Genome-Wide Rnai Screen Reveals a Role for the ESCRT Complex in Rotavirus Cell Entry

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Genome-wide RNAi screen reveals a role for the ESCRT complex in rotavirus cell entry Daniela Silva-Ayalaa, Tomás Lópeza, Michelle Gutiérreza, Norbert Perrimonb, Susana Lópeza, and Carlos F. Ariasa,1 aDepartamento de Genética del Desarrollo y Fisiología Molecular, Instituto de Biotecnología, Universidad Nacional Autónoma de México, Colonia Chamilpa, Cuernavaca, Morelos 62210, Mexico; and bDepartment of Genetics, Howard Hughes Medical Institute, Harvard Medical School, Boston, MA 02115 Edited by Mary K. Estes, Baylor College of Medicine, Houston, TX, and approved May 3, 2013 (received for review March 14, 2013) Rotavirus (RV) is the major cause of childhood gastroenteritis described that the VP8 protein of human RV strain HAL1166 worldwide. This study presents a functional genome-scale analysis and the human RV strains belonging to the most frequent VP4 of cellular proteins and pathways relevant for RV infection using genotypes (P4 and P8) bind to A-type histo-blood group antigens RNAi. Among the 522 proteins selected in the screen for their (5, 6). Integrin 2β1 has also been reported to serve as an attach- ability to affect viral infectivity, an enriched group that partic- ment receptor for some RV strains (7), although this integrin, as ipates in endocytic processes was identified. Within these pro- well as integrins vβ3 and xβ2 and the heat-shock protein 70 teins, subunits of the vacuolar ATPase, small GTPases, actinin 4, (HSC70), have been implicated mostly in a postattachment in- and, of special interest, components of the endosomal sorting teraction of the virus that might be involved in cell internalization complex required for transport (ESCRT) machinery were found. (7). Nevertheless, RV strains whose infectivity does not depend Here we provide evidence for a role of the ESCRT complex in the on integrins have also been reported. RRV enters cells by an entry of simian and human RV strains in both monkey and human endocytic pathway that is independent of clathrin and caveolin, epithelial cells. In addition, the ESCRT-associated ATPase VPS4A whereas other RV strains have been shown to enter cells through and phospholipid lysobisphosphatidic acid, both crucial for the a clathrin-dependent endocytosis (8). It has also been reported formation of intralumenal vesicles in multivesicular bodies, were that RV cell entry depends on dynamin and cholesterol (8), al- also found to be required for cell entry. Interestingly, it seems that though contradicting results were recently reported in Madin regardless of the molecules that rhesus RV and human RV strains Darby canine kidney cells (9). RRV infection of monkey kidney use for cell-surface attachment and the distinct endocytic pathway MA104 cells has been shown to depend on the small GTPase used, all these viruses converge in early endosomes and use multi- RAB5, but not on RAB4 or RAB7 (10). The interaction of the vesicular bodies for cell entry. Furthermore, the small GTPases RV spike protein VP4 with surface receptors determines the RHOA and CDC42, which regulate different types of clathrin-inde- endocytic pathway used by RVs to enter cells (11). This protein pendent endocytosis, as well as early endosomal antigen 1 (EEA1), has also been proposed to undergo structural changes during the were found to be involved in this process. This work reports the entry process (9, 12); nonetheless, a functional correlation of the direct involvement of the ESCRT machinery in the life cycle of proposed structural changes with cellular factors that trigger a nonenveloped virus and highlights the complex mechanism that these changes is not known. Recently, several studies have reported the use of genome- these viruses use to enter cells. It also illustrates the efficiency of wide RNAi screens to unravel virus–host cell interactions (13). high-throughput RNAi screenings as genetic tools for comprehen- We recently developed a robust high-throughput screening assay sively studying the interaction between viruses and their host cells. to assess RV replication in cell culture (14). In this study we report a genome-wide siRNA screen that allowed us to identify otaviruses (RVs), members of the family Reoviridae, are the more than 500 proteins and several biological processes poten- Rleading etiologic agents of viral gastroenteritis in infants and tially involved in various steps of the RV life cycle. Of particular young children worldwide, being responsible for an estimated interest, the endosomal sorting complex required for transport 453,000 deaths each year (1). The infectious particle is composed (ESCRT) complex, a major pathway for the lysosomal degra- of three concentric layers of protein that enclose the viral ge- dation of monoubiquitinated membrane proteins (15) and also nome formed by 11 segments of double-stranded RNA. The involved in the abscission step of cytokinesis and in the budding proteins of the outermost layer, VP4 and VP7, are involved in process of several enveloped viruses, was found to be involved in virus attachment and cell entry. Two domains constitute the RV cell entry. This report describes the use of the ESCRT spike protein VP4: VP5 at the base of the spike and VP8 at the complex by a nonenveloped virus and highlights the complex head. Once inside the cell, the triple-layered particle (TLP) loses mechanism that RVs use to enter cells. the surface proteins, leading to a double-layered particle (DLP) that is transcriptionally active. The nascent viral mRNAs can be Results used either for viral protein synthesis or for genome replication. Identification of Cellular Proteins Required for RV Infection Using Newly formed progeny DLPs assemble in cytoplasmic inclusions a Genome-Wide siRNA Screen. The assay involved RRV infection known as viroplasms and bud into the lumen of the ER. The of MA104 (Cercopithecus aethiops) cells previously transfected outer-layer proteins then assemble on DLPs in this compartment with an siRNA library that targets 21,181 individual human genes, (2). It has been recently reported, however, that RV hijacks the followed by evaluation of virus replication by an optimized im- autophagy membrane-trafficking pathway to transport the ER- munofluorescent detection of viral protein synthesis (14). The associated viral proteins required for infectious particle assembly to membranes surrounding viroplasms (3). fi Even though speci c steps of entry have been increasingly well Author contributions: D.S.-A., T.L., M.G., N.P., S.L., and C.F.A. designed research; D.S.-A., characterized in recent years, the involvement of host-cell pro- T.L., and M.G. performed research; N.P. contributed new reagents/analytic tools; D.S.-A., teins in the replication life cycle of the virus has been poorly T.L., M.G., N.P., S.L., and C.F.A. analyzed data; and D.S.-A., T.L., and C.F.A. wrote characterized. The initial interactions of the virus with the cell the paper. surface involve several molecules. Specifically, some RV strains The authors declare no conflict of interest. such as rhesus RV (RRV), initially bind to sialic acid on the cell This article is a PNAS Direct Submission. surface through the VP8 domain of the spike protein VP4, but 1To whom correspondence should be addressed. E-mail: [email protected]. some RVs appear to attach to subterminal sialic acid, such as This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. that present in ganglioside GM1 (4); in addition, it was recently 1073/pnas.1304932110/-/DCSupplemental. 10270–10275 | PNAS | June 18, 2013 | vol. 110 | no. 25 www.pnas.org/cgi/doi/10.1073/pnas.1304932110 Downloaded by guest on September 23, 2021 screening was performed in two steps (Fig. S1A and Materials A B and Methods 100 ). Using this experimental design, 522 genes whose TLPs DLPs 100 expression is required for RV infection were identified (Table * S1). Analysis of the data by functional clustering showed that the 75 75 genes that scored as positives are implicated in a broad array of 50 50 ** ** cellular functions and also suggested several statistically enriched ** ** ** ** 25 25 biological pathways that could be involved in the virus life cycle *** fi (Table S2). Among the pathways identi ed are several that have 0 0 been reported to be relevant for, and in some cases highly regu- siRNA: Irre ARF1 COPB1 COPA Irre ATP6V0C ATP6V1B1 lated during, RV infection, including tight junction (TJ) function C150 D (16), endocytosis (8, 10), and calcium signaling (17), as well as the 100 protein-ubiquitination pathway (18, 19). 125 The functional protein clusters initially identified with the 100 75 * Ingenuity Systems software were enriched with several protein- 75 * ** 50 ** interaction databases. We initially characterized three cellular 50 25 processes: the ubiquitin-proteasome pathway, the TJ network, and 25 *** the endocytosis-related protein system. Regarding the protea- Infectivity (%) 0 0 some-ubiquitin components, in silico proteomics showed a strong siRNA: Irre RAB30 RAB2LA ACTN4 Irre ARF6 CDC42 RHOA cluster in our data set: E3 ligase hits, deubiquitinase PAN2, and E 100 F heat-shock proteins. Components of the 26S proteasome were 100 also present in these hits (Fig. S1B and Table S2). These findings 75 are supported by the recent demonstration of the involvement of 75 50 ** ** the proteasome-ubiquitin pathway in the life cycle of RVs (18, 19). 50 Fifteen proteins belonging to the TJ network were recognized 25 25 by protein databases among the positive hits, including JAM-A 0 0 (junctional adhesion molecule) and claudins [human F11 re- Plasmid: Empty WT N17 V12 siRNA: Irre VPS37D VPS25 ceptor (F11R), claudin 6 (CLDN6), CLDN14, and CLDN9) (Fig. S1C and Table S2). Several cytoplasmic proteins involved in Fig. 1. Characterization of proteins involved in endocytosis and intracellular the assembly and maintenance of TJs were also present in our trafficpathway.(A, B, C, D,andF) MA104 cells were transfected with the in- MICROBIOLOGY data set (PARD6A, CNKSR3, MYL9, MYH1, and MYH8), dicated siRNAs and 72 hpt were either infected with RRV [multiplicity of infec- suggesting that TJs are important for RV infection.
Recommended publications
  • View of HER2: Human Epidermal Growth Factor Receptor 2; TNBC: Triple-Negative Breast Resistance to Systemic Therapy in Patients with Breast Cancer

    View of HER2: Human Epidermal Growth Factor Receptor 2; TNBC: Triple-Negative Breast Resistance to Systemic Therapy in Patients with Breast Cancer

    Wen et al. Cancer Cell Int (2018) 18:128 https://doi.org/10.1186/s12935-018-0625-9 Cancer Cell International PRIMARY RESEARCH Open Access Sulbactam‑enhanced cytotoxicity of doxorubicin in breast cancer cells Shao‑hsuan Wen1†, Shey‑chiang Su2†, Bo‑huang Liou3, Cheng‑hao Lin1 and Kuan‑rong Lee1* Abstract Background: Multidrug resistance (MDR) is a major obstacle in breast cancer treatment. The predominant mecha‑ nism underlying MDR is an increase in the activity of adenosine triphosphate (ATP)-dependent drug efux trans‑ porters. Sulbactam, a β-lactamase inhibitor, is generally combined with β-lactam antibiotics for treating bacterial infections. However, sulbactam alone can be used to treat Acinetobacter baumannii infections because it inhibits the expression of ATP-binding cassette (ABC) transporter proteins. This is the frst study to report the efects of sulbactam on mammalian cells. Methods: We used the breast cancer cell lines as a model system to determine whether sulbactam afects cancer cells. The cell viabilities in the present of doxorubicin with or without sulbactam were measured by MTT assay. Protein identities and the changes in protein expression levels in the cells after sulbactam and doxorubicin treatment were determined using LC–MS/MS. Real-time reverse transcription polymerase chain reaction (real-time RT-PCR) was used to analyze the change in mRNA expression levels of ABC transporters after treatment of doxorubicin with or without sulbactam. The efux of doxorubicin was measures by the doxorubicin efux assay. Results: MTT assay revealed that sulbactam enhanced the cytotoxicity of doxorubicin in breast cancer cells. The results of proteomics showed that ABC transporter proteins and proteins associated with the process of transcription and initiation of translation were reduced.
  • Seq2pathway Vignette

    Seq2pathway Vignette

    seq2pathway Vignette Bin Wang, Xinan Holly Yang, Arjun Kinstlick May 19, 2021 Contents 1 Abstract 1 2 Package Installation 2 3 runseq2pathway 2 4 Two main functions 3 4.1 seq2gene . .3 4.1.1 seq2gene flowchart . .3 4.1.2 runseq2gene inputs/parameters . .5 4.1.3 runseq2gene outputs . .8 4.2 gene2pathway . 10 4.2.1 gene2pathway flowchart . 11 4.2.2 gene2pathway test inputs/parameters . 11 4.2.3 gene2pathway test outputs . 12 5 Examples 13 5.1 ChIP-seq data analysis . 13 5.1.1 Map ChIP-seq enriched peaks to genes using runseq2gene .................... 13 5.1.2 Discover enriched GO terms using gene2pathway_test with gene scores . 15 5.1.3 Discover enriched GO terms using Fisher's Exact test without gene scores . 17 5.1.4 Add description for genes . 20 5.2 RNA-seq data analysis . 20 6 R environment session 23 1 Abstract Seq2pathway is a novel computational tool to analyze functional gene-sets (including signaling pathways) using variable next-generation sequencing data[1]. Integral to this tool are the \seq2gene" and \gene2pathway" components in series that infer a quantitative pathway-level profile for each sample. The seq2gene function assigns phenotype-associated significance of genomic regions to gene-level scores, where the significance could be p-values of SNPs or point mutations, protein-binding affinity, or transcriptional expression level. The seq2gene function has the feasibility to assign non-exon regions to a range of neighboring genes besides the nearest one, thus facilitating the study of functional non-coding elements[2]. Then the gene2pathway summarizes gene-level measurements to pathway-level scores, comparing the quantity of significance for gene members within a pathway with those outside a pathway.
  • Transcriptomic Analysis of the Aquaporin (AQP) Gene Family

    Transcriptomic Analysis of the Aquaporin (AQP) Gene Family

    Pancreatology 19 (2019) 436e442 Contents lists available at ScienceDirect Pancreatology journal homepage: www.elsevier.com/locate/pan Transcriptomic analysis of the Aquaporin (AQP) gene family interactome identifies a molecular panel of four prognostic markers in patients with pancreatic ductal adenocarcinoma Dimitrios E. Magouliotis a, b, Vasiliki S. Tasiopoulou c, Konstantinos Dimas d, * Nikos Sakellaridis d, Konstantina A. Svokos e, Alexis A. Svokos f, Dimitris Zacharoulis b, a Division of Surgery and Interventional Science, Faculty of Medical Sciences, UCL, London, UK b Department of Surgery, University of Thessaly, Biopolis, Larissa, Greece c Faculty of Medicine, School of Health Sciences, University of Thessaly, Biopolis, Larissa, Greece d Department of Pharmacology, Faculty of Medicine, School of Health Sciences, University of Thessaly, Biopolis, Larissa, Greece e The Warren Alpert Medical School of Brown University, Providence, RI, USA f Riverside Regional Medical Center, Newport News, VA, USA article info abstract Article history: Background: This study aimed to assess the differential gene expression of aquaporin (AQP) gene family Received 14 October 2018 interactome in pancreatic ductal adenocarcinoma (PDAC) using data mining techniques to identify novel Received in revised form candidate genes intervening in the pathogenicity of PDAC. 29 January 2019 Method: Transcriptome data mining techniques were used in order to construct the interactome of the Accepted 9 February 2019 AQP gene family and to determine which genes members are differentially expressed in PDAC as Available online 11 February 2019 compared to controls. The same techniques were used in order to evaluate the potential prognostic role of the differentially expressed genes. Keywords: PDAC Results: Transcriptome microarray data of four GEO datasets were incorporated, including 142 primary Aquaporin tumor samples and 104 normal pancreatic tissue samples.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Supplementary Materials

    Supplementary Materials

    1 Supplementary Materials: Supplemental Figure 1. Gene expression profiles of kidneys in the Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice. (A) A heat map of microarray data show the genes that significantly changed up to 2 fold compared between Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice (N=4 mice per group; p<0.05). Data show in log2 (sample/wild-type). 2 Supplemental Figure 2. Sting signaling is essential for immuno-phenotypes of the Fcgr2b-/-lupus mice. (A-C) Flow cytometry analysis of splenocytes isolated from wild-type, Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice at the age of 6-7 months (N= 13-14 per group). Data shown in the percentage of (A) CD4+ ICOS+ cells, (B) B220+ I-Ab+ cells and (C) CD138+ cells. Data show as mean ± SEM (*p < 0.05, **p<0.01 and ***p<0.001). 3 Supplemental Figure 3. Phenotypes of Sting activated dendritic cells. (A) Representative of western blot analysis from immunoprecipitation with Sting of Fcgr2b-/- mice (N= 4). The band was shown in STING protein of activated BMDC with DMXAA at 0, 3 and 6 hr. and phosphorylation of STING at Ser357. (B) Mass spectra of phosphorylation of STING at Ser357 of activated BMDC from Fcgr2b-/- mice after stimulated with DMXAA for 3 hour and followed by immunoprecipitation with STING. (C) Sting-activated BMDC were co-cultured with LYN inhibitor PP2 and analyzed by flow cytometry, which showed the mean fluorescence intensity (MFI) of IAb expressing DC (N = 3 mice per group). 4 Supplemental Table 1. Lists of up and down of regulated proteins Accession No.
  • Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice

    Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice

    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia.
  • Formation of COPI-Coated Vesicles at a Glance Eric C

    Formation of COPI-Coated Vesicles at a Glance Eric C

    © 2018. Published by The Company of Biologists Ltd | Journal of Cell Science (2018) 131, jcs209890. doi:10.1242/jcs.209890 CELL SCIENCE AT A GLANCE Formation of COPI-coated vesicles at a glance Eric C. Arakel1 and Blanche Schwappach1,2,* ABSTRACT unresolved, this review attempts to refocus the perspectives of The coat protein complex I (COPI) allows the precise sorting of lipids the field. and proteins between Golgi cisternae and retrieval from the Golgi KEY WORDS: Arf1, ArfGAP, COPI, Coatomer, Golgi, Endoplasmic to the ER. This essential role maintains the identity of the early reticulum, Vesicle coat secretory pathway and impinges on key cellular processes, such as protein quality control. In this Cell Science at a Glance and accompanying poster, we illustrate the different stages of COPI- Introduction coated vesicle formation and revisit decades of research in the Vesicle coat proteins, such as the archetypal clathrin and the coat context of recent advances in the elucidation of COPI coat structure. protein complexes II and I (COPII and COPI, respectively) are By calling attention to an array of questions that have remained molecular machines with two central roles: enabling vesicle formation, and selecting protein and lipid cargo to be packaged within them. Thus, coat proteins fulfil a central role in the 1Department of Molecular Biology, Universitätsmedizin Göttingen, Humboldtallee homeostasis of the cell’s endomembrane system and are the basis 23, 37073 Göttingen, Germany. 2Max-Planck Institute for Biophysical Chemistry, 37077 Göttingen, Germany. of functionally segregated compartments. COPI operates in retrieval from the Golgi to the endoplasmic reticulum (ER) and in intra-Golgi *Author for correspondence ([email protected]) transport (Beck et al., 2009; Duden, 2003; Lee et al., 2004a; Spang, E.C.A., 0000-0001-7716-7149; B.S., 0000-0003-0225-6432 2009), and maintains ER- and Golgi-resident chaperones and enzymes where they belong.
  • Supplementary Figures 1-14 and Supplementary References

    Supplementary Figures 1-14 and Supplementary References

    SUPPORTING INFORMATION Spatial Cross-Talk Between Oxidative Stress and DNA Replication in Human Fibroblasts Marko Radulovic,1,2 Noor O Baqader,1 Kai Stoeber,3† and Jasminka Godovac-Zimmermann1* 1Division of Medicine, University College London, Center for Nephrology, Royal Free Campus, Rowland Hill Street, London, NW3 2PF, UK. 2Insitute of Oncology and Radiology, Pasterova 14, 11000 Belgrade, Serbia 3Research Department of Pathology and UCL Cancer Institute, Rockefeller Building, University College London, University Street, London WC1E 6JJ, UK †Present Address: Shionogi Europe, 33 Kingsway, Holborn, London WC2B 6UF, UK TABLE OF CONTENTS 1. Supplementary Figures 1-14 and Supplementary References. Figure S-1. Network and joint spatial razor plot for 18 enzymes of glycolysis and the pentose phosphate shunt. Figure S-2. Correlation of SILAC ratios between OXS and OAC for proteins assigned to the SAME class. Figure S-3. Overlap matrix (r = 1) for groups of CORUM complexes containing 19 proteins of the 49-set. Figure S-4. Joint spatial razor plots for the Nop56p complex and FIB-associated complex involved in ribosome biogenesis. Figure S-5. Analysis of the response of emerin nuclear envelope complexes to OXS and OAC. Figure S-6. Joint spatial razor plots for the CCT protein folding complex, ATP synthase and V-Type ATPase. Figure S-7. Joint spatial razor plots showing changes in subcellular abundance and compartmental distribution for proteins annotated by GO to nucleocytoplasmic transport (GO:0006913). Figure S-8. Joint spatial razor plots showing changes in subcellular abundance and compartmental distribution for proteins annotated to endocytosis (GO:0006897). Figure S-9. Joint spatial razor plots for 401-set proteins annotated by GO to small GTPase mediated signal transduction (GO:0007264) and/or GTPase activity (GO:0003924).
  • Why Cells and Viruses Cannot Survive Without an ESCRT

    Why Cells and Viruses Cannot Survive Without an ESCRT

    cells Review Why Cells and Viruses Cannot Survive without an ESCRT Arianna Calistri * , Alberto Reale, Giorgio Palù and Cristina Parolin Department of Molecular Medicine, University of Padua, 35121 Padua, Italy; [email protected] (A.R.); [email protected] (G.P.); [email protected] (C.P.) * Correspondence: [email protected] Abstract: Intracellular organelles enwrapped in membranes along with a complex network of vesicles trafficking in, out and inside the cellular environment are one of the main features of eukaryotic cells. Given their central role in cell life, compartmentalization and mechanisms allowing their maintenance despite continuous crosstalk among different organelles have been deeply investigated over the past years. Here, we review the multiple functions exerted by the endosomal sorting complex required for transport (ESCRT) machinery in driving membrane remodeling and fission, as well as in repairing physiological and pathological membrane damages. In this way, ESCRT machinery enables different fundamental cellular processes, such as cell cytokinesis, biogenesis of organelles and vesicles, maintenance of nuclear–cytoplasmic compartmentalization, endolysosomal activity. Furthermore, we discuss some examples of how viruses, as obligate intracellular parasites, have evolved to hijack the ESCRT machinery or part of it to execute/optimize their replication cycle/infection. A special emphasis is given to the herpes simplex virus type 1 (HSV-1) interaction with the ESCRT proteins, considering the peculiarities of this interplay and the need for HSV-1 to cross both the nuclear-cytoplasmic and the cytoplasmic-extracellular environment compartmentalization to egress from infected cells. Citation: Calistri, A.; Reale, A.; Palù, Keywords: ESCRT; viruses; cellular membranes; extracellular vesicles; HSV-1 G.; Parolin, C.
  • The Role of ARF Family Proteins and Their Regulators and Effectors in Cancer Progression: a Therapeutic Perspective

    The Role of ARF Family Proteins and Their Regulators and Effectors in Cancer Progression: a Therapeutic Perspective

    fcell-08-00217 April 17, 2020 Time: 19:19 # 1 REVIEW published: 21 April 2020 doi: 10.3389/fcell.2020.00217 The Role of ARF Family Proteins and Their Regulators and Effectors in Cancer Progression: A Therapeutic Perspective Cristina Casalou†, Andreia Ferreira† and Duarte C. Barral* CEDOC, NOVA Medical School, Faculdade de Ciências Médicas, Universidade NOVA de Lisboa, Lisbon, Portugal The Adenosine diphosphate-Ribosylation Factor (ARF) family belongs to the RAS superfamily of small GTPases and is involved in a wide variety of physiological processes, such as cell proliferation, motility and differentiation by regulating membrane Edited by: traffic and associating with the cytoskeleton. Like other members of the RAS Sunil Kumar Verma, superfamily, ARF family proteins are activated by Guanine nucleotide Exchange Factors Centre for Cellular & Molecular (GEFs) and inactivated by GTPase-Activating Proteins (GAPs). When active, they bind Biology (CCMB), India effectors, which mediate downstream functions. Several studies have reported that Reviewed by: Wei-Hsiung Yang, cancer cells are able to subvert membrane traffic regulators to enhance migration and Mercer University, United States invasion. Indeed, members of the ARF family, including ARF-Like (ARL) proteins have Ira Daar, National Cancer Institute (NCI), been implicated in tumorigenesis and progression of several types of cancer. Here, we United States review the role of ARF family members, their GEFs/GAPs and effectors in tumorigenesis *Correspondence: and cancer progression, highlighting the ones that can have a pro-oncogenic behavior Duarte C. Barral or function as tumor suppressors. Moreover, we propose possible mechanisms and [email protected] approaches to target these proteins, toward the development of novel therapeutic †These authors have contributed equally to this work strategies to impair tumor progression.
  • Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

    Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

    Anti-VPS25 monoclonal antibody, clone T3 (DCABH-13967) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]). Immunogen VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNN VKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT LYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol VPS25 Synonyms VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae);
  • Cogps:Cancer Outlier Gene Profile Sets

    Cogps:Cancer Outlier Gene Profile Sets

    coGPS:Cancer Outlier Gene Profile Sets Yingying Wei, Michael Ochs April 24, 2017 1 Introduction Generation of high-throughput genomic data has become routine in modern bi- ology. While the focus remains in many cases on the identification of molecular species, such as mRNA transcripts, that differ between two conditions, the data is often of great interest for elucidating differences in pathway activity. Standard algorithms, such as limma [Smyth 2004]and SAM [Tusher , Tibshirani and Chu 2001], are widely used for identifying transcripts (hereon referred to genes) that dif- fer statistically between two groups. Later, as multiple datasets became avail- able on the same biological process, people began to combine information from multiple studies to improve the power of statistical analysis in each study [Conlon, Song and Liu 2006], [Kendziorski et al. 2003], [Yuan and Kendziorski 2006], [Cui et al. 2005], and [Scharpf et al. 2009]. It is often the case in cancer studies that the identification of important genes by these approaches fails. The realization that genes are often disregulated in only a subset of tumors led to the development of Cancer Outlier Profile Analysis (COPA) [MacDonald, 2006]. Outlier genes are defined to be ones that are over- or under- expressed in a subset of tumor samples compared to normal samples. The difference between outlier differential expressed gene and normal differen- tial expressed gene is that outlier gene may have the same level of expression in majority of tumor samples as that of normals. A few statistics for finding outlier genes have been proposed [MacDonald, 2006], [Tibshirani, R. and Hastie, 2007], and [Wu, 2007].