and democratic UN, demilitarization of international relations and the creation of mechanisms for dialogue and conflict prevention. Human development, climate change, the promotion of peace and disarmament are also examples of terrains for political cooperation. Trade relations must take into account the asymmetries between the two regions and should be designed as part of development agreements. The EU should make clear its support for those fighting today in Colombia for a just and democratic peace. The "common position" adopted by the EU in 1996, which conditioned all cooperation with Cuba should be cancelled. Cuba is the only country in the world subjected by the EU to such treatment, which in fact reinforces the blockade, an anachronistic measure to which the island has been subjected for half a century. " 122 ! ! ! ! ! ! ! ! ! ! ! ! ! ! #.;*5*16'=.-'0'+,-./*'.='F4G*-64*8'01>'H*5.C-0CE! ! ! ! K%EG!.2!=(//.00$8!0(!0#$!)'.+=.)-$2!(7!G$/(='*=BS!L'$$8(/!*+8!=(()$'*0.(+!*/(+>!2(5$'$.>+! C0*0$2!.+!*+!$77('0!0(!./)$8$!0#$!=(/)-$0$!F&'$*&='*0.2*0.(+!(7!%&'()$?!4&'!/$/F$'2!*'$! ())(2$8!0(!7&'0#$'!%&'()$*+!.+0$>'*0.(+!0#'(&>#!0'$*0.$2!*+8!)(-.=.$2!0#*0!$^*=$'F*0$!0#$!)'$2$+0! 8$/(='*0.=!8$7.=.0!*+8!0#$!=$+0'*-.20!)(-.0.=*-!20'&=0&'$!(7!0#$!%N?!!! ! _$!F$-.$5$!.+!O!!! c!L'$$8(/!*+8!=(()$'*0.(+!*/(+>!)$()-$!(7!8.77$'$+0!C0*0$2!!! c!K('$!8$/(='*=B!*+8!'$2)$=0!(7!0#$!,$()-$12!6.--!!! c!J$2)$=0.+>!%&'()$12!#.20('BS!0'*8.0.(+2!*+8!=&-0&'*-!5*-&$2!!! c!J$2)$=0.+>!+*0.(+*-!8.77$'$+=$2!*+8!7'$$8(/!(7!5(0$2?! ! ! ! ! ! ! ! ! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:; 123 ! ! ! MELD is a European political alliance committed to the principles of Democracy, Freedom and cooperation among sovereign States in an effort to impede the complete bureaucratization of Europe. Our members are opposed to further European integration through treaties and policies that exacerbate the present democratic deficit and the centralist political structure of the EU. We believe that new treaties or any modification of existing treaties should be submitted to the peoples’ vote through free and fair national referenda. MELD has 12 delegations with MEPs from the following national parties: Austria: Ewald Stadler, Die Reformkonservativen – REKOS The Netherlands: Daniël van der Stoep, Artikel 50 Bulgaria: Slavi Binev, Member of the National Front for the Salvation of Bulgaria Belgium: Frank Vanhecke, independent Denmark: Danish People’s Party (Dansk Folkeparti) Finland: True Finns (Perussuomalaiset) France: Movement for France (Mouvement pour la France) Greece: Popular Orthodox Rally (!"#$%& '()%*+,+& -./"01(2%&) Italy: Lega Nord & Io amo l’Italia Lithuania: Order and Justice (Tvarka ir teisingumas) Poland: Solidarna Polska Slovakia: Slovak National Party (Slovenská národná strana) 124 MELD subscribes to the following programme: . Freedom and cooperation among people of different States:3Committed to the principles of democracy, freedom and co-operation among Nation States, the party favours an open, transparent, democratic and accountable co-operation among sovereign European States and rejects the bureaucratisation of Europe and the creation of a single centralised European superstate. . More democracy and respect of People’s will:3Convinced that the legitimate level for democracy lies with the Nation States, their regions and parliaments, since there is no such thing as a single European people, the party opposes further European integration (treaties and policies) that would exacerbate the present democratic deficit and the centralist political structure of the EU. The party is of the opinion that any new treaties or any modification of existing treaties should be submitted to the peoples’ vote through free and fair national referenda in the Member States. The party does believe that the legitimacy of any power comes from the will of its Peoples and their right to be free and democratically ruled. . Respect for Europe’s history, traditions and cultural values:3The Peoples and Nations of Europe have the right to protect their borders and strengthen their own historical, traditional, religious and cultural values. The party rejects xenophobia, anti-Semitism and any other form of discrimination. . Respect for national differences and interests: Freedom of votes:3Agreeing to embody these principles, the party respects the freedom of its national delegations and Members to maintain their own views on different policy issues. MELD is committed to: Campaign for a transparent and democratically controlled EU that is less centralised and more flexible, thus bringing it closer to the citizens Protect freedom of political expression and association Defend and strengthen fundamental democratic principles and accountable representation! 125 ! 126 ! ! ! ! ! ! ! ! ! ! ! ! ! ! +,-./*01'H*5.C-064C'20-6E! ! ! ! "#$!%&'()$*+!G$/(='*0.=!,*'0B!>*0#$'2!)*'0.$2!*+8!'$)'$2$+0*0.5$2!6#(!6.2#!7('!*!/('$! 8$/(='*0.=S!.+0$>'*0$8!%&'()$*+!N+.(+S!=-(2$'!0(!.02!=.0.`$+2?!!%&'()$!.2!7*=.+>!*+!*88.0.(+!(7!='.2.2O! $=(+(/.=S!2(=.*-S!)(-.0.=*-d!"#$!)$()-$2S!'*=T$8!6.0#!8(&F0!*+8!8.20'&20S!*'$!0&'+.+>!*6*B!7'(/! 0#$!5$'B!.8$*!(7!%&'()$?!L('!0#(2$!6#(!2#*'$!0#$!%&'()$*+!.8$*-S!0#.2!.2!*!0'$/$+8(&2!=#*--$+>$! 0#*0!+$$82!*!8$=.2.5$!20'*0$>B?!!"#.2!.2!6#B!0#$!%&'()$*+!G$/(='*0.=!,*'0B!.+0$+82!0(!'$F&.-8!0#$! %&'()$*+!)'(\$=0!*+8!0(!(77$'!0(!0#$!)$()-$2!+$6S!*&8*=.(&2!F&0!='$8.F-$!2(-&0.(+2S!6.0#!+$6! )$'2)$=0.5$?!"#.2!.2!0#$!=#*--$+>$!6$!=#(2$!0(!(5$'=(/$!0(>$0#$'?! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:; 127 FROM CRISIS IN EUROPE TO RENEWED EUROPEAN HOPE TIME FOR REBUILDING Manifesto of the European Democratic Party The idea of Europe, of which we are the defenders and champions, is weakened in the eyes of citizens and attacked by powerful political forces. And yet as countries, nations, regions and citizens, the union of Europe is the only path forward to authentic freedom and genuine sovereignty. Without a structured, voluntary and democratized Europe, we would face changes in the world over which we would have no control. So we must defend the European Union. But, to defend it, we need to change it. We are conscious of the reasons for the current public dissatisfaction we are in a position to address them and overcome them. Since 2008, the economic and financial crisis which has affected countries of the European Union to varying degrees has given European citizens the impression that the European Union does not have any sustainable response. The succession of ineffective European Councils has destroyed the already shaky view of the people of a Europe that takes appropriate decisions. Conversely, Europe must speak with one voice in order to face the challenges ahead. Solidarity is not only necessary in today's society, it is also essential for the European Union of tomorrow to bring prosperity to future generations. Together, we can act; divided, we are totally powerless. And if we are powerless, we are weak and crushed. We see a refounded European Union as a decisive asset for the peoples of Europe. Refounded, the EU will refocus on the essentials. Refounded, it will allow citizens to be actively engaged within its institutions. The European choice is a choice of sovereignty Europe was first created in order to put an end to two centuries of atrocious wars between close and neighbouring countries. It is on behalf of the millions who died in the twentieth century that the founders of Europe acted. And war has disappeared from our continent. The founders set themselves the goal of prosperity and economic development of the continent by opening up borders. Three decades of growth have been the result of their action. Thanks to Europe, the free movement of people and goods on the same continent and between countries with similar values was clearly a powerful development factor. The fall of the Soviet system was largely caused by the contrast of the levels of development of the communist model and the free European model. At the turn of the century, however, the turmoil of globalization gradually affected all Europe. !" Manifesto – 28 February 2014 128 All our countries, small or medium-sized on the continental power scale, were faced with power imbalances: the economical power of multinational industrial networks, out of control growth of often invisible and hardly localisable financial powers, the emergence of political powers with populations in the hundreds of millions or billions of people, huge population mobility, the clash of cultural or politico-religious models; all this raised the question of sovereignty in the hearts of the people. The question of sovereignty is the ultimate political issue: it is the right of people to be in charge of their own destiny, to improve their future through their own free choice, to change what appears to be a fatality of History. We maintain that it is misleading the peoples of Europe to make them believe that they can exercise this sovereignty in this new world order in individual countries on their own. In order to have some influence in the changing world it is necessary to pool resources and share decisions so as to create a common sovereignty. None of the crucial issues of the future could otherwise be effectively addressed. No fair and appropriate regulation of financial markets, no insurance against speculative storms, no credible management of energy, environmental or climate change challenges, no resistance to product, monetary, social, or environmental dumping, no management of problematic demographic trends, migration or integration: nothing in our future can be addressed or resolved by individual countries, let alone historical regions, not even by middle powers, in a world where it seems inevitable that, in twenty years’ time, there is not one European state that will not belong to the group of the world's eight largest economies. The European crisis is a crisis of democracy Yet, and this is a worrying European paradox, for a large number of citizens and people, instead of seeing the European Union as their main asset in order to exercise their sovereignty, on the contrary they believe it to be a constraint which deprives them of their rights. In this era of mass information, there cannot be sovereignty without democracy. A power which is not open to citizens, which makes decisions they do not relate to and which they feel they cannot influence, is inevitably challenged and rejected. The European institutions are so complex and sophisticated that they are incomprehensible to citizens, sometimes even for those who are personally involved. The powerful challenges to which they are subjected lead to a challenge of the very idea of Europe itself. Technocracy is thus a powerful source of ammunition for populism. The European refoundation must therefore be carried out in such a way that it addresses two democratic questions: 1. What are the actual aims of the European Union? 2. What role do citizens play in the European Union? #" Manifesto – 28 February 2014 129 What are the actual aims of the European Union? The European Union acts on behalf of States and peoples who have voluntarily and permanently joined it in order to give them access to resources, authority and influence, which would be out of their reach if they remained isolated. The principle governing the Union is the principle of subsidiarity, which assumes that everyone can fully exercise their responsibilities, locally, regionally and nationally, in the areas of its competence. This can lead to the surrender of a number of powers to states or regions. We believe that Europe needs to focus on the fundamentals and to stop to regulate plenty of minor daily matters, embarrassing for citizens and making unstable the field businesses are developing. 1. For those countries and citizens who have made the choice, the political integration of the euro area is essential. The existence of a single currency for these nations and for these peoples calls for effective fiscal convergence. Yet there can be no fiscal convergence without shared political authority. The issue of debt, albeit national but whose consequences resound throughout the whole zone, should lead to shared policy decisions. A true area of solidarity, the European Union cannot allow its peoples to tear each other apart and turn their backs on the weakest. Similarly, if we want to avoid imbalances due to the concentration of activities in the more competitive regions and desertification elsewhere, the existence of a single monetary zone calls for planning policies that promote and encourage the harmonious distribution of these activities across the whole territory. 2. It is essential, for peoples and citizens and for a large part of Europe, to strengthen and restore our production capacity. This implies support for research, technological innovation and new production processes, in many areas in response to changing consumer expectations. However, a significant proportion of these sectors cannot be considered without a European recovery strategy. From digital technology to biotechnology, from nanoscience to future networks, we face competition from powerful organizations with which we cannot compete unless we join forces. For the economy, the priority for the euro zone should be to focus on the creation of value by SMEs, entrepreneurs and artisans. Similar to the American “Small Business Act", specific rules should be re-established for small businesses to promote their access to credit and the public sector market. Sensible competition, with a view to promoting growth and thus for everyone’s benefit, should encourage and not hinder the creation of large European groups capable of establishing themselves in the global economy. This must be preferred to the dogmatic competition rule, that prevents industrial groups from integrating and allying in the EU. Mobilization of savings should contribute to a European fund for industry in order to stimulate economic activity. 3. It is essential to defend and promote the European social model, too often destabilized by the imbalance between standards which, justifiably, we impose on our own producers on European soil, and in the name of competition, the acceptance on our soil and in our markets products from regions of the world that do not meet any of these standards. This causes an understandable sense of rebellion and rejection among our citizens. The principle of reciprocity should be the cornerstone of free trade agreements and govern all areas in a true and well-balanced partnership. It is essential to reduce regional inequalities. We need to pursue structural funds policies to support the growth of disadvantaged areas, while ensuring efficient and effective use of this aid. 4. A strategy for self-sufficiency and energy security is essential, including the integration of networks and full cooperation for supplies. We propose a European energy community based on the following $" Manifesto – 28 February 2014 130 points: diversification of a common European energy mix and of supply sources, a mutual assistance mechanism in case of energy shortage. A return to fossil fuels is unthinkable, we must therefore focus our research and development policies on effective renewable energy production. 5. The defence of the planet and the fight against climate imbalances is essential. The green strategy has been very ambitious in statements but little effective in its results. The new 2030 goals for emission reductions and use of renewable energy must be one of Europe’s pillars of innovation policy, employment and sustainable growth, in order to gain global leadership in order to tackle post-Kyoto paralysis and to promote our economical perspectives. 6. Foreign policy and European security in this new world order is essential. It is an absolute necessity resulting from new issues such as “cyber-threats” and terrorism. Pooling of operational facilities of Member States armed forces is needed to put an end to waste and inefficiency. Europe has been too absent from recent global turmoil, it must speak with one voice on the world stage if it wishes to be heard. Thus, external action must be the intrinsic factor in promoting European values such as respect for human rights, democracy and equity in economic development. The European Union should collectively strengthen its partnership policy with the Eastern Neighbourhood countries. In this respect the association agreements signed with Georgia and Moldova are a positive but insufficient step. We would like a Europe of ‘three circles’: in addition to the countries of the euro zone and the European Union sensu stricto, a "circle of shared interests" with countries who wish to move closer to European standards in terms of human rights, democracy, social-market economy and the standard of living. 7. A fair and effective fight against the tragedies resulting from illegal immigration is essential. Europe must adopt fiscal, operational and legal means to act within the framework of a common policy on asylum and immigration, the principle of which was agreed in 1999. The first priority is to put in place a European coastguard body responsible for monitoring the maritime borders of the EU and to rescue and receive, in the presence of NGOs, ships in distress in the Mediterranean. Europe cannot think of itself as a fortress closed to the world. But it cannot be open to the four winds, vulnerable to human trafficking. Europe needs a co-development policy with a win-win partnership with our partners, including Africa: it must accept regulated immigration, in cooperation with and not to the detriment of the country of emigration. 8. It is essential to strengthen and reform the Common Agriculture Policy. To maintain the priority given to food self-sufficiency while promoting the emergence of environment-friendly agriculture, concerned with the quality, traceability and food safety of products and the carbon footprint. The CAP must support not only production, but also the territories threatened by desertion and hydrogeological deterioration, the producers themselves, the sustainable family farms that our societies need to maintain the balance. It should ensure that fair prices are paid for agricultural production, so that farmers can make a living without needing outside intervention from public authorities. In any case, a more balanced distribution of this aid should be the rule. Maintaining a strong CAP should not be provided at the expense of the development of the rest of the planet. 9. It is essential to fight against all forms of discrimination. Major differences between men and women, for example in salary or access to positions of responsibility, must become a thing of the past. Thus, the European Union must support toward equal remuneration and responsibility in businesses. EU must combat discriminations as well as violence related to sexual orientation and sexual violence of every kind. %" Manifesto – 28 February 2014 131 10. It is essential to promote cultural and linguistic diversity, which forms the wealth of our continent, our history, our cities and our territories. It makes us what we are. EU’s actions undertaken in the 1990’s must be sustained and amplified. This is contributing to the flowering of the Member states cultures, respecting their national and regional diversity and, at the same time, bringing the common cultural heritage to the fore. Faced to its extra-European competitors economical power, the creative sector must be encouraged; European states must keep their public subvention system to the cinema and the audiovisual sector. Decisive democratic progress. The objective is to effectively involve citizens in the European institutional set-up and have them participate in discussions prior to decisions being taken. The European Parliament is the democratic platform for elected members and the only institution directly nominated by the citizens of the European Union for the citizens of the European Union, and its role should be strengthened. This requires an increase in its legislative powers, starting with the right of initiative of which it is now deprived. The Commission has the function of coordination and implementation. Its legislative initiative function should be exercised at the request of and within the framework set by the Parliament and by the Council. The indication of the candidates for the Presidency of the Commission at the European elections could attract the interest of voters. To add clarity, we propose that the positions of President of the Council and President of the Commission be combined. In this way we would, for certain, finally have a leader of Europe who is democratic, representative and effective. The European Council consists of legitimate and recognized leaders of each European country. It is necessary to make its work more transparent by making the decisive part of its meetings public and accessible to the citizens, in a democratic scenario which would at last be comprehensible and clear. To be able to hear directly the Heads of State and Government of the European Union compare their views and make their commitments would better enable the understanding and support of the citizens. We want a Europe that is fair, open and dynamic. Admired by the world for its culture and values. Respected for its political action. We want to wake up the European people because the dream of a united Europe seems to be slipping quietly away and old nightmares are resurfacing. We want the spirit that blew on the Fathers of the democratic Europe of the twentieth century to be refounded by and for the young generations of the twenty-first century. &" Manifesto – 28 February 2014 132 ! ! ! ! ! ! ! ! ! ! ! ! ! ! +,-./*01'K-**'$33401C*! ! ! ! "#$!%&'()$*+!L'$$!D--.*+=$!Y%LDZ!6('T2!0(!/*T$!0#$!.8$*!(7!*!e%&'()$!(7!0#$!,$()-$2f!*!'$*-.0B?!R0! F'.+>2!0(>$0#$'!<:!)'(>'$22.5$!+*0.(+*-.20S!'$>.(+*-.20!*+8!*&0(+(/.20!)*'0.$2!7'(/!*='(22!0#$!%N! 6#(!'$)'$2$+0!20*0$-$22!+*0.(+2S!'$>.(+2S!*+8!0'*8.0.(+*-!+*0.(+*-!/.+('.0.$2?!%LD!7(=&2$2!.02! *=0.5.0B!(+!0#$!)'(/(0.(+!(7!0#$!'.>#0!0(!2$-7Q8$0$'/.+*0.(+S!#&/*+S!=.5.-!*+8!)(-.0.=*-!'.>#02S! 8$/(='*=BS!.+0$'+*-!$+-*'>$/$+0S!/&-0.Q-$5$-!>(5$'+*+=$S!=&-0&'*-!*+8!-.+>&.20.=!8.5$'2.0Bg!*2!6$--! *2!(+!+*0.(+*-.2/S!'$>.(+*-.2/S!*&0(+(/B!*+8!.+8$)$+8$+=$?!"#$!'.>#0!0(!2$-7Q8$0$'/.+*0.(+!.2!*! =('+$'20(+$!(7!%LD12!)(-.0.=*-!)'(>'*//$!*+8!.8$(-(>B?! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:;P! ! ! 133 ELECTIONS EUROPEAN PARLIAMENT 22-25 May 2014 Solidarity Support SME Energy efficiency Human Rights politicalYour Recognition AssemblyRegions of Tackling of all party Diversity and Peoples tax fraud Languages Unity in Social Sustainable Diversity justice development and cohesion Reduction Self- Internal of public Peace deficits determination enlargement Diversity in Renewable Diversity Autonomy Energy of energy Biodiversity farming/ Local supply sources fishing of food Sustainable Subsidiarity growth Stateless Energy Fiscal Regions nations sovereignty discipline (support for) Cooperation Self- Linguistic Transparency equality Independence Government Transparent Energy Europe Equality Democracy markets of the Peoples EFA your European Political party www.e-f-a.org It’s time for self-determination Our manifesto very much reflects this 6. Developing sustainable fisheries and for all the peoples of Europe diversity, and while respecting our differ- aquaculture; ences, works to build on the overarching 7. Facing the challenges to our languag- values and aspirations that we share es and cultures and working towards Welcome to the European Free Alliance whelming support of their people, now in common. Therefore, the manifesto linguistic equality. European election Manifesto for 2014. have the opportunity to decide on their focuses on these shared values of our future and whether they want to become member parties with seven general pol- It is an honour to be your EFA president We live in historic times. Across Europe free, independent states. icy proposals: at such a momentous time for all of ancient nations, regions, and peoples, 1. The right to self-determination, the our parties. I warmly commend this EFA currently under the jurisdiction of var- In May many of our EFA parties are look- internal enlargement, and EU recog- Manifesto to you as we launch our cam- ious states, are increasingly calling for ing forward to success in the European nition of this process; paigns for the 2014 European elections, either enhanced autonomy or outright Parliament elections. 2. Improving democracy and transpar- and wish you all good luck and great suc- independence, and all the benefits that ency in the EU; cess in the elections. The time has come go with bringing decision-making power The European Free Alliance is best 3. Overcoming the euro crisis; for self-determination for a true Europe back home. described as a broad alliance as it gath- 4. The development of sustainable of the peoples, the time has come to ers a diverse range of parties from across energy sources; make this aspiration a reality. Scotland and Catalonia, because of Europe each with their own unique 5. Developing sustainable agriculture the success of their pro-independence approach on how to better the prospects and reforming the Common Agricul- Veel geluk, parties and most importantly the over- for their people. ture Policy; Eric Defoort - President of EFA 1 Internal enlargement 2 Improving the democratic quality of the European Open doors to new states of old nations: be inconceivable that the EU would block institutions the EU must be committed to the recog- access to new states that have reached nition of new member states arising from their statehood through flawless demo- self-determination and democratic pro- cratic processes. The Lisbon Treaty was concluded after a The legislative capacity of the Council has cesses within current member states protracted process. Hopes that it would to become transparent. All legislative de- (which we refer to as the internal enlarge- The nations at sub-state level and / or lead to more democracy and account- liberations and relevant documents must ment). regions with legislative powers must ability were not fully realized. Following be freely available to Europeans in the have a role of their own in European deci- enlargement and the worst financial crisis same manner as the documents of the In the same way, the EU must ensure the sion-making through a strengthened that the euro has faced, the EU needs to European Parliament. The position of each continuity of European citizenship to citi- presence in an “Assembly of regions and set new and ambitious targets in order to member state should be made public. zens of these new states. Democracy is a peoples” replacing the toothless Commit- be a key player in the international arena, fundamental principle of the EU: it would tee of the Regions. a leader in the drive towards a sustainable The President of the European Commis- economy, a model of democracy, social sion should be democratically elected. justice and cohesion. In member states with a devolved struc- ture, all governments of their constituent The legislative capacity of the European nations will be required to be part of the Parliament must be further increased, process of proposing a candidate com- giving it true powers of legislative initiative missioner. and of amending the treaties alongside the competent parliaments within the The international vocation of the EU as a member states. player which acts on the basis of the values of democracy, peace, solidarity and re- Sub-state constituencies for the spect for diversity has to be clarified and European elections should be created in strengthened. the member states that have not yet done so. 6 - EFA MANIFESTO 2014 EFA MANIFESTO 2014 - 7 3 Overcoming the Euro-crisis The current crisis has highlighted how of the (financial) markets. The measures the EU can mean an added value) and a economic conditionality in the cohesion in recent decades several governments taken to improve the economic govern- stricter control on all EU agencies, avoid- policy. A (regional) government should not spent in an irresponsible way without ance of the EU (six-pack, two-pack, fiscal ing overlaps and duplications, should be be punished for the mistakes of another stimulating economic growth and gua- compact) should be applied effectively. installed. government. ranteeing social cohesion. In the first EFA believes that the European Central instance it is up to the member states Bank (ECB) should fully play its role. A European Rating Agency should be set EFA recognizes the vital importance to take the necessary steps, but we also up to control in a transparent way interest played by small and medium sized enter- need to formulate a European framework Austerity measures have to be com- on debt and risk premiums. prises (SME). EU policies should foster the in order to avoid repetition of similar cri- plemented by investments in future competitiveness of SME’s. sis-prone policies in the future. orientated policies and by other stimulat- EFA welcomes the recent EU legislation on ing measures, in the countries hardest hit bonuses paid to bankers. The current international financial and The member states have to make public by the current crisis. On that healthy basis, economic crisis has an important negative finances and the broader socio-economic Europe will have to re-launch an econ- The European Commission should be effect on the labour market and employ- context healthy by: (1) budget consolida- omic recovery policy based on European allowed, alongside national and region- ment situation in the EU. In this context tion and reduction of public deficits, (2) high added value investments. al authorities, to create efficient tools our main focus should remain on the EU structural reforms and (3) investing in to tackle fraud and to fight against tax targets to realize an overall employment smart, sustainable and inclusive growth. EFA supports fiscal harmonization havens and tax evasion outside the EU. rate of 75% in 2020. As a priority the low More fiscal discipline is also necessary throughout the different Member States employment rates for groups at risk such because of new challenges concerning and regions, respecting the fiscal diver- The reformed European Structural and In- as young people, the elderly and the pop- demography, the labour market, social sity and the subsidiarity principle (the vestment Funds should be conditioned to: ulation with a migrant background should security and pensions. Fiscal and bud- rate should be decided by the nation con- ¬ recover competitiveness, be tackled. getary discipline is an essential condition cerned within an EU-wide framework as is ¬ boost public investments in R&D&I, to get access to the European Stability the case for the VAT). In order to improve ¬ encourage productive investments, With youth unemployment at an all-time Mechanism. Solidarity can only be provid- the efficiency and social justice of the cur- ¬ enhance energy savings, high in the EU, it is essential that the pol- ed in combination with more responsibility rent tax system, EFA wants to modify the ¬ improve job training, icies of all levels of government empower from all governments. tax burden imposed on our citizens. ¬ fight against social exclusion, our future generations, inter alia through ¬ Territorial cooperation, including the quality education, skills development and In addition Europe has a task. Solid The EU budget has to be managed bet- emerging macro-regional strategies the validation of informal education, and mechanisms at the EU level will enable ter (smart fiscal consolidation, better develop an inter-generational dialogue. decision-makers to regain the confidence spending and focus on areas where EFA rejects the introduction of macro- In this context priority should be given to 8 - EFA MANIFESTO 2014 EFA MANIFESTO 2014 - 9 4 European Energy policy realize the EU target to reduce the school of becoming unemployed or leaving formal EFA is committed to an energy strate- ergy sources in order to avoid becoming drop-out rates below 10% in 2020. education. gy which maximises energy efficiency, dependent on other regions or territo- prioritises the development of renewa- ries. Distributed generation, where energy EFA strongly supports the Youth Guaran- Imported goods should be classified ac- ble energy, makes the European gas and is produced by many small sources, is a tee Scheme with the aim to ensure that cording to ecological and social standards electricity markets more transparent and good model for some regions and nations all young people under the age of 25 years in the country of origin and should be la- provides for active supervision in order to and should be promoted where appro- receive a good quality offer of employment, beled accordingly. This measure would protect consumers sufficiently. priate. The European electricity network continued education, an apprenticeship or contribute to spread European standards should be renovated and turned into a a traineeship within a period of 4 months in the world. The debate on energy should focus on super-smart grid that can deal with big energy demand, as well as energy sup- fluctuations in green energy production ply and production. Energy consumption (offshore wind energy in the North Sea, should be reduced through a more ra- the Mediterranean solar energy ring, hy- tional and efficient use of energy. Energy dropower in Scandinavia) as well as with efficiency should be the priority since decentralized energy production, e.g. solar the cheapest and greenest kWh is the panels on private homes. kWh that is not consumed and therefore does not need to be produced. Improving We believe that European funding should energy efficiency means less energy pro- be specifically allocated for investment in duction installations are needed to cover renewable energy development and ener- the energy demand. Accordingly energy gy efficiency measures, whilst preserving conservation through energy efficiency the autonomy of the nations and regions measures leads to financial savings and to decide on their energy mix and rec- less carbon emissions. Therefore, EFA be- ognizing that in order to ensure payable lieves that there should be more focus on energy, a realistic energy mix focuses on energy efficiency measures, both for the renewable energy sources without exclu- benefit of the environment and the con- ding certain energy sources as long as sumer. EFA supports an energy savings alternatives are not yet available. As well target. as the benefits to the environment, such investment will create sustainable jobs EFA believes in ensuring a diversity of en- and encourage economic growth. A long 10 - EFA MANIFESTO 2014 EFA MANIFESTO 2014 - 11 Assembly of Regions and Peoples Tackling tax fraud Solidarity Self- Diversity Human determination Social Rights Internal enlargement justice Renewable and cohesion Energy Self- Autonomy Local Government supply of Subsidiarity Diversity Energy food of energy Reduction efficiency sources of public Energy deficits sovereignty Independence Sustainable Democracy Transparent growth Transparency Energy markets Linguistic equality term plan is needed, with investment in regional governments. Local authorities favoured over imports. Efficient Emissions order to prevent a production shortage, skills and infrastructure projects, with- should be involved in planning procedures Performance Standards should be applied large investments in the electricity market out leading to unrealistic costs, which for new constructions, so that no one on all new power stations. EFA supports will be needed. would make Europe a world leader in the community should have to take a dispro- research into carbon capture and storage sector. portionate burden of providing energy for technology but remains cautious about Whichever way energy is produced, it is the wider community. Renewable energy the viability of the technique. vital that the strictest safety measures We believe that the EU should commit projects should bring maximum bene- are guaranteed in every sector, from the itself to an ambitious annual carbon emis- fits to the local community, in the form of EFA is concerned by the practice of production level to waste management. sions reduction target and overhauling our benefits such as lower energy prices. extracting coal-bed methane and shale Guaranteed minimum standards should energy policy is essential to achieve this gas by hydraulic fracturing or ‘fracking’ be set at EU level. aim. Ambitious targets for renewable ener- due to the negative impact on the environ- gy production should be set. An increase ment, particularly on underground water EFA wants to promote research and devel- The development of renewable energy in production can be achieved through courses. opment in the energy domain as a whole. will create jobs and boost the economy streamlining the consent process, sim- Renewable energy technologies are not as well as being a way of reducing carbon plifying planning advice, promoting EFA has long called for the phasing out of the sole areas of importance for the emissions. Promoting more use of renew- community engagement and promoting nuclear energy at a European level. The future; we must also invest in, amongst ables must, next to maximizing energy community benefit. Funding for renewable Fukushima incident was another reminder other things, research on new energy effi- efficiency, be one of the cornerstones of energy should be coordinated with other of the potential dangers of nuclear power. ciency technologies, energy storage and the EU’s energy policy. The possibility of EU funding instruments; in particular the EFA notes that Germany has announced nuclear waste. micro-generation, tidal lagoons, small rural development fund as farmers have a that its nuclear power plants will be scale hydro electric schemes, sea bed vital role in managing resources such as phased out by 2022. Switzerland has In the past, EFA has pointed out the lack turbines and other sustainable power gen- land and water, and structural funds which committed to phasing out nuclear power of democratic control and transparen- eration schemes should be explored. Given aim to develop the economies of our poor- by 2034 and Italy voted against nucle- cy in the energy sector. EFA has concerns that many European nations enjoy an est regions. ar power in a referendum in 2011. Even regarding undemocratic oil cartels, fossil abundance of coastline, a strong empha- though the share of renewable energy will energy oligopolies, nuclear monopolies, sis should be placed on tidal energy, which The use of fossil fuels should be reduced rise in the future, certain regions cannot or an alternative energy sector ruled is also a technology at a commercially with a view to an eventual end to their allow yet the exclusion of nuclear energy by multinational corporations. Govern- advanced state. production in favour of more sustaina- from their energy mix and have to dimin- ments should cooperate in encouraging ble sources. While we are still dependent ish their dependence on nuclear energy in large energy companies to reinvest their Planning policy should be the remit of on their use, local supplies should be a rational and realistic way. In any case, in profits in improving services or cutting 14 - EFA MANIFESTO 2014 EFA MANIFESTO 2014 - 15 5 Agriculture and CAP Reform costs for the consumer. monopolies in the energy market. EFA A safe and secure supply of food is therefore have to be adopted to suit the believes that our ambitions to estab- absolutely critical for the well-being of needs of these different types of farming In the 2011 EFA General Assembly, a lish political control of our countries and Europe’s 500 million citizens. Moreover, and different rural economic situations. motion on energy sovereignty was adopt- regions should be mirrored with control of the viability, prosperity and sustainabil- A “one size fits all” CAP is not in keeping ed. It addresses the oligopolies and our energy sources. ity of European agriculture underpins the with the principle of respect for diversity economic prospects of 12 million farm which is at the heart of EFA. Neverthe- holdings and many more associated food less, EFA parties do share some basic chain and rural enterprises; plays a major fundamental interests in agricultural role in managing landscapes, protecting policy, and call for the following interests the environment and fragile ecosystems; to be central in the discussions on the and forms an essential part of the social future of the CAP: and cultural heritage of the European regions. With an increasingly industrial- ¬ The retention of the Single Farm ised food chain, and ongoing revelations Payment with an adequate budget: about fraud in food labelling and the Farmers in EFA countries and regions spread of plant and animal diseases, the face the economic challenges of a case for securing a safe, healthy, sea- volatile market, high input costs, sonal and local supply of food is more marginal land and distance to markets. relevant than ever. So is the need for an The Single Farm Payment provides an effective reform of the EU’s Common essential bulwark for farm finances, Agricultural Policy. and must be adequately financed from the EU budget: it creates a level playing The constituent parties of the European field between farmers in different parts Free Alliance reflect the significant of Europe. diversity of Europe’s varied agricultur- al landscapes. The issues and challenges ¬ The strengthening of support for Less facing a livestock farmer in the Highlands Favoured Areas: Many EFA parties, such of Scotland are different from an olive ter- as in Bavaria and Galicia are situated in race in Greece, or a large arable farm in less productive agricultural areas which Germany. Different policy strategies will face significant natural handicaps, 16 - EFA MANIFESTO 2014 EFA MANIFESTO 2014 - 17 6 Fisheries and Aquaculture and are classified as “Less Favoured”. countries and regions can tailor the EFA’s founding principle of respect for toric and traditional maritime role which Pillar II of the CAP provides financial implementation of CAP to their own diversity across Europe covers many deserves protection. support to help farmers overcome needs. aspects of our citizens’ culture - be it these handicaps. These payments help linguistic rights, national institutions or This protection has not been found in the prevent farm bankruptcies and land ¬ Greening: The EFA parties face vastly cultural heritage. EU Common Fisheries Policy as it has abandonment, and to maintain food different ecological and environmental existed for the last three decades. production. challenges in their areas: while flooding And in Europe’s coastal regions, livelihoods is a major environmental problem in dependent on the sea form an integral An over-centralised one-size-fits-all ap- ¬ The devolution of power over CAP northern Europe, the Mediterranean part of each area’s heritage and traditions. proach has ignored the needs of individual decision making: Under CAP rules, zone faces the challenge of drought. Generations of fishermen have put to sea areas, failed to conserve fish stocks and Member States are empowered to make The Commission’s proposal to “green” to catch fish in the waters around them, led to a decline in the fishing industry - decisions over the implementation of the CAP through three mandatory and those harvests provide numerous and therefore threatened coastal Europe’s the CAP schemes in their territories, and standard measures has been jobs for people onshore. Aquaculture too cultural traditions. such as how much money to transfer criticised for not reflecting the reality is playing an increasingly important role from Pillar I to Pillar II, or whether to of this diversity. EFA calls for a more in supplying Europe’s food needs - and in EFA believes that these traditions and apply the “small farmers scheme”. regionally flexible approach to greening sustaining often fragile economies. historic rights deserve to be protected, These decisions must be made at as which allows our countries and regions and therefore supports the following key local a level of decision making as to tackle the specific problems they Europe’s coastal traditions show as much points in fisheries policy: possible, particularly in Member States face, while ensuring overall equivalent diversity as any other part of our varied where agriculture is devolved to lower environmental action across Europe, cultures. The issues affecting fishermen ¬ Europe’s diverse fishing industries are a levels of government, so that EFA including safeguarding biodiversity. in Orkney or Shetland differ hugely from vital part of our shared cultural heritage those concerning Corsica or Sardinia. - and the rights and interests of all our Likewise, the development of aquaculture coastal communities must be protected. has shown huge variation across different seas and climate zones. ¬ Management decision making on fish- eries must be decentralised, with real Nonetheless, what binds these interests power being returned to the fishing together is the deep link between coastal nations and regions. Problems are best communities and their dependence on the solved by decisions being taken at a level sea: each fishing town or village has a his- appropriate to each fishery with region- 18 - EFA MANIFESTO 2014 EFA MANIFESTO 2014 - 19 7 Challenges for cultures and languages al cooperation encouraged where shared interests are apparent. Respect for cultural and linguistic diver- the unifying English language is not an ¬ The onshore industry must be given ade- sity is a key element in safeguarding and identification instrument for Europe, while quate protection with both men and enhancing Europe’s cultural heritage. our national languages become local ones women being supported in their vital and lose their European scope. EU policies roles. EFA considers that all the European lan- must contribute to reverse this negative guages in their written and oral forms trend. ¬ Sustainable fishery and aquaculture are equal in value and dignity and are should be allowed to develop in a manner an integral part of European culture and EFA considers that linguistic diversity most appropriate to each region. civilization, contributing to the enrich- stimulates creativity, innovation and the ment of humankind. The EU must support promotion of local cultural heritage, thus the policies of the concerned communi- contributing to economic development. ties to reappropriate their languages. Cultural and artistic creation, cultural heritage, gastronomy, arts & crafts have EFA believes that European languages a job creation potential, help foster iden- and cultures are like biodiversity, a living tity, cannot be relocated and are also basic heritage necessary for the sustainable elements for a sustainable tourism. The development of our societies. They must language industry, i.e. designing, produc- be protected from any risk of extinction. ing and marketing products and services related to languages, is one which has We must prevent our national languages great potential. from being reduced to a secondary role of “low” vernacular languages for daily life, EFA considers that the EU must ensure the while English, promoted by the economic preservation of the linguistic and cultural globalisation, becomes the “high” uniform heritage of Europe and in particular of all language of important discourses, educa- its languages, and must therefore, while tion, science, economic life, etc. Because respecting the principle of subsidiarity, its drive is global and essentially economic contribute to the promotion and develop- (as opposed to being political or cultural), ment of this invaluable cultural heritage. 20 - EFA MANIFESTO 2014 EFA MANIFESTO 2014 - 21 Languages with co-official status must be and organisations, initiatives and activi- recognised at EU level. ties, which work to develop and promote endangered languages. One of the most Although the budget allocated to Euro- important issues for EFA is changing the pean regional or minority languages has eligibility criteria for community language been greatly reduced, EFA believes that the programmes in order to allow all language new Commission programmes for 2014- groups to apply for these funding oppor- 2020 Erasmus for all, Creative Europe and tunities. Europe for Citizens must support NGOs 22 - EFA MANIFESTO 2014 The European Free Alliance (EFA) pro- EFA argues that stateless nations have motes the right to self-determination the right of self-government and of par- and supports the aspirations which EFA ticipation in the world and in the European member parties have for their coun- Union on equal terms with other national- tries, including independence, greater ities, some of which are the possessors of autonomy and linguistic and cultural rec- statehood, others not. ognition. EFA rejects the two extreme solutions that EFA assembles political parties involved in are presented in the current debate on the the quest for enhanced self-government future of the European Union paving a way for our stateless nations. out of the crisis: the centralised and uni- tarian model or the retreat into the nation EFA aims for European unity in diversity, state. creating a European Union of free Peoples based on the principle of subsidiarity, EFA advocates the bottom-up approach of in solidarity with each other and other a European Union of free peoples based on What is EFA? peoples of the world. EFA promotes a the principle of subsidiarity who co-oper- European cooperation based on the diver- ate where necessary in the policy areas sity of nations, regions, peoples, cultures where a European added value offers a and languages. better policy outcome. EFA promotes the process of internal EFA shares the democratic values that enlargement within the European insti- underpin membership in the European tutions and elsewhere as the mechanism Union: human rights, respect for democ- by which nations who gain the statute of a racy and its foundations, gender equality, State remain as an EU member state. rejection of racism and xenophobia. It re- presents a vision of Europe that promotes EFA does actively support the ongoing a more just and more democratic world, democratic self-determination processes including by building solidarity with the across the EU. peoples struggling for self-determination. www.e-f-a.org http://vimeo.com/europeanfreealliance/what-is-efa http://vimeo.com/europeanfreealliance/self-determination Member Parties FULL MEMBERS OBSERVER MEMBERS Alands Framtid | Autonomie - Liberté Aralar | Bloc Nacionalista Valencia - Participation – Écologie (ALPE) | (BLOC) | For Human Rights in United Bayernpartei | Bloque Nacionalista Latvia (FHRUL / PCTVL) | Lausitzer Galego (BNG) | Chunta Aragonesista Allianz (LA) | Nueva Canarias (NC) (Cha) | Die Friesen | Eusko Alkartasuna EFA (EA) | Enotna Lista (EL) | Esquerra Republicana de Catalunya (ERC) | Fryske Nasjonale Partij (FNP) | Lista Za Rijeku | Liga Veneta Repubblica stands for (LVR) | Magyar Kereszténydemokrata Szövetség | Mebyon Kernow (MK) | Moravané | Mouvement Région Savoie another (MRS) | Nieuw-Vlaamse Alliantie (N-VA) | Omo Ilinden Pirin (Omo) | Partido Andalucista (PA) | Partit Occitan (PÒc) | Plaid Cymru | Partitu di a Nazione Corsa Europe (PNC) | Partito Sardo d’Azione (PSd’Az) | Federació PSM-Entesa Nacionlista (PSM- Entesa) | Rainbow | Ruch Autonomii Slaska (RAS) | Slovenska Skupnost (SSK) | Scottish National Party (SNP) | Südschleswigschen Wählerverbands (SSW) | Schleswig Partei (SP) | Süd- Tiroler Freiheit | Union Démocratique Bretonne (UDB) | Unitat Catalana (UC) | Unser Land http://www.e-f-a.org/whos-who/member-parties/ For a Europe of European Free Alliance - EFA Boomkwekerijstraat 1 the Peoples 1000 Brussels, Flanders-Belgium Tel 0032 (0) 2 513.34.76 0032 (0) 2 513.48.51 Fax 0032 (0) 2 513.34.25 [email protected] www.e-f-a.org ! ! ! ! ! ! ! ! ! ! ! ! ! ! +,-./*01'$33401C*'=.-'K-**>.5! ! ! ! "#$!%&'()$*+!D--.*+=$!7('!L'$$8(/!Y%DLZ!.2!*!)*+Q%&'()$*+!*--.*+=$!(7!K$/F$'2!(7!0#$!%&'()$*+! ,*'-.*/$+0S!0(>$0#$'!6.0#!+*0.(+*-!*+8!'$>.(+*-!)*'-.*/$+0*'.*+2!*+8!)*'0.$2S!&+.0$8!&+8$'!*! )(-.0.=*-!)-*07('/!=*--.+>!7('!+*0.(+*-!7'$$8(/!*+8!8$/(='*=B!.+!())(2.0.(+!0(!=$+0'*-.2$8S! 2&)'*+*0.(+*-!=(+0'(-?!I(+=$'+$8!6.0#!.22&$2!(7!7'$$8(/!*+8!8$/(='*=B!.+!0#$!%NS!0#$!%DL!8($2! +(0!()$'*0$!6.0#.+!0#$!E$70QJ.>#0!)(-.0.=*-!)*'*8.>/!*+8!.02!/$/F$'2!=(/$!7'(/!*='(22!*!6.8$! )(-.0.=*-!2)$=0'&/?! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:;P! ! ! 143 Social aspects and immigrations policies With mass migration being a INTRODUCTION 1 simplistic answer to the demographic and economic challenge Europe is actually facing, it The next European elections will be held from the 22nd till the is necessary to strengthen the 25th of May 2014 in all the Member States of the European position of the family in Europe Union. This charter puts forward the proposal of common and to preserve traditional family political policies that members of the European Alliance for policies. These are the only viable Freedom (EAF) wish to defend during the campaign, such as solutions to demographic issues, sovereignty, the retraction – or at least a deep re-examination while implementing, for instance, – of the single currency, and immigration issues. a more equitable tax system. Defending the right for each The European Alliance for 2 Member State to shape and implement its own asylum and Freedom will defend the immigration policies, as well as all the legislation regarding social and labour rights following fundamental for immigrants. Migrants from other EU Member States should also be subjected to these measures. changes: An enhanced protection of secularism in Europe, whose 3 Christian and humanistic roots are threatened by the rise of radical Islam within the European Union, and, in general, an affirmation of the people’s identity and of the nations that make up 2 Europe. 7 Economic aspects Institutional aspects Solidarity within the EU cannot be a one-way path. The At least a redefinition of the legislative 1 European Union is facing its deepest crisis since its inception 1 powers assigned to the European and economic issues that are truly real. The redistribution by Institutions and, more specifically, the wealthiest Member States to those that are facing financial those that are linked to the Lisbon Treaty imbalance is not a viable solution and only serves to avoid, in the in terms of national sovereignty and very short term, the collapse of the system. Therefore, the EAF will subsidiarity principles. call to put an end to supporting measures or other types of funding to Member States in financial difficulty as a result of current economic views and eurocentric dogmatism with regard to the single A greater consideration of currency and austerity. 2 European citizens through national referendums on The Member States that are facing a severe financial and issues of common interest at 2 economic crisis should be allowed to leave the eurozone, while the European level. a concerted dissolution of the eurozone should be considered. A Member State will be able to go back to its own national currency, A re-examination of enlargement to devaluate it if necessary, in order to relaunch its competitiveness. 3 policies of the European Union by holding referendums in each Member The implementation of protections for small, middle and large States with regard to accession criteria. 3 sized businesses, for industries in Europe and for the agricultural sector in particular. These The setting up of effective solutions towards lower protections will help to fight 4 unemployment rates, especially among young people. This against the unfair competition should be based on the conditions and evaluations pertaining induced by the mass to each Member State, and not on EU common policies; the importation of goods from individual approach being more effective than the general one. countries outside the European Union or other Member States. 6 3 DEFENDING DEMOCRACY IN EUROPE The European Alliance for Freedom was formed in order to promote and defend to the utmost the people’s and Member States’ democratic rights against the Brussels drift. Previously, patriotic leaders from various Member States with similar approaches on EU issues had to campaign without the benefits of a real alliance, or in the absence of coordinated action. With a view to the 2014 European Elections, a unified political force has been created in order to fight for the rights of citizens of each Member State of The state of the European Union in which we live today is a result of a the European Union. This new impetus for freedom lack of vision, of corruption and, moreover, the expansion of wants to curb the federalisation imposed by Brussels. centralised legislative powers in Europe. The sovereign Member This impetus, at the same, will promote the people’s States should be a source of innovation and of economic dynamism. sovereignty, renewed accountability and a budgetary They should be able to cooperate and to create bonds of excellence consolidation of States that is far from the current in necessary areas. They should be the engines for growth and views of austerity and globalisation. spreading prosperity in the face of the failures due to decisions imposed by Brussels. 4 5 Economic aspects Institutional aspects Solidarity within the EU cannot be a one-way path. The At least a redefinition of the legislative 1 European Union is facing its deepest crisis since its inception 1 powers assigned to the European and economic issues that are truly real. The redistribution by Institutions and, more specifically, the wealthiest Member States to those that are facing financial those that are linked to the Lisbon Treaty imbalance is not a viable solution and only serves to avoid, in the in terms of national sovereignty and very short term, the collapse of the system. Therefore, the EAF will subsidiarity principles. call to put an end to supporting measures or other types of funding to Member States in financial difficulty as a result of current economic views and eurocentric dogmatism with regard to the single A greater consideration of currency and austerity. 2 European citizens through national referendums on The Member States that are facing a severe financial and issues of common interest at 2 economic crisis should be allowed to leave the eurozone, while the European level. a concerted dissolution of the eurozone should be considered. A Member State will be able to go back to its own national currency, A re-examination of enlargement to devaluate it if necessary, in order to relaunch its competitiveness. 3 policies of the European Union by holding referendums in each Member The implementation of protections for small, middle and large States with regard to accession criteria. 3 sized businesses, for industries in Europe and for the agricultural sector in particular. These The setting up of effective solutions towards lower protections will help to fight 4 unemployment rates, especially among young people. This against the unfair competition should be based on the conditions and evaluations pertaining induced by the mass to each Member State, and not on EU common policies; the importation of goods from individual approach being more effective than the general one. countries outside the European Union or other Member States. 6 3 Social aspects and immigrations policies With mass migration being a INTRODUCTION 1 simplistic answer to the demographic and economic challenge Europe is actually facing, it The next European elections will be held from the 22nd till the is necessary to strengthen the 25th of May 2014 in all the Member States of the European position of the family in Europe Union. This charter puts forward the proposal of common and to preserve traditional family political policies that members of the European Alliance for policies. These are the only viable Freedom (EAF) wish to defend during the campaign, such as solutions to demographic issues, sovereignty, the retraction – or at least a deep re-examination while implementing, for instance, – of the single currency, and immigration issues. a more equitable tax system. Defending the right for each The European Alliance for 2 Member State to shape and implement its own asylum and Freedom will defend the immigration policies, as well as all the legislation regarding social and labour rights following fundamental for immigrants. Migrants from other EU Member States should also be subjected to these measures. changes: An enhanced protection of secularism in Europe, whose 3 Christian and humanistic roots are threatened by the rise of radical Islam within the European Union, and, in general, an affirmation of the people’s identity and of the nations that make up 2 Europe. 7 ! ! ! ! ! ! ! ! ! ! ! ! ! $33401C*'.='+,-./*01'L064.103'#.;*5*168! ! ! ! ! "#$!%&'()$*+!-$5$-!)(-.0.=*-!)*'0B!hD--.*+=$!(7!%&'()$*+!M*0.(+*-!K(5$/$+02i!6*2!7('/$8!.+! j&8*)$20S!k&+>*'B!(+!0#$!9 151 ! ! ! Political declaration Alliance of European National Movements • Conscious of our common responsibility for the European peoples and the diversity of cultures and languages they represent, • Mindful of the inalienable values of Christianity, natural law, peace and freedom in Europe, • Bearing in mind the numerous threats that powerful forces of globalisation pose to this priceless heritage. Representing the national parties and movements in Europe, we demand: 1. The creation of a Europe of free, independent and equal nations in the framework of a confederation of sovereign nation states, refraining from taking decisions on matters properly taken by states themselves; 2. The rejection of any attempt to create a centralised European Super State. 3. The promotion of the freedom, dignity and equal rights of every citizen, and opposition to all forms of totalitarianism. 4. The primacy of direct votes by the people or their elected representatives over any administrative or bureaucratic body. 5. The effective protection of Europe against new threats, such as terrorism and religious, political, economic, or financial imperialism. 6. A peaceful and humane settlement of immigration problems through, among other measures, international cooperation aiming at development and self- sufficiency of third world countries. 7. Strong policies in favour of families aiming at solving the demographic deficit in Europe and promoting traditional values throughout society. 8. The preservation of the diversity of Europe that results from the variety of our identities, traditions, languages and indigenous cultures. 9. A common fight of the European peoples against social dumping and the destructive effects of globalisation. Strasbourg, 15 September 2009 Source: http://aemn.eu/political-declaration/ 152 ! ! ! ! ! ! ! ! ! ! ! ! ! +,-./*01'J)-486401'2.3464C03'#.;*5*16! ! ! ! ! "#$!%&'()$*+!I#'.20.*+!,(-.0.=*-!K(5$/$+0!Y%I,KZ!.2!*!)(-.0.=*-!*22(=.*0.(+!(7!I#'.20.*+Q 8$/(='*0.=!)*'0.$2!*+8!('>*+.2*0.(+2!6#.=#!*'$!*=0.5$!(+!*--!8.77$'$+0!)(-.0.=*-!-$5$-2!.+!%&'()$?! %I,K!.2!'$)'$2$+0$8!(+!0#$!+*0.(+*-!('!%&'()$*+!-$5$-!.+!;:!%N!/$/F$'!20*0$2?!!C)$*'#$*82! $-$=0.(+2!!%I,K!#*2!*!F'(*8!2=()$!(+!.22&$2!*+8!0#$/$2?!G&'.+>!0#$!=(/.+>!%&'()$*+!$-$=0.(+2! =*/)*.>+!%I,K!6.--!7(=&2!(+!0#$!7(--(6.+>!7.5$!2)$*'#$*82O!;?!K*''.*>$!*+8!#&/*+!8.>+.0B!9?! k&/*+!0'*77.=T.+>!*+8!2$^!0'*8$!V?!C&20*.+*F-$!$+0'$)'$+$&'2#.)!*+8!$=(+(/B! 153 ! ! ! ! ǡ ! "#$%&'()! ! *+)',$-&(! ! !!!!!! 154 "#$%&!'(!)'*+&*+,! "#$%&'()$"&#! *! +,! -&%!.!/(%&0/!&-!1(2.#!'"3#"$4! 5! *,! -&%!.#!/)&#&24!$1.$!6&%78!-&%!0/&09/! :! ;,! 0%"&%"$4!-&%!-.2"94!.#'!2.%%".3/! ++! <,! -%//'&2!&-!-."$1=!))"/#)/!.#'!/>0%/88"&#! +;! 5,! 1(2.#!$%.--")7"#3?!-"31$"#3!2&'/%#@'.4!89.A/%4! +B! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! .! ! 155 -CD!E!/FDCGH!CI!'JKLJMN=!-DHHOCP!ELO!%HQGCLQJRJSJMN! ! -*+.'/01+2'*! 0,!&1$!$%()(2'%!%3'-'-!1+-!3$4$+#$5!+)6&1')78!'&!'-!,(3!%$3&+')!&1+&!+!73(9')7!):2;$3!(,!<$(<#$!')! ":3(<$!,$$#!5'-%())$%&$5!,3(2!&1$!":3(<$+)!=)'()!+-!')-&'&:&'()!+)5!'5$+>!! ?1$! "@A*! +%%$<&-! &1$! "=! +-! +! <(#'&'%+#! +)5! -(%'+#! 3$+#'&6>! B! 3$+#'&6! &1+&! 1+-! ;3(:71&! -&+;'#'&6! +)5! '2<3(4$5!#',$!(4$3!&1$!6$+3-!,(3!2+)6!<$(<#$!')!":3(<$>!C:&!&1$!"=!'-!')!)$$5!(,!+!)$9!<+3+5'72! ;+-$5!()!&1$!@13'-&'+)!:)5$3-&+)5')7!(,!&1$!1:2+)!;$')78!')!(35$3!&(!3$-&(3$!&1$!3$#+&'()!;$&9$$)! &1$!":3(<$+)!'5$+!+)5!&1$!<$(<#$!#'4')7!')!&1$!2$2;$3!-&+&$->!!D$!;$#'$4$!&1$!"=!1+-!;$%(2$!+! <3(E$%&!(,!+)!$#'&$!&1+&!'-!#+37$#6!(:&!(,!&(:%1!9'&1!&1$!3$+#'&6!')!&1$!*$2;$3!F&+&$->!?1$!":3(<$+)! <3(E$%&!9'##!()#6!;$!-:-&+')+;#$!',!&1$!7+!! ?1$3$! +3$! 2+)6! <$(<#$! ǁŽƌŬŝŶŐ ŝŶ ƚŚĞ ƵƌŽƉĞĂŶ ŝŶƐƚŝƚƵƚŝŽŶƐ ĂƐ D W͛Ɛ8! %'4'#! -$34+)&-! +)5! @(22'--'()$3-!9'&1!&1$!')&$)&'()!&(!%()&3';:&$!&(!&1$!5$4$#(<2$)&!(,!&1$!":3(<$+)!=)'()!+)5!&1$! 9$##;$')7!(,!'&-!%'&'G$)->!H(9$4$38!'&!'-!%#$+3!&1+&!&1$-$!$,,(3&-8!9$##I')&$)5$5!+-!&1$6!2+6!;$8!5'5!)(&! 3$-&(3$!&1'-!3$#+&'()!;$&9$$)!&1$!"=!+)5!&1$!%'&'G$)->!!! $CTEDOQ!E!/FDCGH!TH!UEL!DHSEMH!MC! ?1$3$!+3$!-'7)+#-!&1+&!&1$!$%()(2'%!%3'-'-!(,!&1$!#+-&!,'4$!6$+3-!'-!$+-')7!5(9)8!;:&!&1$!-'&:+&'()!'-!-&'##! ,3+7'#$!+)5!&1$3$!-&'##!'-!2+--!:)$2<#(62$)&!+2()7-&!6(:)7!<$(<#$!'->!?1$!73$+&$-&!3'-J!&1$!"=!%+)! ƚĂŬĞ ŝƐ ƚŽ ƐŝŵƉůLJ ŐŽ ďĂĐŬ ƚŽ ͚ďƵƐŝŶĞƐƐ ĂƐ ƵƐƵĂů͛͘ ?1$! (#5! <+3+5'72-! 9$3$! &1$! %(3$! 3$+-()! ,(3! &1$! $%()(2'%!%3'-'-!+)5!&1$!5$&$3'(3+&')7!3$#+&'()!;$&9$$)!&1$!"=!')-&'&:&'()-8!'&-!<(#'&'%+#!5'3$%&'()!+)5! &1$!')1+;'&+)&-!(,!&1$!"=!2$2;$3!-&+&$->!! ?1$!"@A*!5($-!)(&!<3$&$)5!&(!(,,$3!+!-(#:&'()!,(3!$4$36!+-<$%&!(,!&1$!%3'-'-!9$!&36!&(!(4$3%(2$>!!!K:3! 7(+#!'-!&(!(,,$3!+!)$9!<+3+5'72!+-!+!5'3$%&'()!,(3!&1$!5$4$#(<2$)&!(,!&1$!":3(<$+)!=)'()>! ?1$! ,:)5+2$)&! (,! &1'-! <+3+5'72! '-! &1$! 3$+#'-&'%! 4'$9! &1+&! &1$! 1:2+)! ;$')7! '-! 3$#+&'()+#>! 0)! '&-! ;'(#(7'%+#!$L'-&$)%$8!'&-!$%(#(7'%+#!5$<$)5$)%$!+)5!$%()(2'%!')&$35$<$)5$)%$8!#',$!'-!3$#+&'()+#>!K:3! 3$#+&'()+#!4'-'()!'-!+!;+#+)%$!;$&9$$)!')5'4'5:+#'&6!()!&1$!()$!1+)5!+)5!%:#&:3$!+)5!$)4'3()2$)&!()! &1$!(&1$3>!!0&!'-!)$'&1$3!%(##$%&'4'-&!)(3!')5'4'5:+#'-&>!! ?1'-!'-!+-!9$##!&1$!@13'-&'+)!:)5$3-&+)5')7!(,!1:2+)!5'7)'&6!&1+&!+,,'32-!&1$!4+#:$!(,!$4$36!1:2+)! ;$')7!,3(2!&1$!;$7'))')7!+)5!')!$4$36!<1+-$!(,!'&-!$L'-&$)%$8!+!4+#:$!&1+&!%+)!()#6!;$!:)5$3-&((5!')! 3$#+&'()!9'&1!$+%1!(&1$3>!!0,!9$!:)5$3-&+)5!1(9!4+#:+;#$!&1$!(&1$3!<$3-()!'-8!9$!%+)!:)5$3-&+)5!&1$! 4+#:$!(,!#',$!+)5!&1$!)$$5!&(!-$$!+)5!#'4$!#',$!3$#+&'()+##6>!?1'-!:)5$3-&+)5')7!1+-!-1+<$5!&1$!1'-&(36! (,!":3(<$!+)5!'-!&1$!,(:)5+&'()!(,!&1$!4+#:$-!9$!%1$3'-1!&(5+6>!B##!,:)5+2$)&+#!3'71&-!+)5!,3$$5(2-! +3$!;+-$5!()!&1$!@13'-&'+)!:)5$3-&+)5')7!(,!&1$!<3$%'(:-)$--!(,!$4$36!')5'4'5:+#>!! D$!)$$5!+!3$)$9$5!:)5$3-&+)5')7!+)5!$2<1+-'-!()!&1$-$!@13'-&'+)I3$#+&'()+#!)(&'()-!')!(35$3!&(! (4$3%(2$! &1$! %:33$)&! %3'-'->! 0)! (:3! :)5$3-&+)5')78! &1$! 3((&! (,! &1'-! %3'-'-! '-! ')5'4'5:+#'-2! ')! 91'%1! ')5'4'5:+#!,3$$5(2!1+-!;$$)!-$<+3+&$5!,3(2!&1$!3$#+&'()!9'&1!(&1$3!<$(<#$!+)5!-(%'$&68!+)5!')!91'%1! &1$!1:2+)!;$')7!'-!:)5$3-&((5!+-!+)!+:&()(2(:-!')5'4'5:+#>!?1'-!&6<$!(,!')5'4'5:+#'-2!1+-!+##(9$5! 73$$5! &(! ;$%(2$! +! 2+E(3! %+:-$! ,(3! (:3! $%()(2'%! %3'-'->! ! 0)5'4'5:+#'-2! '-! &1$! 3((&! (,! 2+)6! -(%'+#! <3(;#$2-! 9$! ,+%$! &(5+6>! ?1$! 9$+J$)')7! -'&:+&'()! (,! &1$! ,+2'#68! &1$! ,3+%&:3')7! (,! -(%'$&6! +)5! &1$! /! ! 156 5$%3$+-')7! -(#'5+3'&6! +3$! $--$)&'+##6! 3((&$5! ')! &1'-! &6<$! (,! ')5'4'5:+#'-2>! ?1'-! -(%'+#! -'&:+&'()! '-! +! 2+E(3!-(:3%$!(,!5'-&3:-&!')!&1$!":3(<$+)!')-&'&:&'()->!! B)(&1$3!%()-$N:$)%$!(,!&1'-!$2<1+-'-!()!+:&()(2(:-!')5'4'5:+#'-2!'-!&1$!%(22(5','%+&'()!(,!#',$>! ?1$3$! '-! +! 5$4$#(<2$)&! ')! 91'%1! 9$+J$3! +)5! 4:#)$3+;#$! #',$! O;$7'))')7! +)5! $)5')7P! ;$%(2$-! -:;(35')+&$5! &(! &1$! -&3()7$3! -&+7$-! (,! #',$>! @:33$)D! &1$! %1('%$! (,! &1$! +:&()(2(:-! ')5'4'5:+#! '-! (,&$)!-$$)!+-!&1$!1'71$-&!<3')%'<#$!+)5!(&1$3!4+#:$-!#'J$!3$-<()-';'#'&6!+)5!2:&:+#!%+3$!+3$!<:&!:)5$3! <3$--:3$>!! ?1$!%(22(5','%+&'()!(,!#',$!'-!)(&!()#6!-$$)!')!2$5'%+#I$&1'%+#!5$;+&$->!0&!'-!<3$-$)&!')!+##!-'&:+&'()-!')! 91'%1!&1$!-&3()7!:-$!+)5!&+J$!+54+)&+7$!(,!&1$!9$+J>!H:2+)!&3+,,'%J')7!+-!2(5$3)I5+6!-#+4$36!'-!+! 3$+#!<3(;#$2!')!":3(<$>!!0)!(:3!$%()(26!9$!-$$!&1+&!&1(-$!91(!1+4$!+!9$+J$3!<(-'&'()!-&3:77#$!&(! 2+')&+')!+!5$%$)&!#$4$#!(,!#'4')7>!?((!(,&$)!<$(<#$!+3$!-$$)!+-!+!2$+)-!&(!+)!$)5>!A(4$3&6!+)5!&1$! ŶƵŵďĞƌŽĨ͚ǁŽƌŬŝŶŐƉŽŽƌ͛ŚĂ-!3$+%1$5!:)<3$%$5$)&$5!#$4$#!')!<(-&I9+3!":3(<$>!! B! @13'-&'+)I3$#+&'()+#! +<<3(+%1! '-! )$%$--+36! &(! %(:)&$3! &1$-$! %()-$N:$)%$-! +)5! $L%$--$-! (,! +:&()(2(:-! ')5'4'5:+#'-2! +)5! &(! <3(4'5$! +! ;+#+)%$5! 4'$9! ()! 1:2+)'&6! +)5! -(%'$&6>! ! B!4'$9!&1+&! ')%#:5$-!&1$!3$#+&'()+#!+)5!$2(&'()+#!5'2$)-'()-!(,!#',$!91'%1!+3$!2(3$!%(2<#$&$!&1+)!&1$!%:33$)&! +:&()(2(:-!<$3%$<&'()!(,!&1$!1:2+)!;$')7>! ?1'-!1+-!,+3I3$+%1')7!'2<#'%+&'()-!,(3!&1$!"=!+)5!'&-!<(#'%'$->!*+)6!<(#'%'$-!&(5+6!+3$!;+-$5!()!&1$! <$3%$<&'()!(,!&1$!1:2+)!;$')7!+-!+)!+:&()(2(:-!')5'4'5:+#!91(!9'##!2+J$!3+&'()+#!5$%'-'()-!+)5! -&3'4$! ,(3! $,,'%'$)%6>! ?1'-! 4'$9! '-! '2<#'%'! 3$,#$%&$5! ')! 2+)6! "=! <(#'%'$-! 91'%1! +3$! (,&$)! ()#6! 2$+-:3$5!,(3!&1$'3!$%()(2'%!$,,'%'$)%6!+)5!(:&%(2$>!?1'-!()$I-'5$5!,(%:-!&(7$&1$3!9'&1!&1$!()$I -'5$5!+<<3(+%1!&(!$%()(26!1+-!$),(3%$5!+!5'-$2<(9$3$5!+)5!5'-%())$%&$5!,$$#')7>!!0&!'-!%#$+3!&1+&!+! %1+)7$!(,!5'3$%&'()!'-!)$%$--+36>! 8FRQJOJEDJMN! B!3$4+#:+&'()!(,!-:;-'5'+3'&6!;+-$5!()!&1$!3$#+&'()+#!<+3+5'72!'-!)$%$--+36>!F:;-'5'+3'&6!2$+)-!&1+&! <(#'&'%+#!5$%'-'()-!+)5!&1$'3!$L$%:&'()!-1(:#58!')!<3')%'<#$8!&+J$!<#+%$!+&!&1$!#$4$#!&(!91'%1!<$(<#$! 3$#+&$! &(! +)5! &1$3$,(3$! ,$$#! $2<(9$3$5! &(9+35-! &1$! 5$%'-'()I2+J')7! <3(%$-->! Q:$! &(! &1$! #+%J! (,! -:;-'5'+3'&6!2+)6!,$$#!:)3$#+&$5!+)5!&1$3$,(3$!5'-$2<(9$3$5>!D$!)$$5!+)!"=!&1+&!:)5$3-&+)5-!&1'-! +)5!&3'$-!&(!;:'#5!&1$!3$#+&'()!9'&1!&1$!<$(<#$!')!&1$!"=>!?1'-!2$+)-!+)!"=!9'&1(:&!&1$!,$5$3+#'-&! ĚƌĞĂŵŽĨĂŶ͚ĞǀĞƌĐůŽƐĞƌƵŶŝŽŶ͛͘ZĂƚŚĞƌĂŶ hƚŚĂƚǁŝůůƌĞĨŽĐƵƐǁŝƚŚŵŽƌĞĞŶĞƌŐLJĂƚƚŚĞ5$%'-'()-!+)5! &+-J-!&1+&!)$$5!&(!;$!5()$!+&!&1'-!#$4$#>!! K:3! 3$#+&'()+#! :)5$3-&+)5')7! +#-(! ')%#:5$-! &1$! %:#&:3+#! 5'2$)-'()>! ! B)6! <$3-()! '-! 3$#+&$5! &(! +)5! -1+<$5!;6!&1$!-:33(:)5')7!%:#&:3$>!"4$)!&1(:71!%:#&:3$!'-!)(&!+!)+&'()+#'-&!()$I5'2$)-'()+#!%()%$<&8! '&!'-!+!3$+#'&6!&1+&!1+-!&3$2$)5(:-!$,,$%&!()!<(#'&'%-!+)5!<(#'%'$->!0&!'-!+!3$+#'&6!&1+&!1+-!)(&!;$$)!7'4$)! -:,,'%'$)&! 9$'71&! ')! "=! <(#'%6!2+J')7! 5:$!&(! &1$! #'2'&$5! ')5'4'5:+#'-&! :)5$3-&+)5')7! (,! &1$! 1:2+)! ;$')7>!B-!+!%()-$N:$)%$!&1$!"=!1+-!;$$)!()!+!%3+-1!%(:3-$!9'&1!$%()(2'%!+)5!<(#'&'%+#!3$+#'&'$-!')! &1$!2$2;$3!-&+&$-!')!&1$!#+-&!,$9!6$+3->!?1'-!1+-!;$$)!2(-&!4'-';#$!')!&1$!$:3(!%3'-'-8!+!%3'-'-!<+3! %+:-$5!;6!,+'#')7!&(!:)5$3-&+)5!%:#&:3+#!5',,$3$)%$->!! D$!+54(%+&$!+)!"=!&1+&!&+J$-!&1$!3$#+&'()+#!3$+#'&6!(,!#',$!+)5!-(%'$&6!')&(!+%%(:)&!')!+##!'&-!<(#'%'$->! ?1'-!9'##!(<$)!&1$!5((3!&(!+)!"=!&1+&!,+%'#'&+&$-!2(3$!+)5!3$7:#+&$-!#$-->!0&!2$+)-!&1+&!+!5((3!)$$5-! &(!;$!(<$)$5!&(9+35-!+)!"=!&1+&!9'##!+##(9!2(3$!5'4$3-'&6!')!2(3$!<(#'%6!,'$#5-!&1+)!'&!%:33$)!5($->! ! M! ! 157 D$!+-!"@A*!;$#'$4$!&1+&!&1$!3$#+&'()+#!3$+#'&6!(,!#',$!2$+)-!&1+&!9$!%+))(&!-$<+3+&$!<$(<#$!,3(2! ƚŚĞŝƌŚŝƐƚŽƌLJĂŶĚĐƵůƚƵƌĂůďĂĐŬŐƌŽƵŶĚƐ͘/ƚŝƐƚŚĞƌĞĨŽƌĞŶŽƚƌĞĂůůLJƉŽƐƐŝďůĞƚŽŝŵƉůĞŵĞŶƚ͚ŽŶĞƐŝnjĞĨŝƚƐ Ăůů͛ƐŽůƵƚŝŽŶƐĂĐƌŽƐƐ ƵƌŽƉĞ͘dŚĞŝĚĞĂƚŚĂƚƚŚŝƐǁĂƐƉŽƐƐŝďůĞ͕ƌĞŐĂƌĚůĞƐƐ(,!(:3!%:#&:3+#!5'4$3-'&68!9+-! ()$!(,!&1$!2+E(3!3$+-()-!,(3!&1$!%3'-'-!&1+&!1'&!&1$!,(:)5+&'()!(,!&1$!$:3(>!! ?1$!"@A*!9'##!<3$-$)&!+!):2;$3!(,!'5$+-!;+-$5!()!(:3!<+3+5'72>! 0)!&1'-!9$!9'##!,(%:-!()!1:2+)! 5'7)'&6!,(3!+##8!+)!')%#:-'4$!":3(<$+)!$%()(268!3$%(7)'&'()!(,!,+2'#6!#',$8!,3$$5(2!(,!3$#'7'()8!;$#'$,! +)5!%()-%'$)%$!+)5!%(2;+&')7!1:2+)!&3+,,'%J')7>!!! ?1$!7(+#!(,!&1$-$!<3(<(-+#-!'-!&(!'2<3(4$!&1$!"=!+)5!-&'2:#+&$!&1$!5$;+&$!')!'&-!5'3$%&'()>!D$!9'##! %1+##$)7$! &1$! $L'-&')7! -&+&:-! N:(! ;:&! 9$! 9'##! ŶŽƚ ĂĐĐĞƉƚ ƚŚĞ ůĂďĞů ͚":3(-%$<&'%͛ ƚŽ Ě$-%3';$! &1'-! %1+##$)7$>!D$!;$#'$4$!+!2+&:3$!5$;+&$!()!&1$!,:)5+2$)&+#-!(,!&1$!"=!'-!<(--';#$!9'&1(:&!+'2')7!&(! 5'-2+)&#$! &1$! "=>! D$! %1+##$)7$! &1$! #+37$3! ":3(<$+)! <+3&'$-! &(! ;$! (<$)! &(! )$9! '5$+-! 9'&1(:&! ůĂďĞůůŝŶŐƚŚĞŵĂƐ͚":3(-%$<&'%͛ĂŶĚǁĞĐŚĂůůĞŶŐĞƚŚŽƐĞ!<+3&'$-!91(!N:$-&'()!&1$!$L'-&$)%$!(,!&1$!"=! &(!<3$-$)&!%()-&3:%&'4$!+#&$3)+&'4$->! D$!9'##!<3(2(&$!&1'-!4'-'()!')!&1$!%(2')7!":3(<$+)!$#$%&'()-!+)5!')!&1$!,(##(9')7!6$+3->!!D$!')4'&$! &1$!<$(<#$!(,!":3(<$!&(!;$!<+3&!(,!&1'-!<3(%$-->!! ! ! R! ! 158 34 5'.!#!60.'7&!'(!809#*!:2;*2+! @:#&:3+#! 4+#:$-! 3$#+&$5! &(! 1:2+)! 5'7)'&6! 3$<3$-$)&! -(2$! (,! &1$! 2(-&! -'7)','%+)&! +-<$%&-! (,! %()&$2<(3+36! -(%'$&'$-! &13(:71(:&! ":3(<$! +)5! ')&$3)+&'()+##6>! H:2+)! 5'7)'&6! 1+-! ')%3$+-')7#6! ;$%(2$! +! <13+-$! +--(%'+&$5! 9'&1! 4+#:$-! +%3(--! 4+3'(:-! -<$%&3:2->! H(9$4$38! 1:2+)! 5'7)'&6! '-! )(&! ()#6! +! 4+#:$8! '&! '-! )(&! +! ;$#'$,8! +)5! '&! '-! )(&! +)! (<')'()>!T+&1$38!1:2+)!5'7)'&6!'-!+!<3')%'<#$!+)5!&3+)-%$)5-!&1$!-:;E$%&'4$!+)5!<3$-$)&-!+!3$+#'&6!(,! %3'&'%+#!'2<(3&+)%$!&(!$+%1!()$!(,!:->!B-!+!<3')%'<#$8!1:2+)!5'7)'&6!'-8!&1$3$,(3$8!:)%1+)7$+;#$!+)5! 3$#$4+)&!')!+##!%:#&:3$-!+&!+##!&'2$->!0)!":3(<$8!&1$!<3')%'<#$!(,!1:2+)!5'7)'&6!'-!')-%3';$5!')!&1$!,'3-&! +3&'%#$! (,! &1$! @1+3&$3! (,! U:)5+2$)&+#! T'71&-! (,! &1$! "=V! 88H:2+)! 5'7)'&6! '-! ')4'(#+;#$>! 0&! 2:-&! ;$! ƌĞƐƉĞĐƚĞĚĂŶĚƉƌŽƚĞĐƚĞĚ͛͛͘!! H:2+)! 5'7)'&6! $L<3$--$-! &1$! ')&3')-'%! 4+#:$! (,! $4$36! 1:2+)! ;$')7>! 0)! @13'-&'+)'&68! &1'-! :)'4$3-+#! <3')%'<#$!3$-&-!()!&1$!1:2+)!;$')7!+-!%3$+&$5!')!&1$!'2+7$!+)5!#'J$)$--!(,!W(5>!@3$+&$5!')!H'-!'2+7$! +)5!#'J$)$--!5$,')$-!&1$!1:2+)!;$')7!+-!+!3$#+&'()+#!;$')7>!?1$!@13'-&'+)!:)5$3-&+)5')7!(,!W(5!'-! ?3')'&+3'+)!+)5!&1$3$,(3$!3$#+&'()+#!91'%1!2$+)-!&1+&!&1'-!'-!3$,#$%&$5!')!1:2+)!$L'-&$)%$>!A(#'&'%+##6! &1'-!2$+)-!&1+&!1:2+)!5'7)'&6!'-!)(&!E:-&!+;(:&!&1$!4+#:$!+)5!3'71&-!(,!&1$!')5'4'5:+#>!H:2+)!5'7)'&6! '-! )(&! ,:##6! 3$+#'G$5! +-! #()7! +-! &1$! 4+#:$!(,! %(22'&&$5! 3$#+&'()-! '-! )(&! +<<3$%'+&$5! +)5! %1$3'-1$5>! H:2+)! 5'7)'&6! ')%#:5$-! 4+#:')7! 3$#+&'()-! +)5! -&3'4')7! &(9+35-! &1$! 3'71&! +)5! E:-&! 3$#+&'()-! ')! #',$! $&1'%-8!-(%'$&6!+)5!$%()(26>!!! ?1$! ')&3')-'%! 4+#:$! (,! &1$! 1:2+)! ;$')7! ')%#:5$-! $4$36! -&+7$! (,! 1:2+)! $L'-&$)%$>! "L%#:5')7! &1$! ;$7'))')7! (3! &1$! $)5! (,! 1:2+)! #',$! ,3(2! &3$+&2$)&! +-! 1:2+)8! :)5$32')$-! ,:)5+2$)&+##6! &1$! ')&3')-'%!4+#:$!(,!&1$!1:2+)!;$')7!+)5!'-!&1$3$,(3$!+!4'(#+&'()!(,!1:2+)!5'7)'&6>!D$!%+))(&!$L%#:5$! +)6! -&+7$! (,! 1:2+)! #',$! ,3(2! 1:2+)! 5'7)'&6>! ?1$3$! '-! +! <+3&'%:#+3! )$$5! &(! <3(&$%&! 4:#)$3+;#$8! 1+)5'%+<<$58!(3!:);(3)!2$2;$3-!(,!&1$!H:2+)!U+2'#6>!! AESFJLK!SJIH! 0--:$-! &(:%1')7! #',$! $&1'%-! 1+4$! -')%$! #()7! ;$$)! <+3&! (,! &1$! "=! +7$)5+>! "-<$%'+##6! ')! &1$! ,'$#5-! (,! 3$-$+3%1!+)5!,(3$'7)!+'5>!?1$!"=!'-!+!2+E(3!5()(3!&(!3$-$+3%1!<3(E$%&-!')!2+)6!,ŝĞůĚƐ͕ŝŶĐůƵĚŝŶŐ͚ůŝĨĞ ƐƚƵĚŝĞƐ͛ƚŚĂƚŵĂLJƌĂŝƐĞďŝŽI$&1'%+#!N:$-&'()->!?1$!"=!'-!+-!9$##!+)!'2<(3&+)&!-:<<(3&$3!(,!,(3$'7)!+'5! +)5!')!&1'-!9+6!')4(#4$5!')!N:$-&'()-!+3(:)5!3$<3(5:%&'4$!$&1'%->! T$-<$%&!,(3!H:2+)!Q'7)'&6!')!&1$!,'$#5!(,!C'(2$5'%+#!3$-$+3%1!3$N:'3$-!:)'4$3-+#!+%%$<&+)%$!(,!&1$! <3')%'<#$! &1+&! F%'$)%$! 2:-&! -$34$! H:2+)'&6! 3+&1$3! &1+)! H:2+)'&6! -$34$! F%'$)%$>! H:2+)! #',$8! ')! 91+&$4$3! ,(328! 91+&$4$3! '&-! +<<$+3+)%$! (3! %+<+%'&68! 1+-! ')1$3$)&! +)5! ')5'-<:&+;#$! 5'7)'&6>! C+-'%! ;'(#(7'%+#!<3')%'<#$-!'33$,:&+;#6!-1(9!&1+&!,3(2!&1$!2(2$)&!(,!%()%$<&'()!(3!%3$+&'()!&1$!$2;36(! ')-'5$!(3!(:&-'5$!&1$!9(2;!'-!+!:)'N:$!1:2+)!;$')7!9'&1!+!:)'N:$!7$)$&'%!%(5$>!! dŚĞĚĞďĂƚĞĂƌŽƵŶĚƚŚĞƌĞƉŽƌƚ͚ŽŶƐĞdžƵĂůĂŶĚƌĞƉƌŽĚƵĐƚŝǀĞŚĞĂůƚŚĂŶĚƌŝŐŚƚƐ͛ƚŚĂƚǁĂƐƚĂďůĞĚďLJ!*"A! "5'&$! "-&3ĞůĂ ŚĂƐ ŵĂĚĞ ĐůĞĂƌ ƚŚĂƚ Ă ŶƵŵďĞƌ ŽĨ E'K͛Ɛ ĂŶĚ ĂůůŝĞĚ D W͛Ɛ ƉƵƐŚ ĨŽƌ ĂďŽƌƚŝŽŶ ƚŽ ďĞ ')%#:5$5!')!"=!<(#'%'$->!?1$!1:7$!9+4$!(,!<3(&$-&!,3(2!%'&'G$)-!,3(2!+##!2$2;$3I-&+&$-!#$+5!&(!&1$! 3$E$%&'()!(,!&1'-!3$<(3&>!?1$!1'71!<3(,'#$!(,!&1$!5$;+&$!2+5$!2+)6!<$(<#$!+9+3$!&1+&!&1'-!'-!<#+6')7!+&! "=! #$4$#>! ?1$! -(IĐĂůůĞĚ ͚ ƐƚƌĞůĂ ƌĞƉŽƌƚ͛ ƐĞĞŵƐ ƚŽ ďĞ Ă ƌĞĂĐƚŝŽŶ ŽŶ &1$! -:%%$--! (,! &1$! ":3(<$+)! ŝƚŝnjĞŶƐ͛/ŶŝƚŝĂƚŝǀĞ͚KŶĞŽĨhƐ͛ƚŚĂƚƌĞĐĞŝǀĞĚƐƵƉƉŽƌƚĨƌŽŵϭ͕ϴŵŝůůŝŽŶĐŝƚŝnjĞŶƐŝŶƚŚĞ h͘! ?1$! "@A*! 9$#%(2$-! &1$! -&+&$2$)&-! ,3(2! &1$! ":3(<$+)! @(22'--'()! ')! 91'%1! '&! 9+-! %#$+3#6! $L<3$--$5!&1+&!+;(3&'()!'-!+)!'--:$!(,!&1$!2$2;$3I-&+&$-!+)5!)(&!+)!'--:$!,(3!"=!<(#'%'$->!0)!+55'&'()8! S! ! 159 &1$!"@A*!3$%+##-!&1+&!&1$!":3(<$+)!@(:3&!(,!Y:-&'%$!1+-!3:#$5!OC3Z-&#$!4->!W3$$)<$+%$P!&1+&!+!1:2+)! $2;36(!3$<3$-$)&-!&1$!;$7'))')7!')!&1$!5$4$#(<2$)&!(,!+!1:2+)!;$')7>!! U(##(9')7!&1'-8!+)5!;+-$5!()!&1$!5$-%3';$5!<3')%'<#$-!(,!1:2+)!5'7)'&68!&1$!"@A*!%+##-!()!&1$!)$L&! ":3(<$+)!@(22'--'()!&(!$)5!&1$!,')+)%')7!(,!+%&'4'&'$-!&1+&!<3$-:<<(-$!&1$!5$-&3:%&'()!(,!1:2+)! $2;36(-8!')!<+3&'%:#+3!')!&1$!+3$+-!(,!3$-$+3%18!5$4$#(<2$)&!+'5!+)5!<:;#'%!1$+#&1>!! ?1$! "@A*!(<<(-$-! +)6!2(4$! &(9+35-!&1$! ')%#:-'()! (,! +;(3&'()! ')! "=! <(#'%'$->! ?1$! "@A*! $L<$%&-! ,3(2!&1$!@(22'--'()!&(!%()&'):$!&1$'3!%#$+3!-&+)%$!()!&1'-!'--:$!!!?1$!"@A*!%()-$N:$)!%+##-!()! &1$!@(22'--'()!&(!$)5!"=!,:)5')7!&1+&!-:<<(3&-!&1$!<3(2(&'()!(,!+;(3&'()!+-!<+3&!(,!3$<3(5:%&'4$! 1$+#&1!+)5!3'71&->!! $VH!UDJQJQ!CI!VFPEL!OJKLJMN!!! A(<$!U3+)%'-!2+5$!')!&1$!$L1(3&+&'()!["4+)7$#''!W+:5':2[!+!%#$+3!#')J!;$&9$$)!&1$!$%()(2'%!%3'-'-! +)5!1:2+)!5'7)'&6>!0)!2+)6!9+6-!&1$!%3'-'-!1+-!3$4$+#$5!:)E:-&!$%()(2'%!3$#+&'()-!+)5!1+-!')!&1$! <3(%$--!:)5$32')$5!1:2+)!5'7)'&6>!B)!$%()(26!(,!$L%#:-'()!'-!4'(#+&')7!1:2+)!5'7)'&6>! ?1$! 2'##'()-! (,! ":3(<$+)-! &1+&! #(-&! &1$'3! E(;-! +)5! &1$! 2+)6! 2(3$! &1+&! ,$#&! 5'-$2<(9$3$58! 1+4$! $L<$3'$)%$5!&1'-!')!&1$'3!(9)!#'4$->!?1$!73(9')7!<(4$3&6!')!":3(<$!+)5!')%3$+-')7!7+!! ?1'-!'-!)(&!()#6!+!":3(<$+)!'--:$>!0&!-1(:#5!;$!+!7#(;+#!<3'(3'&6!&(!,'71&!&1$!$)(32(:-!')E:-&'%$!&1+&! <$(<#$! $L<$3'$)%$! +)5! 1+-! $,,$%&! ()! $4$)! &1$'3! 2(-&! ;+-'%! )$$5->! "4$)! ')-&'&:&'()-! +-! &1$! D(3#5! "%()(2'%!U(3:2!1+4$!<(')&$5!&(!$%()(2'%!')$N:+#'&6!+-!+!2+E(3!7#(;+#!<3(;#$2>!0)!+!&'2$!')!91'%1! 9+7$-!,$##!-:;-&+)&'+##68!&1$!-:<$3I3'%1!()#6!')%3$+-$5!&1$'3!9$+#&1>! ?1$!"@A*!9'##!&1$3$,(3$!-$&!(:&!+)!+7$)5+!&(9+35-!+)!')%#:-'4$!$%()(26!;+-$5!()!E:-&!$%()(2'%! 3$#+&'()->!0)!(:3!(<')'()!&1'-!'-!&1$!()#6!#()7I&$32!+)-9$3!&(!&1'-!%3'-'->!?1$3$!'-!+!)$$5!&(!$)5!&1$! -'&:+&'()!')!91'%1!&1$!2+3J$&<#+%$!+)5!,')+)%'+#!-<$%:#+&'()!-$$2!+:&()(2(:-!+)5!-$<+3+&$5!,3(2! -(%'$&6!91'#$!+&&+%J')7!1:2+)!5'7)'&6>!D$!)$$5!+)!$%()(26!&1+&!9(3J-!,(3!&1$!<$(<#$!+)5!+54+)%$-! &1$!5'7)'&6!(,!$4$36!1:2+)!;$')7>!! U(3!&1'-!3$+-()!&1$!"@A*!-:<<(3&-!ƚŚĞ͚A#$57$!,(3!+!9(3JIĨƌĞĞ^ƵŶĚĂLJĂŶĚĚĞĐĞŶƚǁŽƌŬ͛ĂƐůĂŝĚĚŽǁŶ ;6!&1$!":3(<$+)!F:)5+6!B##'+)%$V!! ?(! $)-:3$! &1+&! +##! 3$#$4+)&! "=I#$7'-#+&'()! ;(&1! 3$-<$%&-! +)5! <3(2(&$-! &1$! <3(&$%&'()! (,! +! %(22()! 9$$J#6! 5+6! (,! 3$-&! ,(3! +##! "=! %'&'G$)-8! 91'%1! -1+##! ;$! ')! <3')%'<#$! ()! +! F:)5+68! ')!(35$3! &(! <3(&$%&! 9(3J$3-\!1$+#&1! +)5! <3(2(&$! +! ;$&&$3! ;+#+)%$!;$&9$$)!,+2'#6!+)5!<3'4+&$!#',$!+)5!9(3J]! ?(! <3(2(&$! "=I#$7'-#+&'()! 7:+3+)&$$')7! -:-&+')+;#$! 9(3J')7! &'2$! <+&&$3)-! ;+-$5! ()! &1$! <3')%'<#$! (,! 5$%$)&! 9(3J! ;$)$,'&')7! -(%'$&6! +-! 9$##! +-! &1$! $%()(26! +-! +! 91(#$>.! W(4$3)2$)&-! +3$! ')! $--$)%$! )(&! 2$+)&! &(! 3:)! $%()(2'$-! ;:&! %+)! -:<<(3&! %1+)7$-! ')! &1$! 3'71&! 5'3$%&'()>! ?1'-! ')%#:5$-! &1$! "=! 7(4$3)2$)&+#! ')-&'&:&'()->! H(9$4$38! $4$)! 2(3$! &1+)! 3$)$9+#! (,! <(#'%'$-8!&1$3$!'-!+!)$$5!&(!-$$!&1$!<$(<#$!;$1')5!&1$!):2;$3-!+-!2(3$!'2<(3&+)&!&1+)!$%()(2'%! ,'7:3$->!?1'-!9'##!3$,#$%&!+)!+9+3$)$--!(,!&1$!Q'7)'&6!+)5!')&3')-'%!4+#:$!(,!$4$36!1:2+)!;$')7>!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! .!1&& 160 =4 5'.!#*!61'*'9#+!?'.@,!('.!A&'7%&!!! ?1$!9(3-&!(,!&1$!$%()(2'%!%3'-'-!&1+&!<#+7:$5!&1$!$%()(2'$-!(,!":3(<$!-')%$!/__a!-$$2-!&(!1+4$! <+--$5>!0)!-(2$!%(:)&3'$-!&1$3$!+3$!$4$)!-(2$!-'7)-!(,!E(;!73(9&1>!?1'-!'-!+!9$#%(2$!-'&:+&'()!,(3! &1(-$!91(!%+)!)(9!,')5!+7+')!+!E(;>!!B&!&1$!-+2$!&'2$!;:-')$--$-!+)5!,+2'#'$-!+3$!-&'##!-&3:77#')7!&(! <+6! (,,! $L%$--! 5$;&-! +-! <:;#'%! 5$;&-! +3$! +&! <(-&I9+3! 1'71-! ')! +#2(-&! $4$36! "=! *$2;$3! F&+&$! +)5! %1$+! 0)! &1$! 7#(;+#! $%()(26! &1$! $2$37')7! $%()(2'$-8!91(-$!73(9&1!1$#<$5!":3(<$+)!$L<(3&$3-!&13(:71!&1$!%3'-'-8!+3$!)(9!-1(9')7!-'7)-!(,! -&+7)+&'()>! ?1'-!-1(9-!&1$!,3+7'#'&6!(,!&1$!%:33$)&!5$-'7)!(,!(:3!$%()(2'%!-6-&$2>!?1$!%3'-'-!1+-!5$2()-&3+&$5! &1$!2+E(3!,#+9-!91'%1!1+4$!&(!;$!5$+#&!9'&1!')!(35$3!&(!<3$4$)&!+!3$<$&'&'()>!F'2<#6!%()&'):')7!9'&1! &1$! %:33$)&! -6-&$2! 9'&1(:&! +553$--')7! ,:)5+2$)&+#! '--:$-! '-! )(&! +)! (<&'()>! ?1$! ,:)5+2$)&+#! N:$-&'()-!(,!<(4$3&6!O+)5!9(3J')7!<((3P8!(9)$3-1'<8!$%(#(768!$)$3768!+7$')7!+)5!3$-(:3%$-!%+))(&! ;$!'7)(3$5!5:$!&(!&1$!-'2<#$!,+%&!&1+&!',!&1$-$!'--:$-!+3$!)(&!5$+#&!9'&1!&1$6!9'##!;$%(2$!&1$!%+:-$! ,(3!+!5$$<$3!%3'-'->!! $CTEDOQ!E!LHT!HUCLCPJU!GEDEOJKP! U(3!&1'-!3$+-()!&1$!3$#+&'()+#!<+3+5'72!1+-!&(!;$!+<<#'$5!&(!(:3!$%()(26>!"%()(26!'-!')!$--$)%$! +;(:&! #',$>! 0)! (:3! 4'$9! &1$! <:3<(-$! (,! +##! $%()(2'%! +%&'4'&'$-! '-! &(! -:<<(3&! #',$! +)5! +54+)%$! &1$! 9$##;$')7!,(3!+##>!"%()(26!'-!2$+)&!&(!<3(4'5$!-:,,'%'$)&!2$+)-!,(3!+##!<$(<#$8!&(!-:<<(3&!,+2'#6!#',$8! &(!#$&!<$(<#$!,#(:3'-1!9'&1!&1$'3!%3$+&'4$!&+#$)&-!+)5!&(!,')5!-(#:&'()-!,(3!&1$!<3(;#$2-!9$!,+%$/>!! ?1'-! 4'$9! #$+5-! &(! &1$! %()%#:-'()! &1+&! $%()(26! '-! )(&! E:-&! +;(:&! $,,'%'$)%6! +)5! %(2<$&'&'4$)$--! #$+5')7!&(!+!<3(,'&!3$7+35#$--!(,!&1$!-(%'(I%:#&:3+#!%()&$L&>!"%()(26!%+))(&!;$!-$$)!-$<+3+&$5!,3(2! %:#&:3$8!1'-&(36!+)5!3$#'7'()>!?1$!3$4$3-$!'-!+#-(!&3:$]!(:3!%:#&:3$8!%()4'%&'()-!+)5!1'-&(36!-1+<$!(:3! $%()(2'$-M>!B!<3(%$--!91'%1!5$2()-&3+&$-!&1+&!(:3!$%()(26!'-!+!3$#+&'()+#!<3(%$-->! H(9$4$38!+&!&1$!2(2$)&8!&1$!()$I5'2$)-'()+#!4'$9!(,!&1$!$%()(26!+-!+!-6-&$2!(,!2$3$!<3(5:%&'()! +)5!%()-:2<&'()8!'-!-&'##!5(2')+)&!3$7+35#$--!(,!'&-!:)-:-&+')+;'#'&6!')!;(&1!$%()(2'%!+)5!$%(#(7'%+#! &$32->!?1$!5(2')+)&!,+%&(3!')!&1'-!%:33$)&!4'$9!'-!%+<'&+#!91'%1!'-!-$$)!+-!&1$!2(-&!'2<(3&+)&!')<:&! +)5!3$-:#&!(,!&1$!$%()(2'%!<3(%$-->!F$$')7!%+<'&+#!+-!&1$!2(-&!5(2')+)&!,+%&(3!1+-!3$-:#&$5!')&(!+)! $%()(2'%!-6-&$2!')!91'%1!%+<'&+#!2+3J$&-!5(!)(&!()#6!5(2')+&$!&1$!91(#$!$%()(2'%!<3(%$--!;:&! $4$)!;$%(2$!+!&13$+&!&(!&1$!3$+#!$%()(26>!B!3$%$)&!3$-$+3%1!3$<(3&!,3(2!*%b')-$6!-1(9-!1(9!&1$! ,(%:-! ()! <3(,'&! ,(3! -1(3&I&$32! -1+3$1(#5$3! 4+#:$! '-! &(L'%! &(! &1$! 3$+#! $%()(26! (,! 3$+#! <$(<#$8! 3$+#! %(2<+)'$-8! 3$+#! <3(5:%&'()! +)5! 3$+#! -$34'%$-R>! D(3-$! $4$)8! &1$! -<$%:#+&'()! ()! ,((5! <3'%$-! 1+-! +<<+3$)!#$+5!&(!1:)7$3!+)5!-$4$3$!-(%'+#!<3(;#$2-!')!&1$!7#(;+#!-(:&1>!! ?1$!5(2')+)%$!(,!%+<'&+#!2+3J$&-!1+-!$4$)!<:&!5$2(%3+%6!'&-$#,!')!E$(<+356>!0)!&1$!#+-&!,$9!6$+3-!9$! 1+4$! -$$)! ;'7! ')4$-&2$)&! ,:)5-! +)5! '2<$3-()+#! ')&$3)+&'()+#! ;(5'$-! (4$33'5')7! &1$! 5$2(%3+&'%! ƉƌŽĐĞƐƐ͘ /ŶƚŚŝƐ ǁĂLJ ƚŚĞ ĚĞĐƌĞĂƐĞ ŽĨ ĞĐŽŶŽŵŝĐ ͚ŽǁŶĞƌƐŚŝƉ͛ ŚĂƐ! ;$$)!&3+)-#+&$5! ')&(! +! -'&:+&'()! ')! 91'%1!<$(<#$!,$$#!&1+&!&1$'3!5$2(%3+&'%!'),#:$)%$!1+-!7()$!+-!9$##>!!! B)!'2<(3&+)&!:)5$3#6')7!%+:-$!(,!&1$!$%()(2'%!%3'-'-!9+-!&1$!%:#&:3$!(,!$L%$--'4$!73$$5!')!&1$!9(3#5! (,! %+<'&+#! 2+3J$&->! ?1'-! 9+-! <+3! <(--';#$! 5:$! &(! &1$! +:&()(26! (,! &1$-$! 2+3J$&-! (4$3! &1$! 3$+#! $%()(268! #$+5')7! &(! +! 2$3$! ,(%:-! ()! 2()$6! 5'-%())$%&$5! ,3(2! '&-! $,,$%&-! ()! 3$+#! <$(<#$>! ?1'-! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! /!^ĞĞĂůƐŽ͚ĨƚĞƌĂƉŝƚĂůŝƐŵ͕ƌĞƚŚŝŶŬŝŶŐĞĐŽŶŽŵŝĐƌĞůĂƚŝŽŶƐŚŝƉƐ͕͛:ƵďŝůĞĞĂŵƉĂŝŐŶΘ W&͕ϮϬϭϮ! M!^ĞĞĂůƐŽ͚dŚĞ ĐŽŶŽŵŝĐƐŽĨ'ŽŽĚĂŶĚ ǀŝů͕͛ďLJdŽŵĄƓ^ĞĚůĄēĞŬ͕ϮϬϬϵ! R!1&& 161 %:#&:3$! '-! +&! &1$! -+2$! &'2$! $2;$55$5! ')! &1$! '5$+! &1+&! <$(<#$! +3$! )(! 2(3$! &1+)! <3(5:%$3-! +)5! %()-:2$3-! 91(! 1+4$! &(! -+&'-,6! &1$'3! 5$-'3$->! ?1$! #+&&$3! ;$%(2')7! 2(3$! +)5! 2(3$! ')5$;&$5! +)5! 5'-(9)$5>! ?1'-!-'&:+&'()!3+'-$-!&9(!,:)5+2$)&+#!N:$-&'()->!0&!3+'-$-!&1$!N:$-&'()!(,!4+#:$-!+)5!&1$!N:$-&'()!(,! (9)$3-1'! 0,!%(2<$&'&'()! +)5! $,,'%'$)%6! +3$! &1$! ()#6! 4+#:$-!')! $%()(2'%! <(#'%'$-! &1$)! 9$! 9'##! %3$+&$! +)! $%()(26! 91'%1! '7)(3$-! +##! (&1$3! $N:+##6! '2<(3&+)&! 4+#:$-! #'J$! &3:-&8! 3$-<()-';'#'&6! +)5! 3$%'<3(%'&6>! 0&! +#-(! <:&-! ,:)5+2$)&+#! 4+#:$-! ,(3! +! -(%'$&6! :)5$3! <3$--:3$! #'J$! 7$)$3(-'&6! +)5! 2:&:+#! %+3$>! B! #'2'&$5! -%(<$! (,! 4+#:$-! 9'##! &1$3$,(3$! #$+5! &(! &1$! $L%#:-'()! (,! '2<(3&+)&!+-<$%&-!(,!#',$!+)5!-(%'$&6!+)5!+-!+!%()-$N:$)%$!#$+5!&(!&1$!$L%#:-'()!(,!<$(<#$>!! ?1'-!'-!')5$$5!&1$!%+-$!')!&1$!%3'-'-!&1+&!1'&!":3(<$>!0&!'-!5$2()-&3+&$5!')!&1$!5$-%3';$5!$,,$%&-!()! 5$2(%3+%6>!D$!%+)!-$$!'&!$4$)!%#$+3$3!')!(:3!$%()(26>!=)$2<#(62$)&!1+-!3'-$)!&(!:)<3$%$5$)&$5! #$4$#-8! $-<$%'+##6! +2()7! 6(:)7! <$(<#$>! ! B%%(35')7! &(! &1$! ":3(<$+)! @(22'--'()! &1$3$! 1+-! ;$$)! +! ƐŚĂƌƉƌŝƐĞŽĨƉŽǀĞƌƚLJŝŶƚŚĞ h͘dŚĞƚƌĂĚŝƚŝŽŶĂůĂŶƐǁĞƌ͚ŵŽƌĞũŽďƐ͛ƚŽĞƐĐĂƉĞƉŽǀĞƌƚLJŝƐŶŽƚƐƵĨĨŝĐŝĞŶƚ 'ŶƚŚĞĨĂĐĞŽĨĂƌŝƐĞŝŶƚŚĞŶƵŵďĞƌŽĨ͚ǁŽƌŬŝŶŐƉŽŽƌ͛͘dŚĞϮϬϭϯ ŵƉůŽLJŵĞŶƚĞǀĞůŽƉŵĞŶƚŝŶ ƵƌŽƉĞ 3$4'$9!,(:)5!&1+&!()#6!1+#,!(,!&1$!<((3!91(!&+J$!+!E(;!+3$!+;#$!&(!$-%+<$!<(4$3&6>!?1$!$L<#(-'()!(,! :)$2<#(62$)&! '-! %#$+3#6! %())$%&$5! &(! &1$! 2+--'4$! ;+)J3:<&%6! (,! -2+##! +)5! 2$5':2! -'G$5! $)&$3<3'-$-!O^D ͛ƐP!+)5!2+--'4$!#+6I(,,-!;6!2:#&')+&'()+#->!C(&1!%+:-$-!(,!&1'-!2+--!:)$2<#(62$)&! <(')&!&(!&1$!)$$5!,(3!+!)$9!+)5!2(3$!')%#:-'4$!5'3$%&'()!(,!(:3!$%()(26>!! D1+&!'-!)$$5$5!&1$3$,(3$!'-!+!3$)$9$5!$2<1+-'-!()!4+#:$-!+)5!3$#+&'()-!')!(:3!$%()(2'%!&1')J')7! +)5!<(#'%'$->!0&!'-!)(9!&'2$!,(3!+!-6-&$2!&1+&!(,,$3-!)(!3$9+35!9'&1(:&!3$-<()-';'#'&68!)(!')4$-&2$)&! 9'&1(:&!')4(#4$2$)&!+)5!)(!<3(,'&!9'&1(:&!<+3&'%'<+&'()>!!! 0&!'-!&'2$!,(3!+!3$#+&'()+#!<+3+5'72!&1+&!#$+5-!&(!+!2(3$!')%#:-'4$!+<<3(+%1!')!91'%1!&1$!5'7)'&6!(,!&1$! 1:2+)!;$')78!(:3!%(22()!9$##;$')7!+)5!9'-$!-&$9+35-1'!?1'-!+<<3(+%1!%+)!7:'5$!&1$!"=!+-!9$##!+-!)+&'()+#!7(4$3)2$)&-!')! &1$'3!$%()(2'%!<(#'%'$->!! 3FJOHSJLHQ!ICD!/(!GCSJUJHQ!! C+-$5!()!&1$!(:&#')$5!'5$+!(,!3$#+&'()+#!4+#:$-!')!$%()(2'%!<(#'%'$-8!<(#'%6!2+J')7!1+-!&(!;$!5()$!+-! %#(-$#6!%())$%&$5!&(!&1$!<$(<#$!+-!<(--';#$>!?1'-!)+33(9-!&1$!-%(<$!(,!&1$!"=!<(#'%6!2+J')7!&(!'--:$-! &1+&!+3$!%:33$)!5$+#&!9'&1!+&!"=!#$4$#>!0)!'&-!$%()(2'%!<(#'%'$-!&1$!"=!%+)!)$4$3&1$#$--!<#+%$!)$9! 7(+#-!+)5!;$)%12+3J-!&1+&!5$,')$!$%()(2'%!-:%%$-->!! B!2+E(3!;$)%1I2+3J!%1+)7$!'-!&(!3$5$,')$!73(9&1!;$6()5!2$3$!WQA!&$32->!W3(9&1!1+-!&(!;$%(2$! 2(3$!&1+)!A:3%1+-')7!*+)+7$3-!0)5$L$-!OA*0P>!W3(9&1!')!&1'-!-%$)+3'(!1+-!&(!;$!5$,')$5!')!&1$!,'3-&! <#+%$!')!')%#:-'4$!&$32->!"%()(2'%!73(9&1!'-!()#6!<3$-$)&!',!&1$3$!'-!3'-$!')!$2<#(62$)&!+)5!5$%3$+-$! ')!<(4$3&68!')%#:5')7!+!5$%3$+-$!')!&1$!):2;$3!(,!9(3J')7!<((3>!0)%#:-'4$!73(9&1!%+)!,:3&1$32(3$! ŝŶĐůƵĚĞƚŚĞƐŝƚƵĂƚŝŽŶŽĨ^D ͛ƐĂƐĂƉƌŝŵĞŝŶĚŝĐĂƚŝŽŶŽĨƐƵƐƚĂŝŶĂďůĞĂŶĚůŽŶŐI&$32!'2<3(4$2$)&!(,!(:3! $%()(26>!K)$!%3:%'+#!73(9&1!2+3J$3!'-!&1$!5$%3$+-$!(,!$%()(2'%!<3$--:3$!()!,+2'#'$->!D$!1+4$!&(! 53'4$!&1$!"=!$%()(26!&(9+35-!+!7(+#V!HQ'!OH:2+)!Q$4$#(<2$)&!')5'%+&(3PS!(,!"=!%(:)&3'$-!-1(:#5! ;$!')!&1$!&(! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! S!1&& 162 B)(&1$3!73(9&1!')5'%+&(3!'-!&1$!3'-$!')!(9)$3-1'!0)%#:-'4$!73(9&1! ')%#:5$-! &1$! $L&$)&! (,! $%(#(7'%+#! <3$--:3$>! ?1$! $%(#(7'%+#! %(-&-! %+))(&! ;$! <+--$5! &(! ,:&:3$! 7$)$3+&'()->! dŚĞƌĞĨŽƌĞ ƚŚĞ h ƐŚŽƵůĚ ǁŽƌŬ ƚŽ Ă ͚ĐŝƌĐƵůĂƌ ĞĐŽŶŽŵLJ͛ ĂƐ ƌĞĐŽŵŵĞŶĚ ďLJ ƚŚĞ tŽƌůĚ "%()(2'%!U(3:2!')!(35$3!&(!1+4$!+!-:-&+')+;#$!+<<3(+%1!&(9+35-!&1$!:-+7$!(,!3$-(:3%$->! B)!'2<(3&+)&!)$9!7(+#!,(3!"=!$%()(2'%!<(#'%'$-!'-!&(!-&3'4$!,(3!3$+#!5'4$3-','%+&'()!')!(:3!$%()(26! +)5!')!&1$!,')+)%')7!2(5$#-!(,!%(2<+)'$-!+)5!(&1$3!;:-')$--!2(5$#->!B!1'71!5$73$$!(,!5'4$3-'&6!9'##! %3$+&$! +! 2(3$! -:-&+')+;#$! $%()(268! $-<$%'+##6! 91$)! &1'-! '-! +%%(2<+)'$5! ;6! 2(3$! 5'4$3-'&6! (,! ,')+)%')7>!?1'-!9'##!2+J$!(:3!$%()(26!#$--!5$<$)5')7!()!+!,$9!&6<$-!(,!,')+)%')7!+-!'&!'-!&1$!%+-$!+&! &1$!2(2$)&>!!F1+3')7!&1$!;$-&!<3+%&'%$-!+)5!;$)5')7!&1$!3$7:#+&'()!&(!&1+&!7(+#!%+)!;$!'2<(3&+)&!"=! <(#'%6! ')-&3:2$)&->! B! %:#&:3$! (,! -(%'+#! 3$-<()-';'#'&6! ')! &1$! %+<'&+#! 2+3J$&-! %+)! ;$! -&'2:#+&$58! -1(9')7!&(!&1$!%#'$)&-!&1+&!&1$6!-1(:#5!%1(-$!,'32-!9'&1!-(%'+#!3$-<()-';'#'&6!+)5!-:-&+')+;'#'&6>! /LUCFDEKJLK!JLUSFQJWH!KDCTMV!ELO!DHLHTES!CI!RFQJLHQQ!SJIH! 0)!9(3J')7!&(9+35-!+!2(3$!3$#+&'()+#!$%()(26!'&!'-!%3:%'+#!&1+&!&1$3$!'-!+!%#$+3!<3$,$3$)%$!+&!"=!#$4$#! ,(3! +##! &6<$-! (,! %(2<+)'$-! &1+&! +3$! ,(%:-$5! ()! -&+J$1(#5$3! 4+#:$>! ?1'-! <(#'%6! <3$,$3$)%$! -1(:#5! ')%#:5$!&1$!,(##(9')7!)()I$L1+:-&'4$!#'-&!(,!;:-')$--!2(5$#-V!F*"\-8!%(I(<$3+&'()-8!-(%'+#!$)&$3<3'-$-! +)5! ,(32-! (,! -1+3$5! (9)$3-1'! 0&! +#-(! ')%#:5$-! &1(-$! %(2<+)'$-! 91(! &+J$! -(%'+#! %(3<(3+&$!3$-<()-';'#'&6!-$3'(:-#6!+-!+)!')4$-&2$)&>!! B! ,+%'#'&+&')7! "=! 2$+)-! ')! &1'-! -<$%','%! ,'$#5! &1+&! &1$! "=! 9'##! 5$4$#(!"=!-:;-'5'$-!')!&1$!$%()(2'%!-<1$3$!%+)! ;$!5'3$%&$5!&(9+35-!+)!')%3$+-$!')!')%#:-'4$!;:-')$--!&6<$-!')!&1$!"=>!?1$!"=!%+)!,:3&1$3!$)%(:3+7$! ŝŶĐůƵƐŝǀĞ ŐƌŽǁƚŚ ǁŝƚŚ Ă ƉƌĞĨĞƌĞŶĐĞ ĨŽƌ ůŽĐĂů ĂŶĚ ƌĞŐŝŽŶĂů ^D ͛Ɛ ;$%+:-$! &1$6! %3$+&$! #()7I&$32! $2<#(62$)&!')!+!3$7'()>!?1$-$!<3$,$3$)%$-!%+)!;$!$L<3$--$5!')!&1$!3:#$-!,(3!&$)5$3')7!! ?1$! "@A*! N:$-&'()-!9'&1!&1'-! <3(<(-+#! &1$! $2<1+-'-! ()! %(2<$&'&'()! +-! $L<3$--'()!(,! &1$! '5$+!(,! &3+5'&'()+#!,3$$!2+3J$&!<3')%'<#$-!+<<#'$5!&(!+##!-<1$3$-!(,!$%()(2'%!+)5!<:;#'%!#',$>!0&!'-!&'2$!&1+&!&1$! '5$+! (,! &1$! ,3$$! 2+3J$&! '-! %(2<#$&$5! 9'&1! '2<(3&+)&! ,:)5+2$)&+#-! (,! (:3! $%()(2'%! #',$! #'J$! $%(#(7'%+#!-:-&+')+;'#'&6!+)5!')%#:-'4$!$%()(2'%!73(9&1>!0&!'-!+-!9$##!&'2$!&(!N:$-&'()!&1$!$L<+)-'()! (,!&1$!2+3J$&!&(!+##!&6<$-!(,!<:;#'%!-$34'%$->!?1$!"=!-1(:#5!$)5!'&-!')4(#4$2$)&!')!&1'-!3$7+35!+)5! #$+4$! '&! &(! &1$! 2$2;$3! -&+&$-! &(! 5$%'5$! 91$&1$3! <:;#'%! -$34'%$-! -1(:#5! ;$! <3'4+&'-$5! (3! )(&>! "-<$%'+##6!')!%3:%'+#!'2<(3&+)&!,'$#5-!#'J$!1$+#&1%+3$8!+##!"=!<3$--:3$!,(3!2(3$!<3'4+&'-+&'()!1+-!&(!$)5>!! B&!&1$!-+2$!&'2$!&1$!"@A*!;$#'$4$-!&1+&!:)5:$!-&+&$!-:<<(3&!,(3!O2(-&!(,!&1$!&'2$!;'7P!%(2<+)'$-!'-! )(&!%(2<+&';#$!9'&1!+)!"=!(,!,3$$!$L%1+)7$!(,!7((5-!+)5!-$34'%$->!U+'3!%(2<$&'&'()!&(7$&1$3!9'&1! &1$!)(&'()-!(,!')%#:-'4$!73(9&1!9'##!#$+5!&(!2(3$!'))(4+&'()>!0))(4+&'()!')!&:3)!'-!+!%3:%'+#!$)7')$!,(3! ,:&:3$! $%()(2'%! <3(73$--! +)5! -(%'+#! '2<3(4$2$)&->! 0))(4+&'()! '-! $-<$%'+##6! '2<(3&+)&! &(! ,')5! +)-9$3-!&(!%3:%'+#!+)5!<3$--')7!$%(#(7'%+#!N:$-&'()->!*(3$!73$$)!&$%1)(#(7'$-!')!&3+)-<(3&!%+)!;$!+! 2+E(3!-&$! /LHDKN! W3$$)!&$%1)(#(7'$-!+3$!$4$3!2(3$!'2<(3&+)&!')!"=!$)$376!<(#'%'$->!?1$!"@A*!+<<#+:5-!+2;'&'(:-! "=I9'5$! 73$$)! &+37$&-! +)5! )+&'()+#! ')'&'+&'4$-! -:%1! +-! &1$! W$32+)! \")$37'$9$)5$\8! $4$)! &1(:71! )$7+&'4$!-'5$I$,,$%&-!-:%1!+-!+)!')%3$+-$!')!&1$!:-$!(,!%(+#!,(3!$)$376!7$)$3+&'()!1+4$!&(!;$!&+%J#$5>! D$! 1+4$! -$$)! +)! $)(32(:-! ')%3$+-$! ')! 3$7'()+#! +)5! #(%+#! 73$$)! $)$376! %(I(<$3+&'()-! ')! &1$! #+-&! 5$%+5$>! 02<3(4')7! &1$! 73'5! +&! #(%+#! #$4$#! &(! ,+%'#'&+&$! ,:3&1$3! 73(9&1! (,! <3'4+&$! +)5! -1+3$5! 73$$)! $)$376!7$)$3+&'()!%+)!,:3&1$3!$)%(:3+7$!+!5$4$#(<2$)&!&1+&!9'##!2+J$!&1$!"=!#$--!5$<$)5$)&!()! e! ! 163 '2<(3&$5!,(--'#!,:$#->!B&!&1$!-+2$!&'2$!&1$!"=!1+-!&(!'2<3(4$!&1$!$)$376!73'5!+&!":3(<$+)!#$4$#8!')! (35$3!&(!<3(&$%&!')!<+3&'%:#+3!&1$!"+-&$3)!"=!*$2;$3!F&+&$-!,3(2!T:--'+)!<(9$3!7+2$->!B!-1+3!! B&! &1$! -+2$! &'2$! &1$-$! &$%1)(#(7'$-! 1+4$! &(! ;$! 5$4$#(<$5! ')! +! 9+6! &1+&! &1$6! 9'##! ;$%(2$! #$--! 5$<$)5')7!()!3+3$!$+3&1!2$&+#-8!2+J')7!&1$2!#$--!5$<$)5$)&!()!@1')$-$!$L<(3&!<(#'%'$->! .KDJUFSMFDH! ?1$!-+2$!<3$,$3$)%$!%+)!;$!+<<#'$5!')!&1$!@(22()!B73'%:#&:3+#!A(#'%6>!0)!&1'-!,'$#5!%(I(<$3+&'()!%+)! ;$!$)%(:3+7$5!+-!+)!+#&$3)+&'4$!&(!$L<+)-'()8!+)5!73$$)!'))(4+&'()-!%+)!;$!$)%(:3+7$5>!?1$!5'3$%&! <+62$)&-!O,'3-&!<'##+3!(,!@BAP!-1(:#5!;$!;$&&$3!&+37$&$5!()!-(%'+#!(;E$%&'4$-!+)5!-:-&+')+;'#'&6!)$$5->! F$%()5! <'##+3! <(#'%'$-! -1(:#5! %(2<#$2$)&! &1'-! +)5! -:<<(3&! &1$! <3(4'-'()! (,! 73$$)! <:;#'%! -$34'%$-! O<3$-$34')7! )+&:3$! +)5! 3$-<$%&')7! &1$! 3$#+&'()! 9'&1! %3$+&'()P>! ! @()&'):')7! +)5! '2<3(4')7! %(I (<$3+&'4$-8!<3(5:%$3!73(:<-!+)5!')&$3;3+)%1$!(37+)'-+&'()-!'-!+!<3(4$)!9+6!&(!$)-:3$!,((5!-$%:3'&68! 2+3J$&!&3+)-<+3$)%6!+)5!,+'3!3$2:)$3+&'()!,(3!":3(<$>!0&!'-!+#-(!+!9+6!&(!-&3$)7&1$)!&1$!<(-'&'()!(,! ,+32$3-!')!&1$!%1+')!(,!+73'%:#&:3+#!')5:-&3'$->!! $DEOH!! 0)%#:-'4$!73(9&1!%+))(&!;$!#'2'&$5!&(!&1$!"=!',!'&!'-!&(!;$!&3:#6!')%#:-'4$>!Q:$!&(!&1$!#+%J!(,!<3(73$--!')! &3+5$! #';$3+#'G+&'()! +&! &1$! D(3#5! ?3+5$! K37+)'G+&'()! OD?KP8! &1$! "=! '-! )$7(&'+&')7! +)! ')%3$+-')7! ):2;$3! (,! &3+5$! +73$$2$)&-! 9'&1! %(:)&3'$-! +)5! 3$7'()-! +##! (4$3! &1$! 9(3#5>! U(3! &1$-$! &3+5$! +73$$2$)&-!&(!<3(4'5$!3$+#!4+#:$!,(3!<$(<#$!()!;(&1!-'5$-!(,!&1$!+73$$2$)&8!&1$6!9'##!)$$5!-$3'(:-! ,+'3!&3+5$>!U+'3!&3+5$!')%#:5$-!,:3&1$3')7!+!#$4$#!<#+6')7!,'$#58!;:&!'-!+#-(!+553$--')7!&1$!-(I%+##$5!)()! &3+5$! %()%$3)->! ?1$! "@A*! 9+)&-! -&3()7! %1+<&$3-! ()! 1:2+)! 3'71&-! +)5! -:-&+')+;#$! 5$4$#(<2$)&8! -:;E$%&!&(!&1$!-&+)5+35!2$%1+)'-2-!,(3!5'-<:&$!-$&&#$2$)&8!+-!+!2')'2:2!5$2+)5!,(3!%()-$)&!&(! +)6! &3+5$! +73$$2$)&>! U:3&1$32(3$8! ')! %+-$! (,! +73$$2$)&-! 9'&1! 5$4$#(<')7! %(:)&3'$-! &1$6! %+)! ;$! +%%(2<+)'$5!;6!+!<3(%$--!(,!$L%1+)7$!(,!73$$)!&$%1)(#(76!'))(4+&'()->!!! $VH!IFMFDH!CI!MVH!HFDC! ?$2<(3+#!3$5:%&'()-!(,!5$;&-8!<3'2+36!;:57$&!-:3<#:-$-!+)5!,3+7'#$!$%()(2'%!73(9&1!%+))(&!1'5$!(3! &+J$!+9+6!&1$!,+%&!&1+&!+!):2;$3!(,!$%()(2'$-!')!&1$!":3(G()$!%+))(&!%()4$37$X>!?1$!%:#&:3+#!+)5! %())$%&$5!$%()(2'%!5',,$3$)%$-!%+)!)(!#()7$3!;$!'7)(3$5>!?1$!<(#'%6!9'&1!3$7+35!&(!&1$!$:3(!1+-!&(! ;$%(2$!,+3!#$--!'5$(#(7'%+#!+)5!2:%1!2(3$!<3+%&'%+#>!?1$!"@A*!5($-!)(&!;+%J!&1$!'5$+!&1+&!&1$!"=! +)5!&1$!":3(G()$!-1(:#5!;$%(2$!'5$)&'%+#!')!&1$!#()7!3:)>! C$,(3$! +! )$9! %3'-'-! 9'##! $2$37$! +)! 1()$-&! 5$;+&$! '-! )$%$--+36! &(! 5$&$32')$! 91'%1! ":3(G()$! $%()(2'$-! 1+4$! #()7I&$32! <(&$)&'+#! &(! %()4$37$>! U(3! &1(-$! $%()(2'$-! 91(! 5'5! )(&! 1+4$! &1$-$! <3(-<$%&-! +! )$9! <+&1! &(! <3(-<$3'&6! 1+-! &(! ;$! 5$-'7)$5>! 0)! (35$3! &(! J$$!!!! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! X!^ĞĞĂůƐŽ W&ƉƵďůŝĐĂƚŝŽŶ͚͗ƚŚĞĨƵƚƵƌĞŽĨƚŚĞ ƵƌŽ͛1&& 164 B4 A.2'.2+!f',$!-&+3&-!')!&1$!,+2'#6!+)5!3$#+&'()-!-&+3&!')!&1$!,+2'#6>!?1$! )+&:3+#!,+2'#6!'-!+!2'%3(I-(%'$&6!91$3$!$#$2$)&+36!-J'##-!+)5!$L<$3'$)%$-!+3$!;$')7!%()4$6$5>! H$+#&16!,+2'#'$-!#$+5!&(!+!1$+#&16!-(%'$&6!91'#$!,3+72$)&$5!,+2'#'$-!5(!&1$!(<<(-'&$>! ?1$!"@A*!9+)&-!&1$!":3(<$+)!=)'()!&(!3$-<$%&!&1$!-(4$3$'7)&6!(,!&1$!,+2'#68!;+-$5!()!2+33'+7$! ;$&9$$)!()$!2+)!+)5!()$!9(2+)8!+)5!3$%(7)'G$!'&-!')1$3$)&!3'71&-!&1+&!+3$!')+#'$)+;#$>!?1$!,+2'#6! '-!)(&!+!2$3$!%(##$%&'()!(,!')5'4'5:+#-!+)5!&1$3$,(3$!#$7'-#+&'()!;+-$5!-(#$#6!()!&1$!')5'4'5:+#!9'##! $4$)&:+##6!%(##'5$!9'&1!&1$!3'71&-!(,!&1$!,+2'#6>! $VH!IFMFDH!CI!/FDCGH! B)6!4'-'()!()!&1$!,:&:3$!(,!&1$!":3(<$+)!=)'()!+)5!&1$!*$2;$3!F&+&$-!-1(:#5!')%#:5$!+!4'$9!()! 1(9!&(!<3(2(&$!1$+#&16!,+2'#'$-!91$3$+-!&1$6V! I B3$!&1$!-&+3&')7!<(')&!,(3!,(32')7!1:2+)!+--$&-! I B%%(2<+)6!#',$!,3(2!&1$!;$7'))')7!:)&'#!&1$!)+&:3+#!$)5! I @3$+&$!&1$!-(%'+#!-<+%$!91$3$!%1'#53$)!7+')!%(),'5$)%$8!$-&+;#'-1!3$#+&'()-!+)5!73(9!: 0)4$-&')7!')!%1'#53$)!'-!')4$-&')7!')!&1$!,:&:3$8!+-!&1$6!9'##!73(9!:!A+3$)&-!91(!')4$-&!')!&1$'3!%1'#53$)!&1$3$,(3$!')4$-&!')!-(%'$&6!+-!+!91(#$>!A+3$)&-!-1(:#5! ŶŽƚďĞĞĐŽŶŽŵŝĐĂůůLJ͞ƉƵŶŝƐŚĞĚ͟ĨŽƌ&+J')7!3$-<()-';'#'&6!&(!3+'-$!&1$'3!%1'#53$)>! D'&1(:&!+)6!5(:;&8!&1$!4'$9!()!,+2'#6!+)5!2+33'+7$!'-!()$!(,!&1$!2(-&!'2<(3&+)&!+)5!'),#:$)&'+#! <(#'&'%+#!'--:$->!!*+)6!3$#'7'(:-8!%:#&:3+#8!1'-&(3'%+#!+)5!$%()(2'%+#!+-<$%&-!+3$!')4(#4$5!')!%3$+&')7!+! 4'$9>!"@A*!;$#'$4$-!&1+&!+)6!,(32!(,!<(#'%6!()!,+2'#6!-1(:#5!&1$3$,(3$!;$!&1$!3$-<()-';'#'&6!(,!&1$! *$2;$3!F&+&$-!+)5!&1$!"=!-1(:#5!3$-<$%&!-:;-'5'+3'&68!$-<$%'+##6!3$7+35')7!&1'-!-:;E$%&>! XESELUJLK!UEDH!Y!TCDZ! ?1$!,+2'#6!'-!+!%+3')7!:)'&6>!A$(<#$8!+-!3$#+&'()+#! ;$')7-8!)$$5!&1'-!$)4'3()2$)&!;$,(3$!&1$6!)$$5! %+3$$38!<(--$--'()-!+)5!9$+#&1>!B&!&1$!-+2$!&'2$!'&!'-!%#$+3!&1+&!&1$!,+2'#6!)$$5-!+!-(:)5!$%()(26! &(!;$!+;#$!&(!-:<<(3&!,+2'#6!#',$>!! ?1$!2+E(3'&6!(,!&1$!,+2'#'$-!')!":3(<$!+3$!-&3:77#')7!&(!,')5!-(2$!;+#+)%$!;$&9$$)!<+'5!9(3J!+)5! ,+2'#6! #',$>! ?(! %(2<#'%+&$! 2+&&$3-8! ')! D$-&$3)! ":3(<$! :)<+'5! 9(3J! '-! 2:%1! :)5$34+#:$5! +&! &1$! $L<$)-$!(,!,+2'#6!#',$>!D$!+54(%+&$!&1$3$,(3$!&1+&!<(#'%6!2+J$3-!9'##!-$$!&1$!')&3')-'%!+)5!$%()(2'%+#! ǀĂůƵĞŽĨ ĐĂƌĞ ĨŽƌŽŶĞ͛Ɛ ŚŽŵĞ ĂŶĚĐŚŝů53$)>! 0)! "=!$%()(2'%! <(#'%'$-! 1(9$4$3!+)! $%()(2'%!4'$9! '-! 5(2')+)&!;$,(3$!&1$!,3$$5(2!+)5!')&3')-'%!4+#:$!(,!&1$!,+2'#6>!?9(!,:##I&'2$!9(3J')7!<+3$)&-!+3$! -$$)!+-!+!7$)$3+#!7(+#!')!(35$3!&(!-:-&+')!&1$!$%()(26>!! 0&! '-! '2<(3&+)&!&1+&!%+3$! +)5! 9(3J! %+)! ;$! ;+#+)%$5>! 0)! (:3! 4'$9!&1$!$%()(26! 1+-! &(! ;$! ;+#+)%$5! &(9+35-!&1$!,+2'#6!+)5!)(&!E:-&!&1$!,+2'#6!&(9+35-!&1$!$%()(2'%!<3(%$--$->!D'&1(:&!&1$!4'$9!&1+&! &1$!$%()(26!1+-!&(!-$34$!,+2'#'$-8!-(()!,+2'#6!#',$!;$%(2$-!-:;(35')+&$5!&(!$%()(2'%!<3(%$--$->!0)! 3$%$)&! 6$+3-! 9$! 1+4$! -$$)! &((! (,&$)! &1+&! 2$+-:3$-! &(! 3$<+'3! &1$! $%()(2'%! %3'-'-! 1+4$! %+:-$5! ..! ! 165 $%()(2'%! 1+35-1'! B&! &1$! -+2$! &'2$! O$L&$)5$5P! ,+2'#6! #',$! 1+-!;$$)! &1$! 3$+-()! 916! <$(<#$!9$3$!+;#$!&(!%+336!()!&13(:71(:&!&1$!%3'-'->! "=! <(#'%6! 2+J$3-! %+)! %()-'5$3! &1$! $,,$%&-! (,! &1$! "=! $%()(2'%! <(#'%'$-! 9'&1(:&! ')&$3,$3')7! ')! &1$! ,+2'#6!<(#'%'$-!(,!&1$!2$2;$3!-&+&$->!?1$!"@A*!5($-!)(&!%+##!,(3!"=!2$+-:3$-!,(3!,+2'#'$-!;:&!3+&1$3! ,(3!+!%1+)7$!(,!+&&'&:5$!+2()7!<(#'%6!2+J$3-!')!&1'-!3$7+35>!! 9ERCFD!PJKDEMJCL! ?1$!"=!-1(:#5!,+%'#'&+&$!&1$!*$2;$3!F&+&$-!()#6!')!%()-'5$3')7!'--:$-!&1+&!+3$!%3(--')7!;(35$3->!?1$! 2(-&!'2<(3&+)&!'&$2!'-!&1$!-(%'+#!%()-$N:$)%$-!(,!#+;(:3!2'73+&'()>!?1$!')&$3)+#!2+3J$&!1+-!;3(:71&! 2+)6!;#$--')7-!&(!&1$!":3(<$+)!%()&')$)&!;:&!'&!1+-!+#-(!<:&!,+2'#'$-!:)5$3!<3$--:3$>!H:)53$5-!(,! &1(:-+)5-!(,!2'73+&'()!9(3J$3-!&$2<(3+3'#6!9(3J!+)5!#'4$!')!+!5',,$3$)&!%(:)&36!&1+)!&1$'3!,+2'#'$->! "-<$%'+##68!')!A(#+)58!T(2+)'+!+)5!C:#7+3'+!&1'-!<1$)(2$)()!'-!'22')$)&>!D1$3$+-!&1$3$!'-!+!%#$+3! $%()(2'%!;$)$,'&!,(3!&1$!2+)!(3!9(2+)!&(!9(3J!+;3(+5!I!$+3)')7!+!;$&&$3!-+#+36!')!(35$3!&(!-:-&+')! &1$!,+2'#6!$%()(2'%+##6!I!8!'&!5($-!1+4$!-$3'(:-!)$7+&'4$!%()-$N:$)%$-!,(3!&1$!,+2'#6!&1+&!'-!-&'##!')! &1$!%(:)&36!(,!(3'7')>!! ?1$!3((&!(,!&1'-!<3(;#$2!'-!&1$!$L&3$2$!,(%:-!()!$%()(2'%!<+3&'%'<+&'()!+)5!E(;!$2+)%'<+&'()!,(3! 9(2$)>!?1$!$L&3$2$!,(%:-!()!&1$!$%()(26!')-&$+5!(,!()!&1$!9$##I;$')7!(,!<$(<#$!1+-!#$5!&(!()$I -'5$5!<(#'%'$-!')!"=!+)5!*$2;$3!F&+&$!#$7'-#+&'()>!?1'-!2'-&+J$!)$$5-!&(!;$!%(33$%&$5>!! ! ! ./! ! 166 D4 5.&&/'9!'(!5#2+>E!)'*,12&*1&!#*/!6F7.&,,2'*! U+'&18!%()-%'$)%$!+)5!$L<3$--'()!+3$!3$#+&'()+#!+)5!,:)5+2$)&+#!,3$$5(2->!?1$-$!,3$$5(2-!2$+)! &1+&!9$!5(!)(&!E:-&!2+J$!(:3!(9)!%()4'%&'()!1$+35!;:&!&1+&!9$!7'4$!$+%1!(&1$3!&1$!-<+%$!&(!5(!&1$! -+2$8!')5'4'5:+##6!+)5!&(7$&1$3>!T$+#!,3$$5(2!(,!,+'&18!%()-%'$)%$!+)5!$L<3$--'()!()#6!;$%(2$-! 4'-';#$!4'+!3$#+&'()-!9'&1!&1(-$!91(!,$$#8!&1')J!(3!+%&!5',,$3$)>!*:&:+#!3$-<$%&!,(3!&1$-$!,3$$5(2-! 9'##!#$+5!&(!3$+#!<#:3+#'&6>! ?1$!":3(<$+)!=)'()!'-8!;$-'5$-!+!<3(E$%&!,(3!<$+%$!+)5!<3(-<$3'&68!+#-(!+!<3(2(&$3!(,!<#:3+#'&6>!0)!&1$! LJĞĂƌϮϬϬϬƚŚĞ hŵŽƚƚŽ͞hŶŝƚĞĚŝŶŝǀĞƌƐŝƚLJ͟!9+-!+5(<&$5>!"@A*!91(##6!-:<<(3&-!&1'-!2(&&(!-')%$! ŽŶůLJĂƌĞĂůƵŶĚĞƌƐƚĂŶĚŝŶŐŽĨĞĂĐŚŽƚŚĞƌ͛ƐĐƵůƚƵƌĞĂŶĚŚŝƐƚŽƌLJĐĂŶůĞĂĚƚŽĂďĞŶĞĨŝĐŝĂůĐŽŽƉĞƌĂƚŝŽŶŽŶ &1$!#()7!&$32>! -CFLOEMJCLQ! ?1$!;+-'-!,(3!&1$!4'$9!(,!&1$!"@A*!()!,3$$5(2!(,!,+'&18!%()-%'$)%$!+)5!$L<3$--'()!'-!5$3'4$5!,3(2! B3&'%#$!.a!(,!!"#$%&'(#)*+,$-#.,+)+/'0&$01$234+&$5'6"/*!O?1$!=)'&$5!d+&'()-!B--$2;#68!A+3'-8!.eRaP! ǁŚŝĐŚƐƚĂƚĞƐ͗͞"4$36()$!1+-!&1$!3'71&!&(!,3$$5(2!(,!&1(:71&8!%()-%'$)%$!+)5!3$#'7'()]!&1'-!3'71&! ')%#:5$-!,3$$5(2!&(!%1+)7$!1'-!3$#'7'()!(3!;$#'$,8!+)5!,3$$5(28!$'&1$3!+#()$!(3!')!%(22:)'&6!9'&1! (&1$3-!+)5!')!<:;#'%!(3!<3'4+&$8!&(!2+)',$-&!1'-!3$#'7'()!(3!;$#'$,!')!&$+%1')78!<3+%&'%$8!9(3-1' Ϯ͘dŚŝƐƌŝŐŚƚŝƐŝŶŚĞƌĞŶƚŝŶŚƵŵĂŶŝƚLJĂŶĚƌŽŽƚĞĚŝŶƚŚĞŝŶǀŝŽůĂďůĞĚŝŐŶŝƚLJŽĨĞĂĐŚŚƵŵĂŶŝŶĚŝǀŝĚƵĂů͘ƐĂ ďŝƌƚŚƌŝŐŚƚŽĨďĞůŽŶŐŝŶŐ͕ŝƚƉƌŽƚĞĐƚƐŽƵƌĨƌĞĞĚŽŵƚŽďĞŚƵŵĂŶĂŶĚŝƐƚŚĞĞƋƵĂůƌŝŐŚƚŽĨĂůůŚƵŵĂŶ ďĞŝŶŐƐǁŝƚŚŽƵƚĞdžĐĞƉƚŝŽŶ͘$ ϯ͘dŚĞƌŝŐŚƚƚŽĨƌĞĞĚŽŵŽĨƚŚŽƵŐŚƚ͕ĐŽŶƐĐŝĞŶĐĞ͕ĂŶĚƌĞůŝŐŝŽŶĐŽŶƚĂŝŶƐĂĚƵƚLJĂƐǁĞůůĂƐĂƌŝŐŚƚ͕ďĞĐĂƵƐĞ ĂƌŝŐŚƚĨŽƌŽŶĞƉĞƌƐŽŶŝƐĂƵƚŽŵĂƚŝĐĂůůLJĂƌŝŐŚƚĨŽƌĂŶŽƚŚĞƌĂŶĚĂƌĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌďŽƚŚ͘$ ϰ͘dŚĞƉƵďůŝĐƉůĂĐĞŽĨĨƌĞĞĚŽŵŽĨƚŚŽƵŐŚƚ͕ĐŽŶƐĐŝĞŶĐĞ͕ĂŶĚƌĞůŝŐŝŽŶŝƐďĞƐƚĨƵůĨŝůůĞĚƚŚƌŽƵŐŚĐƵůƚŝǀĂƚŝŶŐ ĐŝǀŝůŝƚLJďĞƚǁĞĞŶĐŝƚŝnjĞŶƐĂŶĚĐŽŶƐƚƌƵĐƚŝŶŐĂĐŽƐŵŽƉŽůŝƚĂŶĂŶĚĐŝǀŝůƉƵďůŝĐƐƋƵĂƌĞʹĂƉƵďůŝĐƐƋƵĂƌĞŝŶ ǁŚŝĐŚƉĞŽƉůĞŽĨĂůůĨĂŝƚŚƐ͕ƌĞůŝŐŝŽƵƐĂŶĚŶĂƚƵƌĂůŝƐƚŝĐ͕ĂƌĞĨƌĞĞƚŽĞŶƚĞƌĂŶĚĞŶŐĂŐĞƉƵďůŝĐůŝĨĞŽŶƚŚĞ ďĂƐŝƐŽĨƚŚĞŝƌĨĂŝƚŚ͘$ ϱ͘dŚĞƌŝŐŚƚƐŽĨĨƌĞĞĚŽŵŽĨƚŚŽƵŐŚƚ͕ĐŽŶƐĐŝĞŶĐĞ͕ĂŶĚƌĞůŝŐŝŽŶĂƉƉůLJŶŽƚŽŶůLJƚŽŝŶĚŝǀŝĚƵĂůƐ͕ďƵƚƚŽ ŝŶĚŝǀŝĚƵĂůƐŝŶĐŽŵŵƵŶŝƚLJǁŝƚŚŽƚŚĞƌƐ͕ĂƐƐŽĐŝĂƚŝŶŐŽŶƚŚĞďĂƐŝƐŽĨĨĂŝƚŚ͘:$ ! Ŷƚŝ@ĚŝƐĐƌŝŵŝŶĂƚŝŽŶ$ ! D'&1(:&!+)6!5(:;&8!5'-%3'2')+&'()!'-!5+2+7')7!,(3!&1$!-(%'$&6!+)5!')5'4'5:+#-!+)5!'&!-1(:#5!;$! +553$--$5!')!+!<3(<$3!9+6>!H(9$4$38!+)&'I5'-%3'2')+&'()!#+9-!+)5!<(#'%'$-!%+)!%3$+&$!+!-$3'(:-!3'-J!(,! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! `!W#(;+#!%1+3&$3!(,!@()-%'$)%$!1&& 167 $),(3%')7!+!,(32!(,!<(#'&'%+#!%(33$%&)$--!&1+&8!91$)!+<<#'$58!<:&!$N:+#!,:)5+2$)&+#!3'71&-!+)5! ,3$$5(2-!:)5$3!<3$--:3$>! ! B)&'I5'-%3'2')+&'()!<(#'%'$-!%+)8!&1$3$,(3$8!;$%(2$!+!-$3'(:-!3'-J!&(!&1$!,3$$5(2!(,!3$#'7'(:-! +--(%'+&'()->!?1$-$!(37+)'G+&'()-!()#6!$L'-&!9'&1!&1$!+'2!&(!+54+)%$!&1$'3!,+'&18!,$##(9-1'<8!+)5! -'2'#+3!+%&'4'&'$->!?1$!3'71&!&(!<3(2(&$!&1$-$!$,,(3&-!+)5!;$#'$,-!'-!7:+3+)&$$5!')!')&$3)+&'()+#!#+9!+-! +!,:)5+2$)&+#!3'71&!+)5!+!%(3)$3-&()$!,(3!5$2(%3+%6>!"@A*!;$#'$4$-!&1+&!)+&'()+#!-&+&$-!+)5!&1$!"=! -1(:#5!;$!'2<+3&'+#!')!+--$--')7!&1$!#$7'&'2+%6!(,!3$#'7'(:-!;$#'$,-!+)5!-1(:#5!3$N:'3$!%(),#'%&')7! 73(:<-!&(!&(#$3+&$!$+%1!(&1$3>!0)!-(2$!2$2;$3!-&+&$-8!3$#'7'(:-!(37+)'G+&'()-!+)5!,+'&1I;+-$5! +--(%'+&'()-!1+4$!;$$)!-1:&!5(9)!;$%+:-$!(,!+)&'I5'-%3'2')+&'()!#$7'-#+&'()!O#'J$!&1$!T(2+)!@+&1(#'%! ,(-&$3!%+3$!+7$)%'$-!')!&1$!=bP>!?1$!"@A*!&1$3$,(3$!%+##-!,(3!%+:&'()!9'&1!3$7+35!&(!&1$!"N:+#! ?3$+&2$)&!Q'3$%&'4$-!')!(35$3!&(!<3$4$)&!-:%1!:)')&$)5$5!%()-$N:$)%$-!(,!"=!<(#'%6>!! ! 0&!'-!&1$!4'$9!(,!"@A*!&1+&!,+'&1!')-<'3$-!2+)6!"=!%'&'G$)-!&(!+%&'4$#6!$)7+7$!')!-(%'$&6!,(3!&1$!;$)$,'&! (,!-(%'$&6!+-!+!91(#$>!T$#'7'(:-!,(##(9$3-!+3$!(,&$)!+%&'4$!')!):2$3(:-!#(%+#8!3$7'()+#!(3!)+&'()+#! +%&'4'&'$-!+553$--')7!'--:$-!-:%1!+-!<(4$3&68!%+3$!+)5!3$%()%'#'+&'()>!?1$!<#:3+#'&6!(,!3$#'7'(:-!+)5! '5$(#(7'%+#!9(3#54'$9-!')!&1$!"=!-1(:#5!;$!3$-<$%&$5!')-&$+5!(,!3$E$%&$5!')!,+4(:3!(,!()$!<+3&'%:#+3! 3$#'7'()!(3!'5$(#(76>!! ! ?1$!+--$3&'()!+)5!<3(2(&'()!(,!$N:+#!,3$$5(2!(,!+##!%()4'%&'()-!+)5!2:&:+#!5'+#(7:$!+3$!')!(:3!4'$9! &1$!;$-&!9+6!&(!%(2;+&!5'-%3'2')+&'()>!! ! -DHHOCP!MC!OJQEKDHH! ! U3$$5(2!&1+&!()#6!<3(&$%&-!'5$+-!&1+&!+3$!+%%$<&$5!;6!&1$!2+E(3'&6!'-!)(&!3$+#!,3$$5(2>!!i$&8!&1$3$!'-! +!73(9')7!&$)5$)%6!')!":3(<$+)!')-&'&:&'()-!&(!<3(2(&$!&1$!,3$$5(2!(,!()$!73(:!?1$3$!'-!#$--!+)5!#$--!,3$$5(2!&(!5'-+73$$!9'&1!&1$!4'$9-!(,!+!4(%+#! <(#'&'%+#!2+E(3'&6>!i$&8!&1$!":3(<$+)!@(:3&!(,!H:2+)!T'71&-!1+-!')&$3<3$&$5!,3$$5(2!(,!$L<3$--'()!&(! <3(&$%&!)(&!()#6!&1$!'),(32+&'()!(3!'5$+-!&1+&!+3$!,+4(:3+;#6!3$%$'4$5!(3!3$7+35$5!+-!')(,,$)-'4$!(3! +-!+!2+&&$3!(,!')5',,$3$)%$8!;:&!+#-(!&1(-$!&1+&!(,,$)58!-1(%J!(3!5'-&:3;>!?1$!#+&&$3!+3$!&1$!&3:$! 5$2+)5-!(,!<#:3+#'-28!;3(+5I2')5$5)$--!+)5!&(#$3+)%$>!0,!&1$3$!'-!)(!,:)5+2$)&+#!3'71&!&(!5'-+73$$! &1$3$!'-!)(!5$2(%3+&'%!-(%'$&6>a! ! "@A*!;$#'$4$-!&1+&!3$+#!<#:3+#'-2!3$N:'3$-!&1$!-<+%$!,(3!+!73(:<8!3$#'7'()!(3!'5$(#(76!&(!N:$-&'()!&1$! 4'$9-!(,!+)(&1$3!73(:<8!3$#'7'()!(3!'5$(#(76!+&!+)6!&'2$>!0)!(35$3!&(!%3$+&$!+!7$):')$!5$;+&$!+&!&1$! )+&'()+#!+)5!":3(<$+)!#$4$#8!&1$3$!-1(:#5!;$!3((2!,(3!+##!4'$9-!')!-(%'$&6;$$ ! 0)!&1$!"=!&1$3$!-1(:#5!;$!+!#$4$#!<#+6')7!,'$#5!')!&1'-!3$7+358!$-<$%'+##6!91$)!'&!%(2$-!&(!,:)5')7!(,! E'K͛ƐďLJƚŚĞ h͘?1$!"@A*!9+)&-!+!&1(3(:71!3$4'$9!(,!&1'-!,:)5')7!+)5!+-J-!,(3!2(3$!&3+)-<+3$)%6>! E'K͛ƐǁŚŽŚĂǀĞĂŶŝĚĞŽůŽŐŝĐĂůŽƌŝŶĚƵƐƚƌLJƌĞůĂƚĞĚŝŶƚĞƌĞƐƚŝŶ hƉŽůŝĐLJŵĂŬŝŶŐƐŚŽƵůĚŝŶƉƌŝŶĐŝƉůĞŶŽƚ 3$%$'4$!5'3$%&!,:)5')7!,3(2!&1$!"=>! ! "@A*!9+)&-!+!":3(<$+)!=)'()!&1+&!9$!.+&!3$#+&$!&(8!+!":3(<$+)!=)'()!&1+&!3$-<$%&-!%:#&:3+#8! 1'-&(3'%+#!+)5!3$#'7'(:-!5',,$3$)%$-!+)5!<3(2(&$-!+!7$):')$#6!(<$)!5$;+&$!+)5!&1$!,3$$5(2!&(! 5'-+73$$!,(3!+##>! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! a!T(7$3!b'-J+8!͞?1$!&13$+&!&(!3$#'7'(:-!#';$3&'$-!+)5!&1$!":3(<$+)!')-&'&:&'()-͟$$')!"@A*!<:;#'%+&'()!<'8#)/=$01$1+'/"$+&>$.0&*.'#&.#?$F,$3+! <(#'&'%''!OY:)$!/_..PV!M!I!./! .R! ! 168 0EDHLMES!DJKVMQ! ! "@A*!;$#'$4$-!&1+&!'&!'-!:! ?1$!'),#:$)%$!(,!)+&'()+#!7(4$3)2$)&-!')!&1'-!-1(:#5!;$!#'2'&$5!91'#$!&1$!":3(<$+)!=)'()!'&-$#,! -1(:#5!,:##6!3$-<$%&!&1$!<3')%'<#$!(,!-:;-'5'+3'&68!$-<$%'+##6!3$7+35')7!&1'-!'--:$>!! ! ?1$!=)'&$5!d+&'()-!@()4$)&'()!()!&1$!T'71&-!(,!&1$!@1'#5!-&+&$-!&1+&!+2()7!&1$!2(-&!'2<(3&+)&! 3'71&-!(,!&1$!%1'#58!;$-'5$-!&1$!3'71&!&(!#',$8!+3$!<3$%'-$#6!&1$!3'71&!&(!<+3$)&+#!#(4$!+)5!&1$!3'71&!&(! $5:%+&'()>!?1$!@()4$)&'()!+#-(!$L<#'%'!-&+&$-!&1+&!<+3$)&-8!;$')7!&1$!()$-!91(!#(4$!&1$'3!%1'#53$)! &1$!2(-&8!+3$!&1$!()$-!%+##$5!:<()!&(!5$%'5$!+;(:&!&1$!$5:%+&'()!(,!&1$'3!%1'#53$)>!U:3&1$32(3$8! B3&'%#$!/!(,!&1$!U'3-&!A3(&(%(#!(,!&1$!":3(<$+)!@()4$)&'()!(,!H:2+)!T'71&-!$L<#'%'!-<$%','$-!&1+&! &1$!-&+&$!-1+##!3$-<$%&!&1$!3'71&!(,!<+3$)&-!&(!$)-:3$!$5:%+&'()!+)5!&$+%1')7!')!%(),(32'&6!9'&1!&1$'3! (9)!3$#'7'(:-!%()4'%&'()->e!! ! "@A*!,:##6!-:<<(3&-!&1$-$!B3&'%#$-!+)5!9+)&-!&1$!":3(<$+)!=)'()!&(!3$-<$%&!&1$!3'71&-!(,!&1$!<+3$)&-! ')!$4$36!"=!2$2;$3!-&+&$>!?1$!"=!')-&'&:&'()-!-1(:#5!3$,3+')!,3(2!+)6!')&$3,$3$)%$!')!&1'-!+3$+>!B! ĐŽŝŶĐŝĚĞŶƚĂůƉŽůŝƚŝĐĂůŵĂũŽƌŝƚLJŽĨD W͛ƐŝŶƚŚĞ ƵƌŽƉĞĂŶWĂƌůŝĂŵĞŶƚĐĂŶŶŽƚĚĞĐŝĚĞŽǀĞƌƐŽŵĞƚŚŝŶŐĂƐ <$3-()+#!+-!&1$!3+'-')7!(,!%1'#53$)>!! ! -DHHOCP!CI!IEJMV!ELO!GDCMHUMJCL!CI!UCLWHDMQ!JL!/(!GCSJUJHQ! ! U3$$5(2!(,!;$#'$,!'-!+!%#$+3!')5'%+&(3!(,!&1$!#$4$#!(,!5$2(%3+%6!+)5!,3$$5(2!')!+!%(:)&36>!0&!'-!)(! %(')%'5$)%$!&1+&!&1$!%(:)&3'$-!')!91'%1!@13'-&'+)-!+3$!<$3-$%:&$5!&1$!2(-&8!+3$!$'&1$3!+:&1(3'&+3'+)! 3$7'2$-!(3!,+'#$5!-&+&$-!&1+&!+3$!,+%')7!+!%$3&+')!#$4$#!(,!%'4'#!9+3>!0)!2+)6!-(I%+##$5!2(3$!9$##I (35$3$5!-(%'$&'$-!&1$3$!'-!')!<3+%&'%$!)(!3$+#!,3$$5(2!(,!;$#'$,!+-!9$##>!! ! B%%(35')7!&(!@A#&$-00)*$(4$3!.__!2'##'()!@13'-&'+)-!9(3#59'5$!+3$!%:33$)!<$3-$%:&$5!(3!')!5+)7$3! ;$%+:-$!(,!&1$'3!;$#'$,>!?1$!):2;$3!(,!<$3-$%:&$5!<$(<#$!(,!(&1$3!,+'&1-!'-!#(9$38!1(9$4$3! <$3-$%:&'()!()!&1'-!73(:)5!'-!+#9+6-!+)!+%&!+7+')-&!1:2+)!5'7)'&6>!! ! ?1$!"@A*!9$#%(2$-!&1$3$,(3$!&1$!+5(<&'()!(,!&1$!7:'5$#')$-!&(!<3(2(&$!,3$$5(2!(,!;$#'$,!')!"=! ,(3$'7)!<(#'%6>!?1$-$!7:'5$#')$-!+3$!+!<3+%&'%+#!5$2()-&3+&'()!(,!,3$$5(2!(,!,+'&1!+-!%(3$!4+#:$!(,!&1$! h͘ WDD W͛ƐŚĂǀĞďĞĞŶŝŶƚŚĞĨŽƌĞĨƌŽŶƚŽĨƚŚĞĚĞǀĞůŽƉŵĞŶƚŽĨƚŚĞƐĞŐƵŝĚĞůŝŶĞƐ͘! ! dŚĞ WDD W͛ƐŚĂǀĞŝŶƚŚŝƐƌĞŐĂƌĚƉƵƚƐƉĞĐŝĂůĞŵƉŚĂƐŝƐŽŶƚŚĞƌŝŐŚƚ(,!$+%1!<$3-()!&(!%1+)7$! 1'-^1$3!;$#'$,!O(3!3$,3+')!,3(2!+)6!;$#'$,P>!?1'-!3'71&!'-!&1$!%(3)$3-&()$!(,!,3$$5(2!(,!,+'&1>!D'&1(:&! &1'-!3'71&!&1$3$!'-!)(!3$+#!,3$$5(2!(,!3$#'7'()!+)5!;$#'$,>!! !!! H(9$4$38!+#-(!9'&1')!&1$!"=!&1$3$!'-!+!&3$)5!(,!%()4$3&-!&1+&!+3$!;$')7!&13$+&$)$5!;$%+:-$!&1$6! %1+)7$5!&1$'3!;$#'$,>!?1'-!'-!$-<$%'+##6!&1$!%+-$!9'&1!2'73+)&-!+)5!+-6#:2!-$$J$3-!%(2')7!&(!&1$!"=>! W'4$)!&1'-!;+%J73(:)58!&1$!"@A*!9+)&-!&1$!":3(<$+)!=)'()!&(!+553$--!&1'-!'--:$!')!&1$!%(2')7!6$+3-! +)5!,+%'#'&+&$!-(#:&'()-!,(3!&1$!2$2;$3!-&+&$->! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! e!b'-J+8!M!I!./! .S! ! 169 G4 809#*!".#((21@2*;H!52;>+2*;!9'/&.*I/#!0&!5'-&(3&-!3$#+&'()-!+)5! -$4$3$#6!1:3&-!<$(<#$!&(!3$IĞƐƚĂďůŝƐŚŶĞǁŚĞĂůƚŚLJƌĞůĂƚŝŽŶƐŚŝƉƐ͘ŚƌŝƐƚŝĂŶE'K͛ƐŚĂǀĞďĞĞŶůĞĂĚŝŶŐ &1$!,'71&!+7+')-&!&1'-!2(5$3)I5+6!-#+4$36!+)5!,(3!&1$!"@A*!&1'-!'-!+)!'--:$!&1+&!1+-!&(!;$!1'71!()!&1$! +7$)5+!(,!&1$!"=>!! B<<3(L'2+&$#6!/_>e!2'##'()!<$(<#$!+3$!')!,(3%$5!#+;(:3!9(3#59'5$>!B#&1(:71!'&!'-!5',,'%:#&!&(!$-&+;#'-1! +)!$L+%&!,'7:3$8!%()-$34+&'4$!$-&'2+&$-!-:77$-&!RR!<$3!%$)&!(,!&1$-$!<$(<#$!1+4$!;$$)!&3+,,'%J$5._>! ?3+,,'%J')7! ,(3! -$L:+#! $L<#('&+&'()! '-! &1$! 2(-&! %(22()! 9(3#59'5$! I! Sa! <$3! %$)&! (,! +##! '5$)&','$5! 4'%&'2-!+3$!4'%&'2!(,!-$L:+#!$L<#('&+&'()!+)5!,(3%$5!')&(!<3(-&'&:&'()>!! )CCGHDEMJCL!EM!/(!EL!JLMHDLEMJCLES!SHWHS! F')%$! 1:2+)! &3+,,'%J')7! '-! +! %3(--I;(35$3! %3'2$8! %(2;+&')7! '&! 3$N:'3$-! ')&$3)+&'()+#! %((<$3+&'()>! "@A*!53+9-!&1$!+&&$)&'()!(,!&1$!"A!&(!&1$!<(-'&'4$!3$-:#&-!+%1'$4$5!;6!E(')$5!)()I#$7'-#+&'4$!$,,(3&-! -:%1!+-!%#(-$!%((<$3+&'()!9'&1!<3(,$--'()+#-!+)5!&1$!%'4'#!-(%'$&6!(37+)'-+&'()-!+%&'4$!')!&1$!,'$#5!+)5! <+3&)$3-1' 0DHWHLM!ELO!DHOFUH!MVH!OHPELO! ?1$!;$-&!-(#:&'()8!<3(4$)!&(!$,,$%&'4$#6!+553$--..!+)5!1+4$!<(-'&'4$!$,,$%&-!()!3$5:%')7!&1$!5$2+)5! ,(3!-$L:+#!-$34'%$-8!'-!&(!$)%(:3+7$!+&!"=!#$4$#!&1+&!2$2;$3!-&+&$-!9'##!%3'2')+#'-$!&1$!<:3%1+-$!(,! -$L! ')! +##! %'3%:2-&+)%$-! +-! 9$##! +-! &1'35! <+3&6! -$##$3-! O%()-'-&')7! (,! <'2<-! +)5! &3+,,'%J$3-P! +)5! 5$%3'2')+#'-$!&1(-$!<$3-()+##6!-$##')7!-$L8!-:%1!+-!&1$!d(35'%!*(5$#./>!! 3JWH!QGHUJES!EMMHLMJCL!MC!UVJSODHL! ?1$! "=! '-! :)5$3! +)! (;#'7+&'()! &(! 2+J$! +!%(22'&2$)&! &(! 5(! $4$36&1')7! ')! '&-! <(9$3!&(! -&(!! ?1'-!%(22'&2$)&!2:-&!-&+3&!9'&1!$3+5'%+&')7!')&$3)$&!%1'#5!<(3)(73+<16!+-!9$##!+-!,'L')7!,#+9-!')!&1$! %1'#53$)!9$#,+3$!-6-&$2>!D$!:37$!&1$!"=!&(!;:'#5!+!&$%1)(#(76!&+-J!,(3%$!+)5!<:&!')!<#+%$!&$%1)(#(76! '))(4+&'()!&(!,'71&!%1'#5!-$L:+#!$L<#('&+&'()>!Q+&+!-6-&$2-!&1+&!&3+%J!+)5!,')5!2'--')7!%1'#53$)8!91(! -1(:#5!;$!3$7+35$5!+-!4'%&'2-!+)5!)(&!3:)+9+6-8!2:-&!+#-(!;$!'2<3(4$5!+&!"=!#$4$#>!!"@A*!'-!+#-(! %+##')7!()!&1$!2$2;$3!-&+&$-!&(!')&3(5:%$!+!-6-&$2!91'%1!9(:#5!<3(4'5$!$4$36!%1'#5!4'%&'2!+!%1'#5! &3+,,'%J')7! 7:+35'+)! &(! -:<<(3&! &1$2! +)5! -<$+J! :! B!7:+35'+)! 91(! (,,$3-! -$%:3'&6!+)5!-&+;'#'&6!&(!+!%1'#5!'-!')4+#:+;#$!')!+'5')7!1'-^1$3!3$%(4$36!+)5!<3$4$)&')7!&1$!%1'#5!,3(2! 3$&:3)')7!&(!1'-!&3+,,'%J$3>! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ._!0)&$3)+&'()+#!f+;(:3!K37+)'-+&'()!W#(;+#!"-&'2+&$!(,!U(3%$5!f+;(:3!/_./! ..!F$(Ii(:)7!@1(?$-0#*$<#6+,'B#>$C)0*/'/3/'0&$D&.)#+*#$234+&$!)+ƥ.E'&6F8!W$32+)!0)-&'&:&$!,(3!"%()(2'%!T$-$+3%1IQ0D!C$3#')8!W$32+)68! f()5()!F%1((#!(,!"%()(2'%-!+)5!A(#'&'%+#!F%'$)%$8!=b! ./!1&& 170 0CSJUJHQ!MC!UCFLMHD!UNRHDUDJPH!UCLLHUMHO!MC!MDEIIJUZJLK! *(-&! 6(:)7! <$(<#$! 91(! +3$! $L<#('&$5! -$L:+##6! ')! 3$&:3)! ,(3! <+62$)&! %+2$! ')&(! %()&+%&! 9'&1! &1$! <:3%1+-$3! 4'+! &1$! 0)&$3)$&.M>! ! 0&! '-! 5',,'%:#&! ,(3! &1$! -$L! -$34'%$-! <3(4'5$5! ()#')$! &(! ,+##! :)5$3! &1$! 5$,')'&'()!(,! -$L! &3+,,'%J')7! ;$%+:-$! '&! '-! 1+35! &(! <3(4$! &1$! &13$$!ŵĂŝŶ ĞůĞŵĞŶƚƐ͗͞ĨŽƌĐĞ͕ ĨƌĂƵĚŽƌ͕ ĐŽĞƌĐŝŽŶ͘͟dŚĞƌĞĨŽƌĞ͕ŵĞĂƐƵƌĞƐĂƚ hůĞǀĞůƚŽĂĚũƵƐƚƚŚĞŚƵŵĂŶƚƌĂĨĨŝĐŬŝŶŐůĞŐŝƐůĂƚŝŽŶƚŽŽŶůŝŶĞƐĞdž -$34'%$-8!+-!9$##!+-!<3(73+2-!&(!3+'-$!+9+3$)$--!+)5!<3$4$)&!<$(<#$!,3(2!;$')7!(,,$3$5!()#')$!E(;-! ')!<3(-&'&:&'()!2:-&!;$!+5(<&$5>!! 0DCMHUM=!QFGGCDM!ELO!EQQJQM!MVH!WJUMJPQ! ?1$!"=!%(22()!<(#'%6!2:-&!+5(<&!+!4'%&'2I,(%:-!+<<3(+%1!;6!$)-:3')7!-$34'%$-!+3$!+4+'#+;#$!&(!1$#! ?1$3$,(3$8! "=! %(22()! 7:'5$#')$-! &(! ;$&&$3! '5$)&',6! 4'%&'2-! (,! &3+,,'%J')7!2:-&!;$!5$4$#(<$5>!U:3&1$38!*$2;$3!F&+&$-!-1(:#5!<3(4'5$!<3(<$3!5$-'7)+&'()!&(!$)-:3$! 4'%&'2-!3$%$'4$!&1$!%+3$!+)5!&1$!1$#! U(3! &1$! <:3<(-$! (,! ;$&&$3! <3(&$%&')7! 6(:)7! <$3-()-! +7+')-&! -$L:+#! +;:-$! 2$2;$3! -&+&$-! %+)! ;$! $)%(:3+7$5!&(!$)-:3$!&1+&!<$3-()-!:! ?1$! "=! %+)! ,+%'#'&+&$! +! <3(%$--! ')! 91'%1! ,+2'#'$-! +3$! 7'4$)! +--'-&+)%$! &(! 3$:)'&$! 9'&1! &1(-$! ":3(<$+)! %'&'G$)-! 91(! +3$! 4'%&'2-! (,! 1:2+)! &3+,,'%J')7!')!+)(&1$3!"=!*$2;$3!F&+&$>!B!4'%&'2I%$)&3$5!+<<3(+%1!+#-(!%(:<#$-!+--'-&+)%$!')!-&+3&')7! ƚŚĞŝƌŶĞǁůŝĨĞĞŝƚŚĞƌŝŶƚŚĞĐŽƵŶƚƌLJƚŚĞLJǁĞƌĞƚƌĂĨĨŝĐŬĞĚŽƌƚŚĞŝƌŚŽŵĞĐŽƵŶƚƌLJ;ƐĞĞ/ƚĂůLJ͛ƐŵŽĚĞůͿ͘^Ž &1$6!+3$!7:+3+)&$$5!+!3$-'5$)%$!<$32'&!+)5!3$%$'4$!$5:%+&'()!+)5!&3+')')7!&(!1$#!?1'-!'-!3$+##6!91+&!$4$36!":3(<$+)!=)'()!%(:)&36!-1(:#5!;$!-&3'4')7!,(3>!! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! .M!F9$5'-1!W(4$3)2$)&!3$<(3&8!<7!MS8!1&& 171 ! 172 ! ! ! ! ! ! ! ! ! ! ! ! +"'H*5.C-068! ! ! ! ! "#$!%NG!.2!*!)*+Q%&'()$*+!*--.*+=$!(7!%NQ='.0.=2!*+8!())(+$+02!(7!%N!/$/F$'2#.)?!"#$!%NG! ())(2$2!7&'0#$'!=$+0'*-.`*0.(+!(7!)(6$'!0(!j'&22$-2!*+8!6*+02!)(6$'2!0'*+27$''$8!F*=T!0(!+*0.(+*-! *+8!'$>.(+*-!)*'-.*/$+02!*+8!8$=.2.(+2!0*T$+!*2!=-(2$!*2!)(22.F-$!0(!0#$!=.0.`$+2?!!"#$!%NG!8($2! +(0!0*T$!*!)(2.0.(+!(+!-$70Q'.>#0!)(-.=B!.22&$2!l!0#.2!.2!*!/*00$'!7('!8$/(='*0.=*--B!$-$=0$8!+*0.(+*-! )*'-.*/$+02?!"#$!%NG!8($2+10!)'(5.8$!*!)-*07('/!7('!'*=.20!('!^$+()#(F$!5.$62?!R+='$*2$8! 0'*+2)*'$+=BS!*==(&+0*F.-.0BS!2&F2.8.*'.0B!*+8!$77$=0.5$!8$/(='*0.=!=(+0'(-!6.0#.+!0#$!%N!.2!(&'! >(*-?! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! C(&'=$O!%&'()$*+!,*'-.*/$+0! #00)OPP666?$-$=0.(+29:;P! 173 ! !"#$%$&'#()#'%*"+,("*(%-.(/0(1.,"&+'%2( ! "#$!%&!'$()*+,-.!/%&'0!1.!,2!,331,2*$!)4!2,-1)2,3!5,+-1$.6!()7$($2-.!,28!5,+31,($2-,+1,2.!,*+)..! %9+)5$!-#,-!:$31$7$!8$*1.1)2.!(9.-!:$!(,8$!,.!*3).$!-)!-#$!*1-1;$2.!,.!5)..1:3$,12.-!49+-#$+!*$2-+,31;,-1)2!)4!5)?$+!12!@+9..$3.!,28!?)+A!4)+!-#$!8$7)39-1)2!)4!5)?$+! 4+)(!-#$!%&!-)!2,-1)2,3!,28!+$>1)2,3!5,+31,($2-. "+,2.5,+$2*B6!.9:.181,+1-B6!8$()*+,*B!,28!817$+.1-B!,+$!-#$!4)9+!(,12!5+12*153$.!)4!-#$!%&'!C!7,39$.! -#,-!?$!,33!.#,+$!.-,28!,>,12.-!,33!4)+(.!)4!81.*+1(12,-1)2 "#$!8$7$3)5($2-!)4!-#$!%9+)5$,2!&21)2!1.!,!(,--$+!)4!>+$,-!*)2*$+2!-)!9. "#$!%9+)5$,2!&21)2!$+)8$.!%9+)5$,2!8$()*+,*B!12!-?)!?,B.F!41+.-6!-#$!$7$+C12*+$,.12>!-+,2.4$+!)4! 5)?$+! -)! @+9..$3.! ?18$2.! -#$! >,5! :$-?$$2! *1-1;$2.! ,28! -#$! $31-$.)7$+2($2-.!*)+5)+,-1)2.!,-!-#$!$H5$2.$!)4!8$*1.1)2!(,A12>!12! 8$()*+,-1*,33B!$3$*-$8!:)81$. "#$!%&'!:$31$7$.!-#,-!8$*1.1)2.!+$>,+812>!-#$!:,3,2*$!)4!5)?$+!:$-?$$2!(,+A$-!,28!8$()*+,-1*,33B! $3$*-$8! 12.-1-9-1)2.! .#)938! :$! 8$*18$8! 12! 2,-1)2,3! 5,+31,($2-.! ,**)+812>! -)! +$.93-.! 4+)(! 2,-1)2,3! $3$*-1)2.6!,28!2)-!:B!-+$,-1$.!-#,-!,+$!12-$+5+$-$8!:B!,!.(,33!29(:$+!)4!I98>$.!12!-#$!%9+)5$,2!D)9+-! 12!J9H$(:9+> "#$!%&'!*)2.1.-.!)4!($(:$+.6!()7$($2-.!,28!($(:$+!5,+-1$.!4+)(!,!:+),8!5)31-1*,3!,28!+$>1)2,3! .5$*-+9(K! 4+)(! G*,2812,71,! -)! -#$! @,3A,2.! ,28! -#$! L:$+1,2! M$212.93,+1-B!-)!.,BF!G-)5N! "#$!%9+)5$,2!&21)2!1.!#$,812>!-#$!?+)2>!81+$*-1)2!?1-#!1-.!$7$+C12*+$,.12>!*$2-+,31.,-1)2!)4!5)?$+! 12!@+9..$3.B!1.!-)!921-$!*+1-1*,3!4)+*$.!-#,-!$(:+,*$!)9+!18$)3)>1*,3!4)928,-1)2!12!,! 5)31-1*,3!.-+9>>3$!,>,12.-!-#$!4$8$+,31;,-1)2!)4!%9+)5$ =2!-#$!?#)3$6!-#$!-#+$$!:1>!5)31-1*,3!4,(131$.F!D#+1.-1,2!'$()*+,-.6!G)*1,31.-.!,28!J1:$+,3.6!.#,+$!,! 4$8$+,31.-!,>$28,!-#,-!*)2-+)3.!-#$!%9+)5$,2!M,+31,($2-!-$+(! >),3! )4! *+$,-12>! ,! &21-$8! G-,-$.! )4! %9+)5$!-#$!*1-1;$2.!)4!-#$!%9+)5$,2!.-,-$. ( 174 3-.(4'$#5(6"+7("*(%-.(/0(1.,"&+'%2($89"#9.2(%-.(*"##"6$8:('&%$9$%$.2;! O! P+>912>! 12! 4,7)9+! )4! 5)31-1*,3! 128$5$28$2*$! 4)+! -#$! ($(:$+! .-,-$.! ,28! -#$1+! 2,-1)2,3! $3$*-$8! 12.-1-9-1)2. O!Q)21-)+12>!-#$!1(53$($2-,-1)2!)4!-#$!%&!D)2.-1-9-1)2,3!"+$,-B!/-#$!J1.:)2!"+$,-B0!12!-#$!%9+)5$,2! &21)2!,28!#1>#31>#-12>!1-.!5+):3$(.!12!+$3,-1)2!-)!-#$!5)31-1*,3!128$5$28$2*$!)4!-#$!($(:$+!.-,-$. O!R)+A12>!,>,12.-!2$?!121-1,-17$.!4+)(!-#$!%9+)5$,2!12.-1-9-1)2.!,1(12>!,-!*)2-+)3312>!()+$!5)31*B! ,+$,. O! R)+A12>! ,>,12.-! -#$! 8$7$3)5($2-!)4! ,! %9+)5$,2! &21)2!S)+$1>2!G$+71*$!-#,-!?133!928$+(12$!-#$! ($(:$+!.-,-$.!4)+$1>26!.$*9+1-B!,28!8$4$2*$!5)31*B O!R)+A12>!,>,12.-!-#$!$H5,2.1)2!)4!-#$!$9+)!;)2$ O!R)+A12>!4)+!-+,2.5,+$2*B!,28!+$4)+(.!,1($8!,-!-)-,3!)5$22$..!12!,33!%&!12.-1-9-1)2. <=+(9$2$"8('>"=%(*=%=+.(&"").+'%$"8($8(/=+").;( =9+!*)(()2!>),3!1.!-)!81(121.#!-#$!5)?$+!)4!%&!12.-1-9-1)2.!,28!-)!*+$,-$!,!%9+)5$!?1-#!5$,*$493! *))5$+,-1)2! ,()2>.-! .)7$+$1>2! G-,-$.B6! -#$+$! ,+$! (,2B! ,3-$+2,-17$! .5$*141*!,55+),*#$.F! T),3!*,2!)23B! :$! ,*#1$7$8! 14! -#$1+! *)92-+1$.! 3$,7$! -#$! %9+)5$,2!&21)2 U$!-#$!5+$.$2-!%9+)5$,2!&21)2!12-)!.)($-#12>!.1(13,+!-)!-#$! %9+)5$,2!S+$$!"+,8$!P..)*1,-1)2 V#-!#,7$!-#$!)5121)2!-#,-!-#$!%9+)5$,2!&21)2!1.!2)-!)23B!,!*)(()2!(,+A$-!:9-!,3.)! ,2!)55)+-921-B!-)!*))5$+,-$!12!)-#$+!41$38.!.9*#!,.!$271+)2($2-,3!5)31*B "#$!%&!'$()*+,-.!4128!2)!*)2-+,81*-1)2.!:$-?$$2!*+1-1*,3!()7$($2-.!,28!X?1-#8+,?,31.-.X!.12*$!?$! ,33! ,>+$$! )2! ,! 4928,($2-,3! 1..9$! 12! 5+$.$2-! 8,B! 5)31-1*.F! ")! .-)5! -#$! 8$7$3)5($2-! )4! -#$! &21-$8! G-,-$.!)4!%9+)5$N!R$!(9.-!?)+A!-)>$-#$+!-)!.-)5!-#$!$+).1)2!)4!8$()*+,*BK!1(5+)7$!-+,2.5,+$2*B6! )5$22$..!,28!2,-1)2,3!.)7$+$1>2-B <=+(*=%=+.(%'272( %&'!#,.!,!+)3$!-)!53,B!12!-#$!5)31-1*.!)4!%9+)5$ R$!#,7$!8$7$3)5$8!124)+(,-1)2!*,(5,1>2.!)2!-#$!J1.:)2!"+$,-B!12!-#$!41+.-!,28!.$*)28!+$4$+$289(.! ,28!?$!?133!*)2-129$!?1-#!)9+!*,(5,1>2.!12!-#$!*)(12>!+$4$+$289(.F!)2$!12! G?$8$2! )2!-#$! $9+)! ,28!)2$!)+! .$7$+,3! 12!'$2(,+A! ,3.)! )2! -#$! $9+)6! ,.! ?$33! ,.! -#$! %812:9+>#! ,>+$$($2- 175 R$!,3.)!:$31$7$!-#,-!L*$3,281*!7)-$+.!,+$!12!2$$8!)4!%&!124)+(,-1)2!12!-#$!$7$2-!,!+$4$+$289(!-,A$.! 53,*$!124)+(,-1)2!12!L*$3,28!1.!)2$!)9+!-)5!5+1)+1-1$. S9+-#$+()+$6!%&!*+1-1*,3!5)31-1*,3!4)+*$.!,+)928!%9+)5$!2$$8!,!*)2-,*-!12!@+9..$3.!-#,-!*,2!5+)718$! ,*-9,3!124)+(,-1)2!)2!%&!,44,1+. "#$! 4,139+$! )4! -#$! $9+)! 1.! ,2! $..$2-1,3! .9:I$*-! )2! ?#1*#!?$!*,2!5+)718$!124)+(,-1)26!$.5$*1,33B!12! *)92-+1$.! .9*#! ,.! L+$3,28! -#$! &21-$8! Y12>8)(6! G?$8$26! '$2(,+A6! D;$*#! Z$59:31*6! M)3,28! ,28! %.-)21, "#$! %&'! (9.-! ,3.)! 41>#-! 4)+! -#$! +93$! )4! -+,2.5,+$2*B! ?1-#12! -#$! %&! 12.-1-9-1)2.$- "#$!%&!'$()*+,-.!#,7$!-#$!2$-?)+A!,28!-#$!2$*$..,+B!$H5$+-1.$!-)!>$-!-#$!I):!8)2$ ?2(%-.+.('85("%-.+('#%.+8'%$9.@( J$-[.!4,*$!1-$8!-)!,55+)7$!,28!+,-14B!,33!-+$,-1$. 176