Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-VPS25 monoclonal antibody, clone T3 (DCABH-13967) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]). Immunogen VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNN VKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT LYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol VPS25 Synonyms VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae); vacuolar protein sorting 25 (yeast); vacuolar protein-sorting-associated protein 25; DERP9; EAP20; MGC10540; ESCRT-II complex subunit VPS25; ELL-associated protein of 20 kDa; dermal papilla-derived protein 9; FAP20; Entrez Gene ID 84313 Protein Refseq NP_115729 UniProt ID A0A024R1X3 Chromosome Location 17q21.2 Pathway ESCRT-II complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us