Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-VPS25 monoclonal antibody, clone T3 (DCABH-13967) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]). Immunogen VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNN VKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT LYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol VPS25 Synonyms VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae); vacuolar protein sorting 25 (yeast); vacuolar protein-sorting-associated protein 25; DERP9; EAP20; MGC10540; ESCRT-II complex subunit VPS25; ELL-associated protein of 20 kDa; dermal papilla-derived protein 9; FAP20; Entrez Gene ID 84313 Protein Refseq NP_115729 UniProt ID A0A024R1X3 Chromosome Location 17q21.2 Pathway ESCRT-II complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Analysis of Gene Expression Data for Gene Ontology
ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION A Thesis Presented to The Graduate Faculty of The University of Akron In Partial Fulfillment of the Requirements for the Degree Master of Science Robert Daniel Macholan May 2011 ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION Robert Daniel Macholan Thesis Approved: Accepted: _______________________________ _______________________________ Advisor Department Chair Dr. Zhong-Hui Duan Dr. Chien-Chung Chan _______________________________ _______________________________ Committee Member Dean of the College Dr. Chien-Chung Chan Dr. Chand K. Midha _______________________________ _______________________________ Committee Member Dean of the Graduate School Dr. Yingcai Xiao Dr. George R. Newkome _______________________________ Date ii ABSTRACT A tremendous increase in genomic data has encouraged biologists to turn to bioinformatics in order to assist in its interpretation and processing. One of the present challenges that need to be overcome in order to understand this data more completely is the development of a reliable method to accurately predict the function of a protein from its genomic information. This study focuses on developing an effective algorithm for protein function prediction. The algorithm is based on proteins that have similar expression patterns. The similarity of the expression data is determined using a novel measure, the slope matrix. The slope matrix introduces a normalized method for the comparison of expression levels throughout a proteome. The algorithm is tested using real microarray gene expression data. Their functions are characterized using gene ontology annotations. The results of the case study indicate the protein function prediction algorithm developed is comparable to the prediction algorithms that are based on the annotations of homologous proteins.
[Show full text]
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice
University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia.
[Show full text]
Large Scale Organization of Chromatin
LARGE SCALE ORGANIZATION OF CHROMATIN MARIO Nicodemi Dip.to di Fisica, Uni.NA “Federico II”, INFN In the cell nucleus chromosomes have a complex architecture serving vital functional purposes. Problem: how is their 3D structure orchestrated? Our contribution: a model of the molecular mechanisms of their self- organization by use of classical polymer physics. (Mirò, Chiffres & Constellations 1941) Research collaborators MRC, Imperial College, London Ana Pombo,, Mita Chotalia, Ines de Santiago, Liron-Mark Lavitas, Sheila Xie, Kedar Natarajan, Carmelo Ferrai, Robert Beagrie, ... Biology, McGill, CA Josée Dostie, James Fraser Physics, Univ. di Napoli, Italy Mariano Barbieri, Ilaria Cataudella, Antonio Scialdone, Melania Barile, Paolo Casale, Valentino Bianco, Emanuela de Falco, Deborah Pallotti, Gaetano Pellegrino, Andrea Piccolo, ... Chromatin organization (I) (A) Linear expression units in compact genomes v.s. spatially assembled units in complex genomes. (B) Colocalization of coregulated genes. (C) ChromatinGene localization organizationat transcription factories (TFs). Example: the Xicʼs of the X Chromosome territories and map chrom.s colocalize at XCI (Heard et al.; Lee et al. ʻ07) Chromatin organizationNuclear scale (I) (A) Linear expression units in compact genomes v.s. spatially assembled units in complex genomes. (B) Colocalization of coregulated genes. (C) Gene localization at transcription factories (TFs). Colocalization of coregulated genes at transcription factories Example: the Xicʼs of the X Transcription chrom.s colocalize at XCI Factory (Heard et al.; Lee et al. ʻ07) (Pictures: Dekker et al. Science ʻ08) Distal regulatory elements Gene Gene Expression Units Assembly of expression units Gene scale (Pictures: Bolzer et al. PLoS Bio. ʼ05; Dekker et al. Science ʼ08) (Pictures: Dekker et al.
[Show full text]
Why Cells and Viruses Cannot Survive Without an ESCRT
cells Review Why Cells and Viruses Cannot Survive without an ESCRT Arianna Calistri * , Alberto Reale, Giorgio Palù and Cristina Parolin Department of Molecular Medicine, University of Padua, 35121 Padua, Italy; [email protected] (A.R.); [email protected] (G.P.); [email protected] (C.P.) * Correspondence: [email protected] Abstract: Intracellular organelles enwrapped in membranes along with a complex network of vesicles trafﬁcking in, out and inside the cellular environment are one of the main features of eukaryotic cells. Given their central role in cell life, compartmentalization and mechanisms allowing their maintenance despite continuous crosstalk among different organelles have been deeply investigated over the past years. Here, we review the multiple functions exerted by the endosomal sorting complex required for transport (ESCRT) machinery in driving membrane remodeling and ﬁssion, as well as in repairing physiological and pathological membrane damages. In this way, ESCRT machinery enables different fundamental cellular processes, such as cell cytokinesis, biogenesis of organelles and vesicles, maintenance of nuclear–cytoplasmic compartmentalization, endolysosomal activity. Furthermore, we discuss some examples of how viruses, as obligate intracellular parasites, have evolved to hijack the ESCRT machinery or part of it to execute/optimize their replication cycle/infection. A special emphasis is given to the herpes simplex virus type 1 (HSV-1) interaction with the ESCRT proteins, considering the peculiarities of this interplay and the need for HSV-1 to cross both the nuclear-cytoplasmic and the cytoplasmic-extracellular environment compartmentalization to egress from infected cells. Citation: Calistri, A.; Reale, A.; Palù, Keywords: ESCRT; viruses; cellular membranes; extracellular vesicles; HSV-1 G.; Parolin, C.
[Show full text]
Systems Consequences of Amplicon Formation in Human Breast Cancer
Downloaded from genome.cshlp.org on September 25, 2021 - Published by Cold Spring Harbor Laboratory Press Research Systems consequences of amplicon formation in human breast cancer Koichiro Inaki,1,2,9 Francesca Menghi,1,2,9 Xing Yi Woo,1,9 Joel P. Wagner,1,2,3 4,5 1 2 Pierre-Etienne Jacques, Yi Fang Lee, Phung Trang Shreckengast, Wendy WeiJia Soon,1 Ankit Malhotra,2 Audrey S.M. Teo,1 Axel M. Hillmer,1 Alexis Jiaying Khng,1 Xiaoan Ruan,6 Swee Hoe Ong,4 Denis Bertrand,4 Niranjan Nagarajan,4 R. Krishna Murthy Karuturi,4,7 Alfredo Hidalgo Miranda,8 andEdisonT.Liu1,2,7 1Cancer Therapeutics and Stratified Oncology, Genome Institute of Singapore, Genome, Singapore 138672, Singapore; 2The Jackson Laboratory for Genomic Medicine, Farmington, Connecticut 06030, USA; 3Department of Biological Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139, USA; 4Computational and Systems Biology, Genome Institute of Singapore, Genome, Singapore 138672, Singapore; 5Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1, Canada; 6Genome Technology and Biology, Genome Institute of Singapore, Genome, Singapore 138672, Singapore; 7The Jackson Laboratory, Bar Harbor, Maine 04609, USA; 8National Institute of Genomic Medicine, Periferico Sur 4124, Mexico City 01900, Mexico Chromosomal structural variations play an important role in determining the transcriptional landscape of human breast cancers. To assess the nature of these structural variations, we analyzed eight breast tumor samples with a focus on regions of gene amplification using mate-pair sequencing of long-insert genomic DNA with matched transcriptome profiling. We found that tandem duplications appear to be early events in tumor evolution, especially in the genesis of amplicons.
[Show full text]
Structure-To-Function Computational Prediction of a Subset of Ribosomal Proteins for the Small Ribosome Subunit
International Journal of Bioscience, Biochemistry and Bioinformatics Structure-to-Function Computational Prediction of a Subset of Ribosomal Proteins for the Small Ribosome Subunit Edmund Ui-Hang Sim*, Chin-Ming Er Department of Molecular Biology, Faculty of Resource Science and Technology, Universiti Malaysia Sarawak, Kota Samarahan, Sarawak, Malaysia. * Corresponding author. Tel.: +60-82-583041; email: [email protected] Manuscript submitted July 18, 2014; accepted January 28, 2015. doi: 10.17706/ijbbb.2015.5.2.100-110 Abstract: Extra-ribosomal functions of ribosomal proteins have been widely accepted albeit an incomplete understanding of these roles. Standard experimental studies have limited usefulness in defining the complete biological significance of ribosomal proteins. An alternative strategy is via in silico analysis. Here, we sought a sequence-to-structure-to-function approach to computationally predict the extra-ribosomal functions of a subset of ribosomal proteins of the small ribosome subunit, namely RPS12, RPS19, RPS20 and RPS24. Three-dimensional structure constructed from amino acid sequence was precisely matched with structural neighbours to extrapolate possible functions. Our analysis reveals new logical roles for these ribosomal proteins, of which represent important information for planning experimental and further in silico studies to elucidate their physiological roles. Key words: Extra-ribosomal functions, RPS12, RPS19, RPS20, RPS24, structural neighbours, 3D modelling. 1. Introduction Ribosomal proteins (RPs) are originally construed as only essential components of the ribosomes involved in protein biosynthesis. However, since the 1990s, their extra-ribosomal roles have been discussed revealing their association with congenital diseases and a wide range of cancers [1], [2]. For instance, over-expression of RPS12 has been observed in the tissues of colon adenocarcinomas and adenomatous polyps [3], squamous cell carcinoma of the human uterine cervix [4], and gastric cancer [5].
[Show full text]
Vacuolar-Sorting Protein SNF8 (1-258, His-Tag) Human Protein Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AR50418PU-S Vacuolar-sorting protein SNF8 (1-258, His-tag) Human Protein Product data: Product Type: Recombinant Proteins Description: Vacuolar-sorting protein SNF8 (1-258, His-tag) human recombinant protein, 0.1 mg Species: Human Expression Host: E. coli Tag: His-tag Predicted MW: 31.4 kDa Concentration: lot specific Purity: >90% by SDS - PAGE Buffer: Presentation State: Purified State: Liquid purified protein Buffer System: 20 mM Tris-HCl buffer, pH8.0, 50% glycerol, 2mM DTT, 200mM NaCl Preparation: Liquid purified protein Protein Description: Recombinant human SNF8 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques. Storage: Store undiluted at 2-8°C for one week or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Stability: Shelf life: one year from despatch. RefSeq: NP_001304121 Locus ID: 11267 UniProt ID: Q96H20 Cytogenetics: 17q21.32 Synonyms: Dot3; EAP30; VPS22 Summary: The protein encoded by this gene is a component of the endosomal sorting complex required for transport II (ESCRT-II), which regulates the movement of ubiquitinylated transmembrane proteins to the lysosome for degradation. This complex also interacts with the RNA polymerase II elongation factor (ELL) to overcome the repressive effects of ELL on RNA polymerase II activity. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] This product is to be used for laboratory only.
[Show full text]
Endosome-Associated Complex, ESCRT-II, Recruits Transport Machinery for Protein Sorting at the Multivesicular Body
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Developmental Cell, Vol. 3, 283–289, August, 2002, Copyright 2002 by Cell Press Endosome-Associated Complex, ESCRT-II, Recruits Transport Machinery for Protein Sorting at the Multivesicular Body Markus Babst,2,4 David J. Katzmann,4 plays a critical role in the sorting of multiple cargo pro- William B. Snyder,2 Beverly Wendland,3 teins within the endosomal membrane system. and Scott D. Emr1 In a recent study, it has been demonstrated that sort- Department of Cellular and Molecular Medicine and ing of the yeast hydrolase carboxypeptidase S (CPS) Howard Hughes Medical Institute into the MVB pathway requires monoubiquitination of School of Medicine the short cytoplasmic tail of the protein (Katzmann et University of California, San Diego al., 2001). Mutations in CPS that block this ubiquitin La Jolla, California 92093 modification result in mislocalization of the protein to the limiting membrane of the vacuole. Furthermore, a protein complex called ESCRT-I (endosomal sorting complex required for transport) binds to ubiquitinated Summary CPS and thereby directs sorting of the hydrolase into the MVB pathway (Katzmann et al., 2001). ESCRT-I is Sorting of ubiquitinated endosomal membrane pro- composed of three different protein subunits (Vps23, teins into the MVB pathway is executed by the class Vps28, and Vps37) which belong to the class E vacuolar E Vps protein complexes ESCRT-I, -II, and -III, and protein sorting (Vps) proteins, a group of 15 proteins the AAA-type ATPase Vps4. This study characterizes required for proper endosomal function, including the ف ESCRT-II, a soluble 155 kDa protein complex formed formation of MVBs (Odorizzi et al., 1998).
[Show full text]
Bioinformatics: a Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D
BIOINFORMATICS A Practical Guide to the Analysis of Genes and Proteins SECOND EDITION Andreas D. Baxevanis Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland USA B. F. Francis Ouellette Centre for Molecular Medicine and Therapeutics Children’s and Women’s Health Centre of British Columbia University of British Columbia Vancouver, British Columbia Canada A JOHN WILEY & SONS, INC., PUBLICATION New York • Chichester • Weinheim • Brisbane • Singapore • Toronto BIOINFORMATICS SECOND EDITION METHODS OF BIOCHEMICAL ANALYSIS Volume 43 BIOINFORMATICS A Practical Guide to the Analysis of Genes and Proteins SECOND EDITION Andreas D. Baxevanis Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland USA B. F. Francis Ouellette Centre for Molecular Medicine and Therapeutics Children’s and Women’s Health Centre of British Columbia University of British Columbia Vancouver, British Columbia Canada A JOHN WILEY & SONS, INC., PUBLICATION New York • Chichester • Weinheim • Brisbane • Singapore • Toronto Designations used by companies to distinguish their products are often claimed as trademarks. In all instances where John Wiley & Sons, Inc., is aware of a claim, the product names appear in initial capital or ALL CAPITAL LETTERS. Readers, however, should contact the appropriate companies for more complete information regarding trademarks and registration. Copyright ᭧ 2001 by John Wiley & Sons, Inc. All rights reserved. No part of this publication may be reproduced, stored in a retrieval system or transmitted in any form or by any means, electronic or mechanical, including uploading, downloading, printing, decompiling, recording or otherwise, except as permitted under Sections 107 or 108 of the 1976 United States Copyright Act, without the prior written permission of the Publisher.
[Show full text]
Identification of Novel Dna Damage Response Genes Using Functional Genomics
IDENTIFICATION OF NOVEL DNA DAMAGE RESPONSE GENES USING FUNCTIONAL GENOMICS by Michael Chang A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Graduate Department of Biochemistry University of Toronto © Copyright by Michael Chang (2005) Identification of novel DNA damage response genes using functional genomics Doctor of Philosophy, 2005; Michael Chang; Department of Biochemistry, University of Toronto ABSTRACT The genetic information required for life is stored within molecules of DNA. This DNA is under constant attack as a result of normal cellular metabolic processes, as well as exposure to genotoxic agents. DNA damage left unrepaired can result in mutations that alter the genetic information encoded within DNA. Cells have consequently evolved complex pathways to combat damage to their DNA. Defects in the cellular response to DNA damage can result in genomic instability, a hallmark of cancer cells. Identifying all the components required for this response remains an important step in fully elucidating the molecular mechanisms involved. I used functional genomic approaches to identify genes required for the DNA damage response in Saccharomyces cerevisiae. I conducted a screen to identify genes required for resistance to a DNA damaging agent, methyl methanesulfonate, and identified several poorly characterized genes that are necessary for proper S phase progression in the presence of DNA damage. Among the genes identified, ESC4/RTT107 has since been shown to be essential for the resumption of DNA replication after DNA damage. Using genome-wide genetic interaction screens to identify genes that are required for viability in the absence of MUS81 and MMS4, two genes required for resistance to DNA damage, I helped identify ELG1, deletion of which causes DNA replication defects, genomic instability, and an inability to properly recover from DNA damage during S phase.
[Show full text]
Rare KMT2A-ELL and Novel ZNF56
CANCER GENOMICS & PROTEOMICS 18 : 121-131 (2021) doi:10.21873/cgp.20247 Rare KMT2A-ELL and Novel ZNF56-KMT2A Fusion Genes in Pediatric T-cell Acute Lymphoblastic Leukemia IOANNIS PANAGOPOULOS 1, KRISTIN ANDERSEN 1, MARTINE EILERT-OLSEN 1, ANNE GRO ROGNLIEN 2, MONICA CHENG MUNTHE-KAAS 2, FRANCESCA MICCI 1 and SVERRE HEIM 1,3 1Section for Cancer Cytogenetics, Institute for Cancer Genetics and Informatics, The Norwegian Radium Hospital, Oslo University Hospital, Oslo, Norway; 2Department of Pediatric Hematology and Oncology, Oslo University Hospital Rikshospitalet, Oslo, Norway; 3Institute of Clinical Medicine, Faculty of Medicine, University of Oslo, Oslo, Norway Abstract. Background/Aim: Previous reports have associated which could be distinguished by fluorescence in situ the KMT2A-ELL fusion gene, generated by t(11;19)(q23;p13.1), hybridization (FISH) (2, 3). Breakpoints within sub-band with acute myeloid leukemia (AML). We herein report a 19p13.3 have been found in both ALL (primarily in infants KMT2A-ELL and a novel ZNF56-KMT2A fusion genes in a and children) and AML. The translocation t(11;19)(q23;p13.3) pediatric T-lineage acute lymphoblastic leukemia (T-ALL). leads to fusion of the histone-lysine N-methyltransferase 2A Materials and Methods: Genetic investigations were performed (KMT2A; also known as myeloid/lymphoid or mixed lineage on bone marrow of a 13-year-old boy diagnosed with T-ALL. leukemia, MLL ) gene in 11q23 with the MLLT1 super Results: A KMT2A-ELL and a novel ZNF56-KMT2A fusion elongation complex subunit MLLT1 gene (also known as ENL, genes were generated on der(11)t(11;19)(q23;p13.1) and LTG19 , and YEATS1 ) in 19p13.3 generating a KMT2A-MLLT1 der(19)t(11;19)(q23;p13.1), respectively.
[Show full text]