Bioinformatics: a Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Gene Mapping Techniques
Developmental Neurobiology, edited by Philippe Evrard and Alexandre Minkowski. Nestle Nutrition Workshop Series, Vol. 12. Nestec Ltd., Vevey/Raven Press, Ltd., New York © 1989. Gene Mapping Techniques Jean-Louis Guenet Institut Pasteur, 75724 Paris Cedex 15, France Very accurate gene mapping is essential in both man and laboratory mammals (1- 3). Several techniques have been used over the last 50 years to localize mammalian genes on the chromosomes of a given species. This chapter reviews these tech- niques, with special emphasis on the most recent ones that represent a true break- through in formal genetics. CLASSICAL GENE MAPPING TECHNIQUES AND THEIR LIMITATIONS When two genes are linked they have a tendency to cosegregate during successive generations. The closer the linkage, the more absolute is the cosegregation. This is the fundamental principle of gene mapping, which has been successfully applied to all species, including plants, over many years. In mammals such as humans and mice, the continued discovery of marker genes scattered throughout the genome has facilitated the mapping of new genes so that we now possess for these two species, particularly the mouse, linkage maps that are far more detailed than those existing for other mammals. In the mouse, special matings can be set up, with appropriate stocks, to test for possible autosomal linkage after two successive reproductive rounds: In general, cross-back crosses are used, cross-intercrosses being reserved for studies in which the viability or the fertility of the homozygous mutant under study is impaired. In humans investigations concerning linkage are based on pedigree analysis. In other words, for both species it is essential to define as a starting point a situa- tion where two genes are heterozygous and either in repulsion A + / + B or in cou- pling AB/ + +, then to look for changes in this configuration after a reproductive cycle (forms in coupling giving rise to forms in repulsion and vice versa), and fi- nally to count the percentage or frequency of these recombination events. -
T-Coffee Documentation Release Version 13.45.47.Aba98c5
T-Coffee Documentation Release Version_13.45.47.aba98c5 Cedric Notredame Aug 31, 2021 Contents 1 T-Coffee Installation 3 1.1 Installation................................................3 1.1.1 Unix/Linux Binaries......................................4 1.1.2 MacOS Binaries - Updated...................................4 1.1.3 Installation From Source/Binaries downloader (Mac OSX/Linux)...............4 1.2 Template based modes: PSI/TM-Coffee and Expresso.........................5 1.2.1 Why do I need BLAST with T-Coffee?.............................6 1.2.2 Using a BLAST local version on Unix.............................6 1.2.3 Using the EBI BLAST client..................................6 1.2.4 Using the NCBI BLAST client.................................7 1.2.5 Using another client.......................................7 1.3 Troubleshooting.............................................7 1.3.1 Third party packages......................................7 1.3.2 M-Coffee parameters......................................9 1.3.3 Structural modes (using PDB)................................. 10 1.3.4 R-Coffee associated packages................................. 10 2 Quick Start Regressive Algorithm 11 2.1 Introduction............................................... 11 2.2 Installation from source......................................... 12 2.3 Examples................................................. 12 2.3.1 Fast and accurate........................................ 12 2.3.2 Slower and more accurate.................................... 12 2.3.3 Very Fast........................................... -
Functional Aspects and Genomic Analysis
Discussion IV./ Discussion IV.1. The discovery of UEV protein and its role in different cellular processes In our studies of cell differentiation and cell cycle control, we have isolated a new gene that is downregulated upon cell differentiation. We have demonstrated that this gene, previously called CROC1 and considered a transcriptional activator of c-fos (Rothofsky and Lin, 1997), is highly conserved in phylogeny, and constitutes, by sequence relationship, a novel subfamily of the ubiquitin-conjugating, or E2, enzymes. We have demonstrated that these proteins are very conserved in all eukaryotic organisms and that they are very similar to the E2 enzymes in sequence and structure, but these proteins lack a conserved cysteine residue responsible for the catalytic activity of the E2 enzymes (Chen et al., 1993; Jentsch, 1992a). We have given these proteins the name UEV (ubiquitin-conjugating E2 enzyme variant). Work by other laboratories has shown that experimental mutagenesis of this cysteine in the catalytic center leads to the inactivation of the E2 enzyme activity, and the mutated protein can behave as a dominant negative variant (Banerjee et al., 1995; Sung et al., 1990; Madura et al., 1993). However, in our initial experiments with recombinant proteins, UEV did not behave as a negative regulator of ubiquitination (Sancho et al., 1998). We have demonstrated also the existence of at least two different human UEV genes, one coding for UEV1/CROC-1, and the other coding for UEV2. The second protein has also been given different names by others, DDVit-1 (Fritsche et al., 1997). 30 Discussion The transcripts from the two human UEV genes differ in their 3’untranslated regions, and produce almost identical proteins. -
Bioinformatics 1
Bioinformatics 1 Bioinformatics School School of Science, Engineering and Technology (http://www.stmarytx.edu/set/) School Dean Ian P. Martines, Ph.D. ([email protected]) Department Biological Science (https://www.stmarytx.edu/academics/set/undergraduate/biological-sciences/) Bioinformatics is an interdisciplinary and growing field in science for solving biological, biomedical and biochemical problems with the help of computer science, mathematics and information technology. Bioinformaticians are in high demand not only in research, but also in academia because few people have the education and skills to fill available positions. The Bioinformatics program at St. Mary’s University prepares students for graduate school, medical school or entry into the field. Bioinformatics is highly applicable to all branches of life sciences and also to fields like personalized medicine and pharmacogenomics — the study of how genes affect a person’s response to drugs. The Bachelor of Science in Bioinformatics offers three tracks that students can choose. • Bachelor of Science in Bioinformatics with a minor in Biology: 120 credit hours • Bachelor of Science in Bioinformatics with a minor in Computer Science: 120 credit hours • Bachelor of Science in Bioinformatics with a minor in Applied Mathematics: 120 credit hours Students will take 23 credit hours of core Bioinformatics classes, which included three credit hours of internship or research and three credit hours of a Bioinformatics Capstone course. BS Bioinformatics Tracks • Bachelor of Science -
13 Genomics and Bioinformatics
Enderle / Introduction to Biomedical Engineering 2nd ed. Final Proof 5.2.2005 11:58am page 799 13 GENOMICS AND BIOINFORMATICS Spencer Muse, PhD Chapter Contents 13.1 Introduction 13.1.1 The Central Dogma: DNA to RNA to Protein 13.2 Core Laboratory Technologies 13.2.1 Gene Sequencing 13.2.2 Whole Genome Sequencing 13.2.3 Gene Expression 13.2.4 Polymorphisms 13.3 Core Bioinformatics Technologies 13.3.1 Genomics Databases 13.3.2 Sequence Alignment 13.3.3 Database Searching 13.3.4 Hidden Markov Models 13.3.5 Gene Prediction 13.3.6 Functional Annotation 13.3.7 Identifying Differentially Expressed Genes 13.3.8 Clustering Genes with Shared Expression Patterns 13.4 Conclusion Exercises Suggested Reading At the conclusion of this chapter, the reader will be able to: & Discuss the basic principles of molecular biology regarding genome science. & Describe the major types of data involved in genome projects, including technologies for collecting them. 799 Enderle / Introduction to Biomedical Engineering 2nd ed. Final Proof 5.2.2005 11:58am page 800 800 CHAPTER 13 GENOMICS AND BIOINFORMATICS & Describe practical applications and uses of genomic data. & Understand the major topics in the field of bioinformatics and DNA sequence analysis. & Use key bioinformatics databases and web resources. 13.1 INTRODUCTION In April 2003, sequencing of all three billion nucleotides in the human genome was declared complete. This landmark of modern science brought with it high hopes for the understanding and treatment of human genetic disorders. There is plenty of evidence to suggest that the hopes will become reality—1631 human genetic diseases are now associated with known DNA sequences, compared to the less than 100 that were known at the initiation of the Human Genome Project (HGP) in 1990. -
Use of Bioinformatics Resources and Tools by Users of Bioinformatics Centers in India Meera Yadav University of Delhi, [email protected]
University of Nebraska - Lincoln DigitalCommons@University of Nebraska - Lincoln Library Philosophy and Practice (e-journal) Libraries at University of Nebraska-Lincoln 2015 Use of Bioinformatics Resources and Tools by Users of Bioinformatics Centers in India meera yadav University of Delhi, [email protected] Manlunching Tawmbing Saha Institute of Nuclear Physisc, [email protected] Follow this and additional works at: http://digitalcommons.unl.edu/libphilprac Part of the Library and Information Science Commons yadav, meera and Tawmbing, Manlunching, "Use of Bioinformatics Resources and Tools by Users of Bioinformatics Centers in India" (2015). Library Philosophy and Practice (e-journal). 1254. http://digitalcommons.unl.edu/libphilprac/1254 Use of Bioinformatics Resources and Tools by Users of Bioinformatics Centers in India Dr Meera, Manlunching Department of Library and Information Science, University of Delhi, India [email protected], [email protected] Abstract Information plays a vital role in Bioinformatics to achieve the existing Bioinformatics information technologies. Librarians have to identify the information needs, uses and problems faced to meet the needs and requirements of the Bioinformatics users. The paper analyses the response of 315 Bioinformatics users of 15 Bioinformatics centers in India. The papers analyze the data with respect to use of different Bioinformatics databases and tools used by scholars and scientists, areas of major research in Bioinformatics, Major research project, thrust areas of research and use of different resources by the user. The study identifies the various Bioinformatics services and resources used by the Bioinformatics researchers. Keywords: Informaion services, Users, Inforamtion needs, Bioinformatics resources 1. Introduction ‘Needs’ refer to lack of self-sufficiency and also represent gaps in the present knowledge of the users. -
Genetic Mapping and Manipulation: Chapter 2-Two-Point Mapping with Genetic Markers* §
Genetic mapping and manipulation: Chapter 2-Two-point mapping with genetic markers* § David Fay , Department of Molecular Biology, University of Wyoming, Laramie, Wyoming 82071-3944 USA Table of Contents 1. The basics ..............................................................................................................................1 2. Calculating map distances ......................................................................................................... 3 3. Other considerations ................................................................................................................. 5 4. References ..............................................................................................................................6 1. The basics The basics. Two-point mapping, wherein a mutation in the gene of interest is mapped against a marker mutation, is primarily used to assign mutations to individual chromosomes. It can also give at least a rough indication of distance between the mutation and the markers used. On the surface, the concept of two-point mapping to determine chromosomal linkage is relatively straightforward. It can, however, be the source of some confusion when it comes to processing the actual data based on phenotypic frequencies to accurately determine genetic distances. It is also worth noting that most researchers don't bother much with exhaustive two-point mapping anymore. Once we've assigned our mutation to a linkage group, it's generally off to the races with three-point and SNP mapping -
How to Generate a Publication-Quality Multiple Sequence Alignment (Thomas Weimbs, University of California Santa Barbara, 11/2012)
Tutorial: How to generate a publication-quality multiple sequence alignment (Thomas Weimbs, University of California Santa Barbara, 11/2012) 1) Get your sequences in FASTA format: • Go to the NCBI website; find your sequences and display them in FASTA format. Each sequence should look like this (http://www.ncbi.nlm.nih.gov/protein/6678177?report=fasta): >gi|6678177|ref|NP_033320.1| syntaxin-4 [Mus musculus] MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTIL ATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINK CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI QQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICV SVTVLILAVIIGITITVG 2) In a text editor, paste all your sequences together (in the order that you would like them to appear in the end). It should look like this: >gi|6678177|ref|NP_033320.1| syntaxin-4 [Mus musculus] MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTIL ATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINK CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI QQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICV SVTVLILAVIIGITITVG >gi|151554658|gb|AAI47965.1| STX3 protein [Bos taurus] MKDRLEQLKAKQLTQDDDTDEVEIAVDNTAFMDEFFSEIEETRVNIDKISEHVEEAKRLYSVILSAPIPE PKTKDDLEQLTTEIKKRANNVRNKLKSMERHIEEDEVQSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKAREETKRAVKYQGQARKKLVIIIVIVVVLLGILAL IIGLSVGLK -
The ELIXIR Core Data Resources: Fundamental Infrastructure for The
Supplementary Data: The ELIXIR Core Data Resources: fundamental infrastructure for the life sciences The “Supporting Material” referred to within this Supplementary Data can be found in the Supporting.Material.CDR.infrastructure file, DOI: 10.5281/zenodo.2625247 (https://zenodo.org/record/2625247). Figure 1. Scale of the Core Data Resources Table S1. Data from which Figure 1 is derived: Year 2013 2014 2015 2016 2017 Data entries 765881651 997794559 1726529931 1853429002 2715599247 Monthly user/IP addresses 1700660 2109586 2413724 2502617 2867265 FTEs 270 292.65 295.65 289.7 311.2 Figure 1 includes data from the following Core Data Resources: ArrayExpress, BRENDA, CATH, ChEBI, ChEMBL, EGA, ENA, Ensembl, Ensembl Genomes, EuropePMC, HPA, IntAct /MINT , InterPro, PDBe, PRIDE, SILVA, STRING, UniProt ● Note that Ensembl’s compute infrastructure physically relocated in 2016, so “Users/IP address” data are not available for that year. In this case, the 2015 numbers were rolled forward to 2016. ● Note that STRING makes only minor releases in 2014 and 2016, in that the interactions are re-computed, but the number of “Data entries” remains unchanged. The major releases that change the number of “Data entries” happened in 2013 and 2015. So, for “Data entries” , the number for 2013 was rolled forward to 2014, and the number for 2015 was rolled forward to 2016. The ELIXIR Core Data Resources: fundamental infrastructure for the life sciences 1 Figure 2: Usage of Core Data Resources in research The following steps were taken: 1. API calls were run on open access full text articles in Europe PMC to identify articles that mention Core Data Resource by name or include specific data record accession numbers. -
Bioinformatics Study of Lectins: New Classification and Prediction In
Bioinformatics study of lectins : new classification and prediction in genomes François Bonnardel To cite this version: François Bonnardel. Bioinformatics study of lectins : new classification and prediction in genomes. Structural Biology [q-bio.BM]. Université Grenoble Alpes [2020-..]; Université de Genève, 2021. En- glish. NNT : 2021GRALV010. tel-03331649 HAL Id: tel-03331649 https://tel.archives-ouvertes.fr/tel-03331649 Submitted on 2 Sep 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. THÈSE Pour obtenir le grade de DOCTEUR DE L’UNIVERSITE GRENOBLE ALPES préparée dans le cadre d’une cotutelle entre la Communauté Université Grenoble Alpes et l’Université de Genève Spécialités: Chimie Biologie Arrêté ministériel : le 6 janvier 2005 – 25 mai 2016 Présentée par François Bonnardel Thèse dirigée par la Dr. Anne Imberty codirigée par la Dr/Prof. Frédérique Lisacek préparée au sein du laboratoire CERMAV, CNRS et du Computer Science Department, UNIGE et de l’équipe PIG, SIB Dans les Écoles Doctorales EDCSV et UNIGE Etude bioinformatique des lectines: nouvelle classification et prédiction dans les génomes Thèse soutenue publiquement le 8 Février 2021, devant le jury composé de : Dr. Alexandre de Brevern UMR S1134, Inserm, Université Paris Diderot, Paris, France, Rapporteur Dr. -
Toolboxes for a Standardised and Systematic Study of Glycans
Campbell et al. BMC Bioinformatics 2014, 15(Suppl 1):S9 http://www.biomedcentral.com/1471-2105/15/S1/S9 RESEARCH Open Access Toolboxes for a standardised and systematic study of glycans Matthew P Campbell1, René Ranzinger2, Thomas Lütteke3, Julien Mariethoz4, Catherine A Hayes5, Jingyu Zhang1, Yukie Akune6, Kiyoko F Aoki-Kinoshita6, David Damerell7,11, Giorgio Carta8, Will S York2, Stuart M Haslam7, Hisashi Narimatsu9, Pauline M Rudd8, Niclas G Karlsson4, Nicolle H Packer1, Frédérique Lisacek4,10* From Integrated Bio-Search: 12th International Workshop on Network Tools and Applications in Biology (NETTAB 2012) Como, Italy. 14-16 November 2012 Abstract Background: Recent progress in method development for characterising the branched structures of complex carbohydrates has now enabled higher throughput technology. Automation of structure analysis then calls for software development since adding meaning to large data collections in reasonable time requires corresponding bioinformatics methods and tools. Current glycobioinformatics resources do cover information on the structure and function of glycans, their interaction with proteins or their enzymatic synthesis. However, this information is partial, scattered and often difficult to find to for non-glycobiologists. Methods: Following our diagnosis of the causes of the slow development of glycobioinformatics, we review the “objective” difficulties encountered in defining adequate formats for representing complex entities and developing efficient analysis software. Results: Various solutions already implemented and strategies defined to bridge glycobiology with different fields and integrate the heterogeneous glyco-related information are presented. Conclusions: Despite the initial stage of our integrative efforts, this paper highlights the rapid expansion of glycomics, the validity of existing resources and the bright future of glycobioinformatics. -
Life with 6000 Genes Author(S): A. Goffeau, B. G. Barrell, H. Bussey, R
Life with 6000 Genes Author(s): A. Goffeau, B. G. Barrell, H. Bussey, R. W. Davis, B. Dujon, H. Feldmann, F. Galibert, J. D. Hoheisel, C. Jacq, M. Johnston, E. J. Louis, H. W. Mewes, Y. Murakami, P. Philippsen, H. Tettelin and S. G. Oliver Source: Science, Vol. 274, No. 5287, Genome Issue (Oct. 25, 1996), pp. 546+563-567 Published by: American Association for the Advancement of Science Stable URL: https://www.jstor.org/stable/2899628 Accessed: 28-08-2019 13:31 UTC REFERENCES Linked references are available on JSTOR for this article: https://www.jstor.org/stable/2899628?seq=1&cid=pdf-reference#references_tab_contents You may need to log in to JSTOR to access the linked references. JSTOR is a not-for-profit service that helps scholars, researchers, and students discover, use, and build upon a wide range of content in a trusted digital archive. We use information technology and tools to increase productivity and facilitate new forms of scholarship. For more information about JSTOR, please contact [email protected]. Your use of the JSTOR archive indicates your acceptance of the Terms & Conditions of Use, available at https://about.jstor.org/terms American Association for the Advancement of Science is collaborating with JSTOR to digitize, preserve and extend access to Science This content downloaded from 152.3.43.41 on Wed, 28 Aug 2019 13:31:29 UTC All use subject to https://about.jstor.org/terms by FISH across the whole genome. A subset of the 37. G. D. Billingsleyet al., Am. J. Hum. Genet. 52, 343 (1994); L.