DOCSLIB.ORG

The Centromeric Part of the Human NK Gene Complex: Linkage of LOX-1 and LY49L with the CD94/NKG2 Region

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Centromeric Part of the Human NK Gene Complex: Linkage of LOX-1 and LY49L with the CD94/NKG2 Region Genes and Immunity (2000) 1, 280–287 2000 Macmillan Publishers Ltd All rights reserved 1466-4879/00 $15.00 www.nature.com/gene The centromeric part of the human NK gene complex: linkage of LOX-1 and LY49L with the CD94/NKG2 region C Bull1, Y Sobanov2,BRo¨hrdanz1, J O’Brien1, H Lehrach1 and E Hofer2 1Max-Planck-Institute for Molecular Genetics, Ihnestrasse 73, D-14195 Berlin, Germany; 2Department of Vascular Biology and Thrombosis Research, Vienna International Research Cooperation Center, University of Vienna, Brunnerstrasse 59, A-1235 Vienna, Austria The natural killer (NK) gene complex is a genomic region containing lectin-type receptor genes. We have established a contig of PAC and BAC clones comprising about 1 Mb of the centromeric part of the NK gene complex. This region extends from the LOX-1 gene, which encodes a receptor for oxidized LDL and was found within 100 kb telomeric of the STS marker D12S77, contains the CD94 and NKG2 NK receptor genes and reaches beyond D12S852 on the proximal side. In this part we have mapped the human LY49L gene, a homologue of the rodent Ly49 genes, which encode important MHC class I receptors for the regulation of NK cell activity in rodents. The LY49L gene is localized 100 to 200 kb centromeric of the NKG2 gene cluster and 300 to 400 kb telomeric of the STS marker D12S841. Genomic sequencing of the complete gene including promoter and intron sequences confirmed that the structure is similar to the mouse Ly49 genes. Screening of several cDNA libraries did not detect any transcripts of putative additional human LY49 genes. In addition, in the course of these studies several EST sequences were localized in the region, one immediately upstream of the LY49L gene. Genes and Immunity (2000) 1, 280–287. Keywords: natural killer cells; NK gene complex; chromosome 12; LOX, CD94, NKG2 and LY-49 genes Introduction NKR-P1 families. Whereas members of the CD94/NKG2 and the NKR-P1 families have been found to be Cytotoxicity of natural killer (NK) cells towards tumor or expressed in mice,17–19 rats20 and humans,5,21–24 1 virally infected target cells is regulated by inhibitory and expression of functional Ly49 proteins has so far only activating signals from cell surface receptors. NK cell been detected in rodents.15,19 receptors that recognize MHC class I or related molecules Recently, an aberrantly spliced cDNA coding for a 2–6 on target cells can be grouped into two structurally dis- human LY49 molecule (named Ly49L) has been tinct classes, namely the immunoglobulin-(Ig)-like and detected25 in the expressed sequence tags (EST) database the C-type lectin receptors. The killer immunoglobulin- and in cDNA libraries derived from human NK cells. like receptors (KIR) have been found to be expressed on Therefore genes related to all different NK cell receptor human NK cells and different variants display either classes have now been found in rodents and in humans. repressive or triggering functions. They are encoded by However, it remains unclear whether intact gene families a cluster of genes in a region on chromosome 19 named related to the human KIR receptors and the rodent Ly49 7,8 the leukocyte receptor complex (LRC). A gene distantly receptors coexist and fulfill similar functions in human as related to the Ig-like receptor gene family has recently well as in rodent NK cells or whether these two receptor also been detected in mice, but its relevance for rodent classes, which bind classical MHC class I molecules, have 9 NK cell function has not been firmly established. evolved differently from common ancestor genes in C-type lectin NK receptors, which occur in both inhibi- humans and rodents. tory and activating forms and are encoded within a syn- Furthermore, there are additional lectin-type receptors 10–13 tenic region on human chromosome 12, mouse chro- encoded in the NK gene complex which possess different 14,15 16 mosome 6 and rat chromosome 4, called the NK functions in various cell types. The CD69 or AICL recep- gene complex, can be sub-grouped into different families. tors26,27 are widely expressed in the hematopoietic lineage Among these are the CD94/NKG2, the Ly49 and the and their functions and ligands are not clearly defined. Recently, the lectin-type LLT1 receptor was reported to be broadly expressed in lymphocytes.28 Furthermore, a Correspondence: Erhard Hofer, Department of Vascular Biology and member of another lectin-type receptor class, LOX-1, has Thrombosis Research, Vienna International Research Cooperation Center, been implicated as a receptor for oxidized low-density University of Vienna, Brunnerstrasse 59, A-1235 Vienna, Austria lipoprotein on endothelial cells and monocytes.29 This work was supported in part by a grant from the Austrian National Bank (Jubila¨umsfond No. 7567) to E.H. In order to establish the basis to search for novel forms Supplementary material to this paper is available from the author. of lectin-type receptor genes, to link the NKG2 and CD94 Received 28 January 2000; revised and accepted 22 February 2000 NK cell receptor genes13,23 with the region containing the Human NK gene complex C Bull et al 281 LY49L and other potentially related genes and to get bp] and 2729 bp) was confirmed as has been previously some clues to the evolution of the locus, we have now published.30 The first exon, however, containing only constructed a physical map based on PAC and BAC untranslated sequence extends at least 285 bp beyond the clones of the centromeric part of the NK complex region. 5Ј-end described by others.25,30 We also noticed that the We have focused here on the centromeric part of the NK exon-intron boundaries of the human LY49L gene (Figure gene complex since the available data indicate that the 2a) differ for all exons from the sequences that have been syntenic region of rodents contains more than nine Ly49 found most frequently at mammalian splice sites.31,32 The genes and resistance loci for cytomegalovirus and pox cDNAs isolated by us and others always contained a part virus.15 In addition we find the LOX-1 gene to be located of intron 5. This is due to the use of a cryptic splice site 200 kb telomeric of CD94. Sequencing of the complete in intron 5. An alignment of all known Ly49 genes from LY49L gene confirmed previous results concerning the mouse, rat and human (Figure 2b) shows that the very exon/intron structure.30 Furthermore, we have identified 3Ј base of exon 5 is a G in all rodent genes, whereas it is several genes represented as EST sequences in the ana- a C in the human LY49L gene. The G is most frequently lyzed region, one EST is encoded within a very short dis- found at the 3Ј end of mammalian exons. tance to the 5Ј-end of the LY49L gene. The potential promoter region of the LY49L gene The approximate position of the potential transcription Results start site was inferred from a cDNA clone that contained a 381 bp sequence stretch upstream from the predicted A contig of PAC and BAC clones comprising the translation initiation codon. This region was not func- centromeric part of the NK gene complex tionally tested but as another gene (EST AA005053) was 13,23 Starting from the NKG2/CD94 gene region and the already located only 559 bp upstream of this site, it seems LY49L gene we have established contigs of PAC and BAC unlikely that transcription initiates much further clones that extend over about 1 Mb and contain the cen- upstream. The 559 bp sequence was analyzed in order to tromeric part of the NK gene complex. Most parts of the find potential promoter binding sites by the SIGSCAN region are covered by several clones (see Figure 1). The algorithm (Version 4.05, http://bimas.dcrt.nih.gov:80/ 29 LOX-1 gene was detected in clone L21228, the first clone molbio/signal/) developed by Dan S Prestridge. This on the telomeric side of this contig, and this gene is there- analysis suggested some potential TATA boxes and tran- fore located about 100 kb telomeric of the STS marker scription factor consensus binding sites based on the D12S77, which flanks the NKG2/CD94 region. The CD94 TRANSFAC database33 (see Figure 3). gene and all five NKG2 genes are placed between 100 to 200 kb centromeric of D12S77 and their relative orien- Screening for additional LY49L genes 13 tation and linkage has been described previously. The After screening two natural killer cell cDNA libraries as LY49L gene is 100 to 200 kb proximal of the NKG2A gene well as human fetal liver, fetal lung, fetal spleen and and has been linked to the STS marker D12S841 which spleen cDNA libraries we detected another incompletely is found 200 to 300 kb centromeric of LY49L. The contig spliced cDNA in a human fetal lung library in addition region extends further beyond the STS markers D12S112 to the one described previously.25 This cDNA lacked exon and D12S852 and therefore covers about 600 kb of the 4 and contained part of intron 5 due to the use of a cryp- region proximal of LY49L. tic splice site in the intron. However, we did not identify any clone that would encode an LY49L molecule with a Additional genes and ESTs in the region complete carbohydrate recognition domain. Taking into By end-sequencing of individual PAC clones several account the possibility that other human LY49 genes sequences identical or closely similar to database EST might have diverged quite far from the rodent genes, we entries were detected in the region.
Load more

Recommended publications
  • Downloaded the Normalized Gene Expression Profile from the GEO (Package Geoquery (5))
    1 SUPPLEMENTARY MATERIALS 2 Supplementary Methods 3 Study design 4 The workflow to identify and validate the TME risk score and TME subtypes in gastric cancer is 5 depicted in Fig. S1. We first estimated the absolute abundance levels of the major stromal and 6 immune cell types in the TME using bulk gene expression data, and assessed the prognostic 7 effect of these cells in a discovery cohort. Next, we constructed a TME risk score and validated it 8 in two independent gene expression validation cohorts and three immunohistochemistry 9 validation cohorts. Finally, we stratified patients into four TME subtypes and examined their 10 genomic and molecular features and relation to established molecular subtypes. 11 Gene expression data 12 To explore the prognostic landscape of the TME, we used four gene expression profile (GEP) 13 datasets of resected gastric cancer patients with publicly available clinical information, namely, 14 ACRG (GSE62254) (1), GSE15459 (2), GSE84437 (3), and TCGA stomach adenocarcinoma 15 (STAD). Specifically, the raw microarray data in the ACRG cohort and GSE15459 were retrieved 16 from the Gene Expression Omnibus (GEO), and normalized by the RMA algorithm (package affy) 17 using custom chip definition files (Brainarray version 23 (4)) that convert Affymetrix probesets to 18 Entrez gene IDs. For GSE84437 dataset, which was measured by the Illumina platform, we 19 downloaded the normalized gene expression profile from the GEO (package GEOquery (5)). The 20 Illumina probes were also mapped to Entrez genes. For multiple probes mapping to the same 21 Entrez gene, we selected the one with the maximum mean expression level as the surrogate for 22 the Entrez gene using the function of collapseRows (6) (package WGCNA).
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • Human Lectins, Their Carbohydrate Affinities and Where to Find Them
    biomolecules Review Human Lectins, Their Carbohydrate Affinities and Where to Review HumanFind Them Lectins, Their Carbohydrate Affinities and Where to FindCláudia ThemD. Raposo 1,*, André B. Canelas 2 and M. Teresa Barros 1 1, 2 1 Cláudia D. Raposo * , Andr1 é LAQVB. Canelas‐Requimte,and Department M. Teresa of Chemistry, Barros NOVA School of Science and Technology, Universidade NOVA de Lisboa, 2829‐516 Caparica, Portugal; [email protected] 12 GlanbiaLAQV-Requimte,‐AgriChemWhey, Department Lisheen of Chemistry, Mine, Killoran, NOVA Moyne, School E41 of ScienceR622 Co. and Tipperary, Technology, Ireland; canelas‐ [email protected] NOVA de Lisboa, 2829-516 Caparica, Portugal; [email protected] 2* Correspondence:Glanbia-AgriChemWhey, [email protected]; Lisheen Mine, Tel.: Killoran, +351‐212948550 Moyne, E41 R622 Tipperary, Ireland; [email protected] * Correspondence: [email protected]; Tel.: +351-212948550 Abstract: Lectins are a class of proteins responsible for several biological roles such as cell‐cell in‐ Abstract:teractions,Lectins signaling are pathways, a class of and proteins several responsible innate immune for several responses biological against roles pathogens. such as Since cell-cell lec‐ interactions,tins are able signalingto bind to pathways, carbohydrates, and several they can innate be a immuneviable target responses for targeted against drug pathogens. delivery Since sys‐ lectinstems. In are fact, able several to bind lectins to carbohydrates, were approved they by canFood be and a viable Drug targetAdministration for targeted for drugthat purpose. delivery systems.Information In fact, about several specific lectins carbohydrate were approved recognition by Food by andlectin Drug receptors Administration was gathered for that herein, purpose. plus Informationthe specific organs about specific where those carbohydrate lectins can recognition be found by within lectin the receptors human was body.
    [Show full text]
  • Supplementary Table S1. List of Differentially Expressed
    Supplementary table S1. List of differentially expressed transcripts (FDR adjusted p‐value < 0.05 and −1.4 ≤ FC ≥1.4). 1 ID Symbol Entrez Gene Name Adj. p‐Value Log2 FC 214895_s_at ADAM10 ADAM metallopeptidase domain 10 3,11E‐05 −1,400 205997_at ADAM28 ADAM metallopeptidase domain 28 6,57E‐05 −1,400 220606_s_at ADPRM ADP‐ribose/CDP‐alcohol diphosphatase, manganese dependent 6,50E‐06 −1,430 217410_at AGRN agrin 2,34E‐10 1,420 212980_at AHSA2P activator of HSP90 ATPase homolog 2, pseudogene 6,44E‐06 −1,920 219672_at AHSP alpha hemoglobin stabilizing protein 7,27E‐05 2,330 aminoacyl tRNA synthetase complex interacting multifunctional 202541_at AIMP1 4,91E‐06 −1,830 protein 1 210269_s_at AKAP17A A‐kinase anchoring protein 17A 2,64E‐10 −1,560 211560_s_at ALAS2 5ʹ‐aminolevulinate synthase 2 4,28E‐06 3,560 212224_at ALDH1A1 aldehyde dehydrogenase 1 family member A1 8,93E‐04 −1,400 205583_s_at ALG13 ALG13 UDP‐N‐acetylglucosaminyltransferase subunit 9,50E‐07 −1,430 207206_s_at ALOX12 arachidonate 12‐lipoxygenase, 12S type 4,76E‐05 1,630 AMY1C (includes 208498_s_at amylase alpha 1C 3,83E‐05 −1,700 others) 201043_s_at ANP32A acidic nuclear phosphoprotein 32 family member A 5,61E‐09 −1,760 202888_s_at ANPEP alanyl aminopeptidase, membrane 7,40E‐04 −1,600 221013_s_at APOL2 apolipoprotein L2 6,57E‐11 1,600 219094_at ARMC8 armadillo repeat containing 8 3,47E‐08 −1,710 207798_s_at ATXN2L ataxin 2 like 2,16E‐07 −1,410 215990_s_at BCL6 BCL6 transcription repressor 1,74E‐07 −1,700 200776_s_at BZW1 basic leucine zipper and W2 domains 1 1,09E‐06 −1,570 222309_at
    [Show full text]
  • Gene Section Review
    Atlas of Genetics and Cytogenetics in Oncology and Haematology INIST -CNRS OPEN ACCESS JOURNAL Gene Section Review KLRK1 (killer cell lectin-like receptor subfamily K, member 1) Lewis L Lanier UCSF, Department of Microbiology and Immunology, San Francisco, CA 94143-0414, USA (LLL) Published in Atlas Database: June 2014 Online updated version : http://AtlasGeneticsOncology.org/Genes/KLRK1ID41094ch12p13.html DOI: 10.4267/2042/56407 This article is an update of : Lanier LL. KLRK1 (killer cell lectin-like receptor subfamily K, member 1). Atlas Genet Cytogenet Oncol Haematol 2008;12(1):47- 49. This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 2.0 France Licence. © 2015 Atlas of Genetics and Cytogenetics in Oncology and Haematology Abstract DNA/RNA KLRK1 encodes a type II transmembrane-anchored Note glycoprotein that is expressed as a disulfide-linked KLRK1 is present on chromosome 12 within a homodimer on the surface of Natural Killer (NK) cluster of genes referred to as the "NK complex" cells, gamma/delta TcR+ T cells, CD8+ T cells, and (NKC) because several genes that are preferentially a minor subset of CD4+ T cells. It associates non- expressed by Natural Killer (NK) cells are located covalently with the DAP10 signaling protein and in this region, including on the centromeric side provides activating or costimulatory signals to NK KLRD1 (CD94) and on the telomeric side KLRC4 cells and T cells. NKG2D binds to a family of (NKG2F), KLRC3 (NKG2E), KLRC2 (NKG2C), glycoproteins, in humans the MICA, MICB, and and KLRC1 (NKG2A) (Houchins et al., 1991). ULBP1-6 membrane proteins, which are frequently Description expressed on cells that have become infected with pathogens or undergone transformation.
    [Show full text]
  • WO 2017/055322 Al O
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2017/055322 Al 6 April 2017 (06.04.2017) W P O PCT (51) International Patent Classification: Umrsl l38, Equipe 13, 15 rue de l'Ecole de Medecine, C12Q 1/68 (2006.01) 75006 Paris (FR). (21) International Application Number: (74) Agent: COLLIN, Matthieu; Inserm Transfert 7 rue Watt, PCT/EP2016/073053 75013 Paris (FR). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 28 September 2016 (28.09.201 6) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, (25) Filing Language: English BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DJ, DK, DM, (26) Publication Language: English DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IR, IS, JP, KE, KG, KN, KP, KR, (30) Priority Data: KW, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, EP15306521.4 29 September 2015 (29.09.2015) EP MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, EP16305886.0 12 July 2016 (12.07.2016) EP OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, (71) Applicants: INSERM (INSTITUT NATIONAL DE LA SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, SANTE ET DE LA RECHERCHE MEDICALE) TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, [FR/FR]; 101, rue de Tolbiac, 75013 Paris (FR).
    [Show full text]
  • Genes NKG2 and CD94 Common Chimpanzee Conservation And
    Conservation and Variation in Human and Common Chimpanzee CD94 and NKG2 Genes This information is current as Benny P. Shum, Laura R. Flodin, David G. Muir, Raja of October 2, 2021. Rajalingam, Salim I. Khakoo, Sophia Cleland, Lisbeth A. Guethlein, Markus Uhrberg and Peter Parham J Immunol 2002; 168:240-252; ; doi: 10.4049/jimmunol.168.1.240 http://www.jimmunol.org/content/168/1/240 Downloaded from References This article cites 66 articles, 16 of which you can access for free at: http://www.jimmunol.org/content/168/1/240.full#ref-list-1 http://www.jimmunol.org/ Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication by guest on October 2, 2021 *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2002 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Conservation and Variation in Human and Common Chimpanzee CD94 and NKG2 Genes1 Benny P. Shum, Laura R. Flodin, David G. Muir, Raja Rajalingam, Salim I. Khakoo,2 Sophia Cleland, Lisbeth A.
    [Show full text]
  • Anti-CD314 / NKG2D Antibody (ARG59400)
    Product datasheet [email protected] ARG59400 Package: 100 μl anti-CD314 / NKG2D antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes CD314 / NKG2D Tested Reactivity Hu Tested Application ICC/IF Host Rabbit Clonality Polyclonal Isotype IgG Target Name CD314 / NKG2D Antigen Species Human Immunogen Synthetic peptide within aa. 50-150 of Human CD314 / NKG2D (NP_031386.2). Conjugation Un-conjugated Alternate Names LR; CD314; NKG2D; NKG2-D; D12S2489E Application Instructions Application table Application Dilution ICC/IF 1:50 - 1:200 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 25 kDa Properties Form Liquid Purification Affinity purified. Buffer PBS (pH 7.3), 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation www.arigobio.com 1/2 Gene Symbol KLRK1 Gene Full Name killer cell lectin like receptor K1 Background Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function.
    [Show full text]
  • Terminal Effector CD8 T Cells Defined by an IKZF2+IL-7R
    Terminal Effector CD8 T Cells Defined by an IKZF2 +IL-7R− Transcriptional Signature Express Fc γRIIIA, Expand in HIV Infection, and Mediate Potent HIV-Specific This information is current as Antibody-Dependent Cellular Cytotoxicity of September 23, 2021. Prossy Naluyima, Kerri G. Lal, Margaret C. Costanzo, Gustavo H. Kijak, Veronica D. Gonzalez, Kim Blom, Leigh Anne Eller, Matthew Creegan, Ting Hong, Dohoon Kim, Thomas C. Quinn, Niklas K. Björkström, Hans-Gustaf Downloaded from Ljunggren, David Serwadda, Elly T. Katabira, Nelson K. Sewankambo, Ronald H. Gray, Jared M. Baeten, Nelson L. Michael, Fred Wabwire-Mangen, Merlin L. Robb, Diane L. Bolton, Johan K. Sandberg and Michael A. Eller J Immunol published online 13 September 2019 http://www.jimmunol.org/ http://www.jimmunol.org/content/early/2019/09/12/jimmun ol.1900422 Supplementary http://www.jimmunol.org/content/suppl/2019/09/12/jimmunol.190042 Material 2.DCSupplemental by guest on September 23, 2021 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Author Choice Freely available online through The Journal of Immunology Author Choice option Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2019 The Authors.
    [Show full text]
  • KLRC4 (NM 013431) Human Tagged ORF Clone – RG204640 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG204640 KLRC4 (NM_013431) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: KLRC4 (NM_013431) Human Tagged ORF Clone Tag: TurboGFP Symbol: KLRC4 Synonyms: NKG2-F; NKG2F Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG204640 representing NM_013431 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATAAACAAAGAGGAACCTACTCAGAAGTGAGTCTGGCCCAGGACCCAAAGAGGCAGCAAAGGAAAC TTAAGGGCAATAAAATCTCCATTTCAGGAACCAAACAGGAAATATTCCAAGTAGAATTAAACCTTCAAAA TGCTTCTTCGGATCATCAAGGGAATGACAAGACATATCACTGCAAAGGTTTACTGCCACCTCCAGAGAAG CTCACTGCTGAGGTCCTAGGAATCATTTGCATTGTCCTGATGGCCACTGTGTTAAAAACAATAGTTCTTA TTCCTTGTATTGGAGTACTGGAGCAGAACAATTTTTCCCTGAATAGAAGAATGCAGAAAGCACGTCATTG TGGCCATTGTCCTGAGGAGTGGATTACATATTCCAACAGTTGTTATTACATTGGTAAGGAAAGAAGAACT TGGGAAGAAAGAGTTTGCTGGCCTGTGCTTCGAAGAACTCTGATCTGCTTTCTA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG204640 representing NM_013431 Red=Cloning site Green=Tags(s) MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEK LTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRT WEERVCWPVLRRTLICFL TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not
    [Show full text]
  • NKG2D Natural Killer Cell Receptor—A Short Description and Potential Clinical Applications
    cells Review NKG2D Natural Killer Cell Receptor—A Short Description and Potential Clinical Applications Jagoda Siemaszko 1, Aleksandra Marzec-Przyszlak 2 and Katarzyna Bogunia-Kubik 1,* 1 Laboratory of Clinical Immunogenetics and Pharmacogenetics, Hirszfeld Institute of Immunology and Experimental Therapy, Polish Academy of Sciences, 53114 Wroclaw, Poland; [email protected] 2 Department of Biosensors and Processing of Biomedical Signals, Faculty of Biomedical Engineering, Silesian University of Technology, 41800 Zabrze, Poland; [email protected] * Correspondence: [email protected] Abstract: Natural Killer (NK) cells are natural cytotoxic, effector cells of the innate immune system. They can recognize transformed or infected cells. NK cells are armed with a set of activating and inhibitory receptors which are able to bind to their ligands on target cells. The right balance between expression and activation of those receptors is fundamental for the proper functionality of NK cells. One of the best known activating receptors is NKG2D, a member of the CD94/NKG2 family. Due to a specific NKG2D binding with its eight different ligands, which are overexpressed in transformed, infected and stressed cells, NK cells are able to recognize and attack their targets. The NKG2D receptor has an enormous significance in various, autoimmune diseases, viral and bacterial infections as well as for transplantation outcomes and complications. This review focuses on the NKG2D receptor, the mechanism of its action, clinical relevance of its gene polymorphisms and a potential application in various clinical settings. Citation: Siemaszko, J.; Marzec-Przyszlak, A.; Keywords: NKG2D receptor; NKG2D ligands; NK cells Bogunia-Kubik, K. NKG2D Natural Killer Cell Receptor—A Short Description and Potential Clinical Applications.
    [Show full text]
  • Rabbit Anti-KLRC4/FITC Conjugated Antibody
    SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-KLRC4/FITC Conjugated antibody SL16782R-FITC Product Name: Anti-KLRC4/FITC Chinese Name: FITC标记的杀伤细胞凝集素样受体C亚家族成员4抗体 killer cell lectin-like receptor subfamily C, member 4; KLRC4; NK cell receptor F; Alias: NKG2 F; NKG2-F type II integral membrane protein; NKG2-F-activating NK receptor; NKG2F; NKG2F_HUMAN. Organism Species: Rabbit Clonality: Polyclonal React Species: Human, ICC=1:50-200IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 18kDa Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLH conjugated synthetic peptide derived from human KLRC4 Lsotype: IgG Purification: affinity purified by Protein A Storage Buffer: 0.01Mwww.sunlongbiotech.com TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium- Product Detail: dependent (C-type) lectins, which have been implicated in the regulation of NK cell function.
    [Show full text]