Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Home , ELL (gene), SNF8, VPS25, VPS36

Anti-VPS25 monoclonal antibody, clone T3 (DCABH-13967) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).

Immunogen VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG1

Source/Host Mouse

Species Reactivity Human

Clone T3

Conjugate Unconjugated

Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA

Sequence Similarities MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNN VKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT LYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Size 1 ea

Buffer In ascites fluid

Preservative None

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

GENE INFORMATION

Gene Name VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ]

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Synonyms VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae); vacuolar protein sorting 25 (yeast); vacuolar protein-sorting-associated protein 25; DERP9; EAP20; MGC10540; ESCRT-II complex subunit VPS25; ELL-associated protein of 20 kDa; dermal papilla-derived protein 9; FAP20;

Entrez Gene ID 84313

Protein Refseq NP_115729

UniProt ID A0A024R1X3

Chromosome Location 17q21.2

Pathway ESCRT-II complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]