VPS25 Goat Polyclonal Antibody – TA303080 | Origene
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Analysis of Gene Expression Data for Gene Ontology
ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION A Thesis Presented to The Graduate Faculty of The University of Akron In Partial Fulfillment of the Requirements for the Degree Master of Science Robert Daniel Macholan May 2011 ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION Robert Daniel Macholan Thesis Approved: Accepted: _______________________________ _______________________________ Advisor Department Chair Dr. Zhong-Hui Duan Dr. Chien-Chung Chan _______________________________ _______________________________ Committee Member Dean of the College Dr. Chien-Chung Chan Dr. Chand K. Midha _______________________________ _______________________________ Committee Member Dean of the Graduate School Dr. Yingcai Xiao Dr. George R. Newkome _______________________________ Date ii ABSTRACT A tremendous increase in genomic data has encouraged biologists to turn to bioinformatics in order to assist in its interpretation and processing. One of the present challenges that need to be overcome in order to understand this data more completely is the development of a reliable method to accurately predict the function of a protein from its genomic information. This study focuses on developing an effective algorithm for protein function prediction. The algorithm is based on proteins that have similar expression patterns. The similarity of the expression data is determined using a novel measure, the slope matrix. The slope matrix introduces a normalized method for the comparison of expression levels throughout a proteome. The algorithm is tested using real microarray gene expression data. Their functions are characterized using gene ontology annotations. The results of the case study indicate the protein function prediction algorithm developed is comparable to the prediction algorithms that are based on the annotations of homologous proteins. -
Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice
University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia. -
Why Cells and Viruses Cannot Survive Without an ESCRT
cells Review Why Cells and Viruses Cannot Survive without an ESCRT Arianna Calistri * , Alberto Reale, Giorgio Palù and Cristina Parolin Department of Molecular Medicine, University of Padua, 35121 Padua, Italy; [email protected] (A.R.); [email protected] (G.P.); [email protected] (C.P.) * Correspondence: [email protected] Abstract: Intracellular organelles enwrapped in membranes along with a complex network of vesicles trafficking in, out and inside the cellular environment are one of the main features of eukaryotic cells. Given their central role in cell life, compartmentalization and mechanisms allowing their maintenance despite continuous crosstalk among different organelles have been deeply investigated over the past years. Here, we review the multiple functions exerted by the endosomal sorting complex required for transport (ESCRT) machinery in driving membrane remodeling and fission, as well as in repairing physiological and pathological membrane damages. In this way, ESCRT machinery enables different fundamental cellular processes, such as cell cytokinesis, biogenesis of organelles and vesicles, maintenance of nuclear–cytoplasmic compartmentalization, endolysosomal activity. Furthermore, we discuss some examples of how viruses, as obligate intracellular parasites, have evolved to hijack the ESCRT machinery or part of it to execute/optimize their replication cycle/infection. A special emphasis is given to the herpes simplex virus type 1 (HSV-1) interaction with the ESCRT proteins, considering the peculiarities of this interplay and the need for HSV-1 to cross both the nuclear-cytoplasmic and the cytoplasmic-extracellular environment compartmentalization to egress from infected cells. Citation: Calistri, A.; Reale, A.; Palù, Keywords: ESCRT; viruses; cellular membranes; extracellular vesicles; HSV-1 G.; Parolin, C. -
Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Anti-VPS25 monoclonal antibody, clone T3 (DCABH-13967) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]). Immunogen VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNN VKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT LYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol VPS25 Synonyms VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae); -
Endosome-Associated Complex, ESCRT-II, Recruits Transport Machinery for Protein Sorting at the Multivesicular Body
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Developmental Cell, Vol. 3, 283–289, August, 2002, Copyright 2002 by Cell Press Endosome-Associated Complex, ESCRT-II, Recruits Transport Machinery for Protein Sorting at the Multivesicular Body Markus Babst,2,4 David J. Katzmann,4 plays a critical role in the sorting of multiple cargo pro- William B. Snyder,2 Beverly Wendland,3 teins within the endosomal membrane system. and Scott D. Emr1 In a recent study, it has been demonstrated that sort- Department of Cellular and Molecular Medicine and ing of the yeast hydrolase carboxypeptidase S (CPS) Howard Hughes Medical Institute into the MVB pathway requires monoubiquitination of School of Medicine the short cytoplasmic tail of the protein (Katzmann et University of California, San Diego al., 2001). Mutations in CPS that block this ubiquitin La Jolla, California 92093 modification result in mislocalization of the protein to the limiting membrane of the vacuole. Furthermore, a protein complex called ESCRT-I (endosomal sorting complex required for transport) binds to ubiquitinated Summary CPS and thereby directs sorting of the hydrolase into the MVB pathway (Katzmann et al., 2001). ESCRT-I is Sorting of ubiquitinated endosomal membrane pro- composed of three different protein subunits (Vps23, teins into the MVB pathway is executed by the class Vps28, and Vps37) which belong to the class E vacuolar E Vps protein complexes ESCRT-I, -II, and -III, and protein sorting (Vps) proteins, a group of 15 proteins the AAA-type ATPase Vps4. This study characterizes required for proper endosomal function, including the ف ESCRT-II, a soluble 155 kDa protein complex formed formation of MVBs (Odorizzi et al., 1998). -
Identification of Novel Dna Damage Response Genes Using Functional Genomics
IDENTIFICATION OF NOVEL DNA DAMAGE RESPONSE GENES USING FUNCTIONAL GENOMICS by Michael Chang A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Graduate Department of Biochemistry University of Toronto © Copyright by Michael Chang (2005) Identification of novel DNA damage response genes using functional genomics Doctor of Philosophy, 2005; Michael Chang; Department of Biochemistry, University of Toronto ABSTRACT The genetic information required for life is stored within molecules of DNA. This DNA is under constant attack as a result of normal cellular metabolic processes, as well as exposure to genotoxic agents. DNA damage left unrepaired can result in mutations that alter the genetic information encoded within DNA. Cells have consequently evolved complex pathways to combat damage to their DNA. Defects in the cellular response to DNA damage can result in genomic instability, a hallmark of cancer cells. Identifying all the components required for this response remains an important step in fully elucidating the molecular mechanisms involved. I used functional genomic approaches to identify genes required for the DNA damage response in Saccharomyces cerevisiae. I conducted a screen to identify genes required for resistance to a DNA damaging agent, methyl methanesulfonate, and identified several poorly characterized genes that are necessary for proper S phase progression in the presence of DNA damage. Among the genes identified, ESC4/RTT107 has since been shown to be essential for the resumption of DNA replication after DNA damage. Using genome-wide genetic interaction screens to identify genes that are required for viability in the absence of MUS81 and MMS4, two genes required for resistance to DNA damage, I helped identify ELG1, deletion of which causes DNA replication defects, genomic instability, and an inability to properly recover from DNA damage during S phase. -
THE OLD and NEW FACE of CRANIOFACIAL RESEARCH: How Animal Models Inform Human Craniofacial Genetic and Clinical Data
HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Dev Biol Manuscript Author . Author manuscript; Manuscript Author available in PMC 2017 July 15. Published in final edited form as: Dev Biol. 2016 July 15; 415(2): 171–187. doi:10.1016/j.ydbio.2016.01.017. THE OLD AND NEW FACE OF CRANIOFACIAL RESEARCH: How animal models inform human craniofacial genetic and clinical data Eric Van Otterloo, Trevor Williams, and Kristin B. Artinger Department of Craniofacial Biology, School of Dental Medicine, University of Colorado Anschutz Medical Campus, Aurora, CO 80045, USA Kristin B. Artinger: [email protected] Abstract The craniofacial skeletal structures that comprise the human head develop from multiple tissues that converge to form the bones and cartilage of the face. Because of their complex development and morphogenesis, many human birth defects arise due to disruptions in these cellular populations. Thus, determining how these structures normally develop is vital if we are to gain a deeper understanding of craniofacial birth defects and devise treatment and prevention options. In this review, we will focus on how animal model systems have been used historically and in an ongoing context to enhance our understanding of human craniofacial development. We do this by first highlighting “animal to man” approaches: that is, how animal models are being utilized to understand fundamental mechanisms of craniofacial development. We discuss emerging technologies, including high throughput sequencing and genome editing, and new animal repository resources, and how their application can revolutionize the future of animal models in craniofacial research. Secondly, we highlight “man to animal” approaches, including the current use of animal models to test the function of candidate human disease variants. -
Product Information
Product information VPS25, 1-176aa Human, His-tagged, Recombinant, E.coli Cat. No. IBATGP1447 Full name: Vacuolar protein-sorting-associated protein 25 NCBI Accession No.: NP_115729 Synonyms: DERP9, EAP20, FAP20 Description: VPS25, also known as vacuolar protein-sorting-associated protein 25, consists of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may play a role in transcription regulation, possibly via its interaction with ELL. Recombinant human VPS25 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques. Form: Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M Nacl Molecular Weight: 23.3 kDa(200aa), confirmed by MALDI-TOF Purity: > 85% by SDS - PAGE Concentration: 0.5 mg/ml (determined by Bradford assay) 15% SDS-PAGE (3ug) Sequences of amino acids: MGSSHHHHHH SSGLVPRGSH MGSHMAMSFE WPWQYRFPPF FTLQPNVDTR QKQLAAWCSL VLSFCRLHKQ SSMTVMEAQE SPLFNNVKLQ RKLPVESIQI VLEELRKKGN LEWLDKSKSS FLIMWRRPEE WGKLIYQWVS RSGQNNSVFT LYELTNGEDT EDEEFHGLDE ATLLRALQAL QQEHKAEIIT VSDGRGVKFF General references: Bailey,S.D. et al. (2010) Diabetes Care 33 (10), 2250-2253 Talmud,P.J. et al. (2009) Am. J. Hum. Genet. 85 (5), 628-642 Storage: Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. -
Variation in Protein Coding Genes Identifies Information Flow
bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 1 1 2 3 4 5 Variation in protein coding genes identifies information flow as a contributor to 6 animal complexity 7 8 Jack Dean, Daniela Lopes Cardoso and Colin Sharpe* 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 Institute of Biological and Biomedical Sciences 25 School of Biological Science 26 University of Portsmouth, 27 Portsmouth, UK 28 PO16 7YH 29 30 * Author for correspondence 31 [email protected] 32 33 Orcid numbers: 34 DLC: 0000-0003-2683-1745 35 CS: 0000-0002-5022-0840 36 37 38 39 40 41 42 43 44 45 46 47 48 49 Abstract bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 2 1 Across the metazoans there is a trend towards greater organismal complexity. How 2 complexity is generated, however, is uncertain. Since C.elegans and humans have 3 approximately the same number of genes, the explanation will depend on how genes are 4 used, rather than their absolute number. -
Downloaded from NCBI on December 361 5Th, 2020
bioRxiv preprint doi: https://doi.org/10.1101/2021.08.17.456605; this version posted August 17, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Characterisation of the Ubiquitin-ESCRT pathway in Asgard archaea sheds new light on 2 origins of membrane trafficking in eukaryotes 3 4 5 6 Tomoyuki Hatano1, Saravanan Palani1*, Dimitra Papatziamou2*, Diorge P. Souza3*, Ralf Salzer3*, 7 Daniel Tamarit4, 5* Mehul Makwana2, Antonia Potter2, Alexandra Haig2, Wenjue Xu2, David Townsend6, 8 David Rochester6, Dom Bellini3, Hamdi M. A. Hussain1, Thijs Ettema4, Jan Löwe3, Buzz Baum3§, 9 Nicholas P. Robinson2§, Mohan Balasubramanian1§ 10 11 12 13 1 Centre for Mechanochemical Cell Biology, Division of Biomedical Sciences, Warwick Medical School, 14 University of Warwick, Coventry CV4 7AL, United Kingdom 15 2 Division of Biomedical and Life Sciences, Faculty of Health and Medicine, Lancaster University, 16 Lancaster LA1 4YG, United Kingdom 17 3 MRC Laboratory of Molecular Biology, Cambridge CB2 0QH, United Kingdom 18 4 Laboratory of Microbiology, Department of Agrotechnology and Food Sciences, Wageningen 19 University, Wageningen 6708 WE, the Netherlands 20 5 Department of Aquatic Sciences and Assessment, Swedish University of Agricultural Sciences, SE- 21 75007 Uppsala, Sweden 22 6 Department of Chemistry, Lancaster University, Lancaster LA1 4YB, United Kingdom 23 24 25 *These authors contributed equally to this work and are listed alphabetically 26 27 28 29 § Correspondence to Mohan Balasubramanian- [email protected]; Nick 30 Robinson- [email protected] ; Buzz Baum- [email protected] 31 32 33 34 bioRxiv preprint doi: https://doi.org/10.1101/2021.08.17.456605; this version posted August 17, 2021. -
Agricultural University of Athens
ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική -
Content Based Search in Gene Expression Databases and a Meta-Analysis of Host Responses to Infection
Content Based Search in Gene Expression Databases and a Meta-analysis of Host Responses to Infection A Thesis Submitted to the Faculty of Drexel University by Francis X. Bell in partial fulfillment of the requirements for the degree of Doctor of Philosophy November 2015 c Copyright 2015 Francis X. Bell. All Rights Reserved. ii Acknowledgments I would like to acknowledge and thank my advisor, Dr. Ahmet Sacan. Without his advice, support, and patience I would not have been able to accomplish all that I have. I would also like to thank my committee members and the Biomed Faculty that have guided me. I would like to give a special thanks for the members of the bioinformatics lab, in particular the members of the Sacan lab: Rehman Qureshi, Daisy Heng Yang, April Chunyu Zhao, and Yiqian Zhou. Thank you for creating a pleasant and friendly environment in the lab. I give the members of my family my sincerest gratitude for all that they have done for me. I cannot begin to repay my parents for their sacrifices. I am eternally grateful for everything they have done. The support of my sisters and their encouragement gave me the strength to persevere to the end. iii Table of Contents LIST OF TABLES.......................................................................... vii LIST OF FIGURES ........................................................................ xiv ABSTRACT ................................................................................ xvii 1. A BRIEF INTRODUCTION TO GENE EXPRESSION............................. 1 1.1 Central Dogma of Molecular Biology........................................... 1 1.1.1 Basic Transfers .......................................................... 1 1.1.2 Uncommon Transfers ................................................... 3 1.2 Gene Expression ................................................................. 4 1.2.1 Estimating Gene Expression ............................................ 4 1.2.2 DNA Microarrays ......................................................