Aberrant Splicing in GJB1 and the Relevance of 5' UTR in CMTX1

Total Page:16

File Type:pdf, Size:1020Kb

Load more

brain sciences Article Aberrant Splicing in GJB1 and the Relevance of 50 UTR in CMTX1 Pathogenesis Federica Boso 1,2,† , Federica Taioli 1,†, Ilaria Cabrini 1, Tiziana Cavallaro 3 and Gian Maria Fabrizi 1,3,* 1 Department of Neurological Sciences, Biomedicine and Movement Sciences, University of Verona, Piazzale L.A. Scuro 10, 37134 Verona, Italy; [email protected] (F.B.); [email protected] (F.T.); [email protected] (I.C.) 2 Department of Cellular, Computational and Integrative Biology, University of Trento, Via Sommarive 9, 38123 Povo (Trento), Italy 3 Azienda Ospedaliera Universitaria Integrata Verona—Borgo Roma, Piazzale L.A. Scuro 10, 37134 Verona, Italy; [email protected] * Correspondence: [email protected]; Tel.: +39-0458124286 † These Authors contributed equally to the work. Abstract: The second most common form of Charcot-Marie-Tooth disease (CMT) follows an X-linked dominant inheritance pattern (CMTX1), referring to mutations in the gap junction protein beta 1 gene (GJB1) that affect connexin 32 protein (Cx32) and its ability to form gap junctions in the myelin sheath of peripheral nerves. Despite the advances of next-generation sequencing (NGS), attention has only recently also focused on noncoding regions. We describe two unrelated families with a c.-17+1G>T transversion in the 50 untranslated region (UTR) of GJB1 that cosegregates with typical features of CMTX1. As suggested by in silico analysis, the mutation affects the regulatory sequence that controls the proper splicing of the intron in the corresponding mRNA. The retention of the intron is also associated with reduced levels of the transcript and the loss of immunofluorescent staining for Cx32 in the nerve biopsy, thus supporting the hypothesis of mRNA instability as a pathogenic mechanism in these families. Therefore, our report corroborates the role of 50 UTR of GJB1 in the pathogenesis of CMTX1 and emphasizes the need to include this region in routine GJB1 screening, as well as in NGS panels. Citation: Boso, F.; Taioli, F.; Cabrini, I.; Cavallaro, T.; Fabrizi, G.M. Aberrant Keywords: Charcot-Marie-Tooth; CMT; X-linked Charcot-Marie-Tooth (CMTX1); Connexin 32; GJB1; 0 Splicing in GJB1 and the Relevance of 5 UTR; noncoding; splicing 50 UTR in CMTX1 Pathogenesis. Brain Sci. 2021, 11, 24. https://dx. doi.org/10.3390/brainsci11010024 1. Introduction Received: 30 November 2020 Charcot-Marie-Tooth disease (CMT) refers to the most frequent group of hereditary Accepted: 23 December 2020 neuropathies, encompassing a wide range of genetic, clinical, neurophysiological and Published: 27 December 2020 pathological features. Despite significant genetic heterogeneity, most known mutations Publisher’s Note: MDPI stays neu- involve four genes (PMP22, GJB1, MFN2 and MPZ)[1,2], but, until recently, molecular tral with regard to jurisdictional claims diagnosis was hampered by a costly and gruelling search for those main causative genes in published maps and institutional by multiplex ligation-dependent probe amplification (MLPA) and conventional Sanger affiliations. sequencing using a candidate-gene approach. Indeed, the advent of next-generation se- quencing (NGS) techniques paved the way for a broader screening of the patients and for the discovery of rarer variants, thus providing a higher likelihood of identification. Notwithstanding this considerable progress, assuming a Mendelian inheritance, a genetic Copyright: © 2020 by the authors. Li- diagnosis remains elusive in 30–70% of CMT patients [1–4], depending on customized censee MDPI, Basel, Switzerland. This gene panels that generally cover only known disease-related coding sequences in order to article is an open access article distributed provide a faster and affordable analysis with higher coverage, as well as fewer incidental under the terms and conditions of the findings. As an example, the most frequent culprit for CMT after peripheral myelin protein Creative Commons Attribution (CC BY) 22 (PMP22) is the gap junction beta 1 protein gene (GJB1), affecting about 6.5–17% of the license (https://creativecommons.org/ patients with a presumptive inherited neuropathy [2,3]. Human GJB1 consists of two exons, licenses/by/4.0/). Brain Sci. 2021, 11, 24. https://dx.doi.org/10.3390/brainsci11010024 https://www.mdpi.com/journal/brainsci Brain Sci. 2021, 11, x FOR PEER REVIEW 2 of 11 Brain Sci. 2021, 11, 24 2 of 11 patients with a presumptive inherited neuropathy [2,3]. Human GJB1 consists of two ex- ons, separated by an intron of variable size: exon 1 encodes most of the 5′ untranslated region (UTR), whereas exon 2 encompasses the entire amino acid coding region and the separated by an intron of variable size: exon 1 encodes most of the 50 untranslated region 3′ UTR. Two different(UTR), whereas tissue-specific exon 2 promoters encompasses have the been entire acknowledged amino acid coding[5]: a basal region pro- and the 30 UTR. moter P1 is locatedTwo different more than tissue-specific 8 kb upstream promoters from the have coding been sequence acknowledged and regulates [5]: a basal the promoter P1 transcript NM_001097642is located more in liver, than 8pancreas, kb upstream oocytes from and the embryonic coding sequence stem cells, and regulateswhile in the transcript the peripheralNM_001097642 nervous system in, the liver, alternative pancreas, promoter oocytes andP2 (the embryonic 130-bp exon stem 1B, cells, which while is in the periph- separated fromeral exon nervous 2 by the system, 356-bp the intron alternative 1B) is promoter responsible P2 (thefor the 130-bp production exon 1B, of which the is separated transcript NM_000166.from exon By 2 alternative by the 356-bp promoter intron usage, 1B) is responsibleGJB1 thus provides for the production mRNAs with of the transcript identical codingNM_000166. regions but By different alternative 5′ UTR promoter with specific usage, cisGJB1-regulatorythus provides elements mRNAs (Sup- with identical plementary Figurecoding S1). regions Thanks but to differentthe broader 50 UTR availability with specific of genetic cis-regulatory screening, elementstoday there (Supplementary are over 450 knownFigure variants S1). Thanks in the to thecoding broader sequence, availability with ofa geneticmajority screening, of missense today muta- there are over 450 tions and rarerknown cases with variants frameshift in the codingand premature sequence, stop with codon a majority mutations of missense or ample mutations dele- and rarer tions. However,cases noncoding with frameshift regions are and increasingly prematurestop recognized codonmutations not only as or key ample regulators deletions. However, of protein expressions,noncoding but regions also as are potential increasingly hidden recognized causes of not diseases, only as keyaccounting regulators for ofso protein expres- much as 10% ofsions, patients but alsowith as GJB1 potential mutations hidden [3]. causes Indeed, of variations diseases, accountingof the UTR forma soy be- much as 10% of come pathogenicpatients by disrupting with GJB1 themutations sequences [3]. that Indeed, regulate variations transcription of the UTR (such may as becomebinding pathogenic by sites for transcriptiondisrupting factors the sequences like Early that Growth regulate Response transcription-2, EGR2 (such asand binding SRY-Box sites 10, for transcription SOX10) or by impairingfactors like mRNA Early translation Growth Response-2, and stability, EGR2 thus and influencing SRY-Box protein 10, SOX10) expres- or by impairing sion [6,7]. mRNA translation and stability, thus influencing protein expression [6,7]. We propose theWe candidate propose the variant candidate c.-17+1G>T variant c.-17+1G>Tas an example as an of examplea 5′ UTR of mutation a 50 UTR mutation that that may accountmay for account mRNA for instability mRNA instabilityby aberrant by splicing aberrant of splicingintron 1B, of ultimately intron 1B, caus- ultimately causing ing CMTX1. CMTX1. 2. Patients, Materials2. Patients, and MaterialsMethods and Methods Two young probandsTwo young who probands were evaluated who were for evaluateda length-dependent, for a length-dependent, sensory-motor sensory-motor neuropathy ledneuropathy to the study led of two to the unrelated study of families two unrelated on the assumption families on of thea genetic assumption path- of a genetic ogenesis (Figurepathogenesis 1A, II-2; Figure (Figure 1B,1A, III II-2;-9). FigureBoth cases1B, III-9). presented Both caseswith typical presented features with typicalof features CMT, reportingof walking CMT, reporting difficulties, walking sensory difficulties, abnormalities sensory and abnormalities slowly progressive and slowly distal progressive distal muscle weaknessmuscle with weakness peroneal withatrophy peroneal and foot atrophy deformities and foot. T deformities.he male proband The malealso had proband also had further clues suchfurther as cluesearly suchonset as(in early the second onset (in decade), the second split decade),hand syndrome, split hand postural syndrome, postural tremor and bilateraltremor hypoacusia. and bilateral Likewise, hypoacusia. pedigree Likewise, analysis pedigree revealed analysis similarly revealed affected similarly affected relatives (Tablerelatives 1), with (Table a tendency1), with for a males tendency to be for m malesore severely to be more and prematurely severely and affected prematurely affected and with no cases of male-to-male transmission, thus suggesting an X-linked dominant and with no cases of male-to-male transmission, thus suggesting
Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • New Developments in Charcot–Marie–Tooth Neuropathy and Related Diseases

    New Developments in Charcot–Marie–Tooth Neuropathy and Related Diseases

    CE: Alpana; WCO 300505; Total nos of Pages: 10; WCO 300505 REVIEW CURRENT OPINION New developments in Charcot–Marie–Tooth neuropathy and related diseases Davide Pareyson, Paola Saveri, and Chiara Pisciotta Purpose of review Charcot–Marie–Tooth disease (CMT) and related neuropathies represent a heterogeneous group of hereditary disorders. The present review will discuss the most recent advances in the field. Recent findings Knowledge of CMT epidemiology and frequency of the main associated genes is increasing, with an overall prevalence estimated at 10–28/100 000. In the last years, the huge number of newly uncovered genes, thanks to next-generation sequencing techniques, is challenging the current classification of CMT. During the last 18 months other genes have been associated with CMT, such as PMP2, MORC2, NEFH, MME, and DGAT2. For the most common forms of CMT, numerous promising compounds are under study in cellular and animal models, mainly targeting either the protein degradation pathway or the protein overexpression. Consequently, efforts are devoted to develop responsive outcome measures and biomarkers for this overall slowly progressive disorder, with quantitative muscle MRI resulting the most sensitive-to-change measure. Summary This is a rapidly evolving field where better understanding of pathophysiology is paving the way to develop potentially effective treatments, part of which will soon be tested in patients. Intense research is currently devoted to prepare clinical trials and develop responsive outcome measures. Keywords
  • X-Linked Diseases: Susceptible Females

    X-Linked Diseases: Susceptible Females

    REVIEW ARTICLE X-linked diseases: susceptible females Barbara R. Migeon, MD 1 The role of X-inactivation is often ignored as a prime cause of sex data include reasons why women are often protected from the differences in disease. Yet, the way males and females express their deleterious variants carried on their X chromosome, and the factors X-linked genes has a major role in the dissimilar phenotypes that that render women susceptible in some instances. underlie many rare and common disorders, such as intellectual deficiency, epilepsy, congenital abnormalities, and diseases of the Genetics in Medicine (2020) 22:1156–1174; https://doi.org/10.1038/s41436- heart, blood, skin, muscle, and bones. Summarized here are many 020-0779-4 examples of the different presentations in males and females. Other INTRODUCTION SEX DIFFERENCES ARE DUE TO X-INACTIVATION Sex differences in human disease are usually attributed to The sex differences in the effect of X-linked pathologic variants sex specific life experiences, and sex hormones that is due to our method of X chromosome dosage compensation, influence the function of susceptible genes throughout the called X-inactivation;9 humans and most placental mammals – genome.1 5 Such factors do account for some dissimilarities. compensate for the sex difference in number of X chromosomes However, a major cause of sex-determined expression of (that is, XX females versus XY males) by transcribing only one disease has to do with differences in how males and females of the two female X chromosomes. X-inactivation silences all X transcribe their gene-rich human X chromosomes, which is chromosomes but one; therefore, both males and females have a often underappreciated as a cause of sex differences in single active X.10,11 disease.6 Males are the usual ones affected by X-linked For 46 XY males, that X is the only one they have; it always pathogenic variants.6 Females are biologically superior; a comes from their mother, as fathers contribute their Y female usually has no disease, or much less severe disease chromosome.
  • SUPPLEMENTARY MATERIAL Effect of Next

    SUPPLEMENTARY MATERIAL Effect of Next

    SUPPLEMENTARY MATERIAL Effect of Next-Generation Exome Sequencing Depth for Discovery of Diagnostic Variants KKyung Kim1,2,3†, Moon-Woo Seong4†, Won-Hyong Chung3, Sung Sup Park4, Sangseob Leem1, Won Park5,6, Jihyun Kim1,2, KiYoung Lee1,2*‡, Rae Woong Park1,2* and Namshin Kim5,6** 1Department of Biomedical Informatics, Ajou University School of Medicine, Suwon 443-749, Korea 2Department of Biomedical Science, Graduate School, Ajou University, Suwon 443-749, Korea, 3Korean Bioinformation Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon 305-806, Korea, 4Department of Laboratory Medicine, Seoul National University Hospital College of Medicine, Seoul 110-799, Korea, 5Department of Functional Genomics, Korea University of Science and Technology, Daejeon 305-806, Korea, 6Epigenomics Research Center, Genome Institute, Korea Research Institute of Bioscience and Biotechnology, Daejeon 305-806, Korea http//www. genominfo.org/src/sm/gni-13-31-s001.pdf Supplementary Table 1. List of diagnostic genes Gene Symbol Description Associated diseases ABCB11 ATP-binding cassette, sub-family B (MDR/TAP), member 11 Intrahepatic cholestasis ABCD1 ATP-binding cassette, sub-family D (ALD), member 1 Adrenoleukodystrophy ACVR1 Activin A receptor, type I Fibrodysplasia ossificans progressiva AGL Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase Glycogen storage disease ALB Albumin Analbuminaemia APC Adenomatous polyposis coli Adenomatous polyposis coli APOE Apolipoprotein E Apolipoprotein E deficiency AR Androgen receptor Androgen insensitivity
  • The CNS Phenotype of X-Linked Charcot-Marie-Tooth Disease More Than a Peripheral Problem

    The CNS Phenotype of X-Linked Charcot-Marie-Tooth Disease More Than a Peripheral Problem

    Views & Reviews CME The CNS phenotype of X-linked Charcot-Marie-Tooth disease More than a peripheral problem Robert A. Taylor, MD; Erin M. Simon, MD; Harold G. Marks, MD; and Steven S. Scherer, MD, PhD X-linked Charcot-Marie-Tooth disease (CMTX) is the lasting 4 hours. The following day, he developed the second most common form of inherited demyelinat- same symptoms, and mild right leg weakness, last- ing neuropathy, next to CMT type 1A, which is ing 10 hours. On day 3, he developed a complete caused by duplication of the PMP22 gene.1 CMTX is motor aphasia, right arm weakness, dysphagia, and caused by mutations in GJB1, the gene encoding loss of gag reflex, lasting 4 hours. MRI (on day 3) connexin32 (Cx32), which belongs to a highly con- showed abnormally increased T2 signal and reduced served family of proteins that form gap junctions in diffusion in the posterior portion of the centrum vertebrates. Myelinating Schwann cells express semiovale bilaterally (figure 1, A and B), as well as Cx32, which likely forms gap junctions between the in the splenium of the corpus callosum (figure 1, C layers of the myelin sheath, thereby providing a and D). These lesions spared the subcortical U fibers shorter pathway for the diffusion of small molecules and did not enhance (not shown). Three-dimensional and ions directly across the myelin sheath.2 Oligo- time-of-flight MR angiography of the intracranial dendrocytes also express Cx32, which participates in vessels, electroencephalography, and CSF were nor- the gap junction coupling of oligodendrocytes and mal, including a normal lactate level (1.1 mmol/L) astrocytes.3 and no oligoclonal bands.
  • Full Disclosure Forms

    Full Disclosure Forms

    Expanding genotype/phenotype of neuromuscular diseases by comprehensive target capture/NGS Xia Tian, PhD* ABSTRACT * Wen-Chen Liang, MD Objective: To establish and evaluate the effectiveness of a comprehensive next-generation * Yanming Feng, PhD sequencing (NGS) approach to simultaneously analyze all genes known to be responsible for Jing Wang, MD the most clinically and genetically heterogeneous neuromuscular diseases (NMDs) involving spi- Victor Wei Zhang, PhD nal motoneurons, neuromuscular junctions, nerves, and muscles. Chih-Hung Chou, MS Methods: All coding exons and at least 20 bp of flanking intronic sequences of 236 genes causing Hsien-Da Huang, PhD NMDs were enriched by using SeqCap EZ solution-based capture and enrichment method fol- Ching Wan Lam, PhD lowed by massively parallel sequencing on Illumina HiSeq2000. Ya-Yun Hsu, PhD ; 3 Thy-Sheng Lin, MD Results: The target gene capture/deep sequencing provides an average coverage of 1,000 per Wan-Tzu Chen, MS nucleotide. Thirty-five unrelated NMD families (38 patients) with clinical and/or muscle pathologic Lee-Jun Wong, PhD diagnoses but without identified causative genetic defects were analyzed. Deleterious mutations Yuh-Jyh Jong, MD were found in 29 families (83%). Definitive causative mutations were identified in 21 families (60%) and likely diagnoses were established in 8 families (23%). Six families were left without diagnosis due to uncertainty in phenotype/genotype correlation and/or unidentified causative Correspondence to genes. Using this comprehensive panel, we not only identified mutations in expected genes but Dr. Wong: also expanded phenotype/genotype among different subcategories of NMDs. [email protected] or Dr. Jong: Conclusions: Target gene capture/deep sequencing approach can greatly improve the genetic [email protected] diagnosis of NMDs.
  • Neurological Diseases Caused by Ion-Channel Mutations Frank Weinreich and Thomas J Jentsch*

    Neurological Diseases Caused by Ion-Channel Mutations Frank Weinreich and Thomas J Jentsch*

    409 Neurological diseases caused by ion-channel mutations Frank Weinreich and Thomas J Jentsch* During the past decade, mutations in several ion-channel humans. This is probably the case for important Na+-chan- genes have been shown to cause inherited neurological nel isoforms, such as those dominating excitation in diseases. This is not surprising given the large number of skeletal muscle or heart, and may also be the case for the different ion channels and their prominent role in signal two channel subunits that assemble to form M-type processing. Biophysical studies of mutant ion channels in vitro K+-channels, which are key regulators of neuronal allow detailed investigations of the basic mechanism excitability [8••,9•]. This concept is supported by the underlying these ‘channelopathies’. A full understanding of observation that many channelopathies are paroxysmal these diseases, however, requires knowing the roles these (i.e. cause transient convulsions): mutations leading to a channels play in their cellular and systemic context. Differences constant disability might be incompatible with life, or may in this context often cause different phenotypes in humans and significantly decrease the frequency of the mutation with- mice. The situation is further complicated by the developmental in the human population. In contrast to the severe effects and other secondary effects that might result from ion- symptoms associated with the loss of function of certain channel mutations. Recent studies have described the different key ion channels, the large number of ion-channel isoforms thresholds to which ion-channel function must be decreased in may lead to a functional redundancy under most circum- order to cause disease.
  • Charcot-Marie-Tooth Disease Type 1A and Inflammatory-Demyelinating Lesions in the Central Nervous System

    Charcot-Marie-Tooth Disease Type 1A and Inflammatory-Demyelinating Lesions in the Central Nervous System

    ISSN: 2378-3001 García-Estévez et al. Int J Neurol Neurother 2019, 6:080 DOI: 10.23937/2378-3001/1410080 International Journal of Volume 6 | Issue 1 Open Access Neurology and Neurotherapy CASE REPORT Charcot-Marie-Tooth Disease Type 1A and Inflammatory- Demyelinating Lesions in the Central Nervous System Daniel A García-Estévez*, Carmen Cid-Rodríguez and Guillermo Ozaita-Arteche Check for Neurology Service, University Hospital of Ourense, Ourense, Spain updates *Corresponding author: Daniel Apolinar García-Estévez, Neurology Service, University Hospital of Ourense, Calle Ramón Puga Noguerol, 52, 32005, Ourense, Spain autosomal dominant, autosomal recessive or X-linked Abstract inheritance pattern [1]. Mutations in the MFN2, GJB1, Charcot-Marie-Tooth disease (CMT) is a hereditary senso- MPZ, NDRG and PMP22 genes have been associated with rimotor polyneuropathy which is occasionally associated with demyelinating lesions in the central nervous system, demyelinating central nervous system (CNS) lesions [2-6]. although it remains unclear whether this finding is coin- Mutations in the 17p11.2 region of the peripheral myelin cidental or whether the two processes share a common protein 22 gene (PMP22) cause CMT1A when the region pathogenic mechanism. is duplicated, and hereditary neuropathy with liability to A male patient with sensorimotor polyneuropathy presented pressure palsy (HNPP) when it is deleted. Both genotypes with symptoms consistent with cauda equina syndrome at are associated with demyelination of the CNS [6,7]. In age 47 in relation to an inflammatory lesion in the conus these cases, the clinical presentation may mimic multiple medullaris. Six years later, he presented with sudden- onset neurological symptoms including dysarthria and right sclerosis (MS) or ischaemic cerebrovascular disease.
  • 1 1 2 3 Cell Type-Specific Transcriptomics of Hypothalamic

    1 1 2 3 Cell Type-Specific Transcriptomics of Hypothalamic

    1 2 3 4 Cell type-specific transcriptomics of hypothalamic energy-sensing neuron responses to 5 weight-loss 6 7 Fredrick E. Henry1,†, Ken Sugino1,†, Adam Tozer2, Tiago Branco2, Scott M. Sternson1,* 8 9 1Janelia Research Campus, Howard Hughes Medical Institute, 19700 Helix Drive, Ashburn, VA 10 20147, USA. 11 2Division of Neurobiology, Medical Research Council Laboratory of Molecular Biology, 12 Cambridge CB2 0QH, UK 13 14 †Co-first author 15 *Correspondence to: [email protected] 16 Phone: 571-209-4103 17 18 Authors have no competing interests 19 1 20 Abstract 21 Molecular and cellular processes in neurons are critical for sensing and responding to energy 22 deficit states, such as during weight-loss. AGRP neurons are a key hypothalamic population 23 that is activated during energy deficit and increases appetite and weight-gain. Cell type-specific 24 transcriptomics can be used to identify pathways that counteract weight-loss, and here we 25 report high-quality gene expression profiles of AGRP neurons from well-fed and food-deprived 26 young adult mice. For comparison, we also analyzed POMC neurons, an intermingled 27 population that suppresses appetite and body weight. We find that AGRP neurons are 28 considerably more sensitive to energy deficit than POMC neurons. Furthermore, we identify cell 29 type-specific pathways involving endoplasmic reticulum-stress, circadian signaling, ion 30 channels, neuropeptides, and receptors. Combined with methods to validate and manipulate 31 these pathways, this resource greatly expands molecular insight into neuronal regulation of 32 body weight, and may be useful for devising therapeutic strategies for obesity and eating 33 disorders.
  • Genetic Testing Medical Policy – Genetics

    Genetic Testing Medical Policy – Genetics

    Genetic Testing Medical Policy – Genetics Please complete all appropriate questions fully. Suggested medical record documentation: • Current History & Physical • Progress Notes • Family Genetic History • Genetic Counseling Evaluation *Failure to include suggested medical record documentation may result in delay or possible denial of request. PATIENT INFORMATION Name: Member ID: Group ID: PROCEDURE INFORMATION Genetic Counseling performed: c Yes c No **Please check the requested analyte(s), identify number of units requested, and provide indication/rationale for testing. 81400 Molecular Pathology Level 1 Units _____ c ACADM (acyl-CoA dehydrogenase, C-4 to C-12 straight chain, MCAD) (e.g., medium chain acyl dehydrogenase deficiency), K304E variant _____ c ACE (angiotensin converting enzyme) (e.g., hereditary blood pressure regulation), insertion/deletion variant _____ c AGTR1 (angiotensin II receptor, type 1) (e.g., essential hypertension), 1166A>C variant _____ c BCKDHA (branched chain keto acid dehydrogenase E1, alpha polypeptide) (e.g., maple syrup urine disease, type 1A), Y438N variant _____ c CCR5 (chemokine C-C motif receptor 5) (e.g., HIV resistance), 32-bp deletion mutation/794 825del32 deletion _____ c CLRN1 (clarin 1) (e.g., Usher syndrome, type 3), N48K variant _____ c DPYD (dihydropyrimidine dehydrogenase) (e.g., 5-fluorouracil/5-FU and capecitabine drug metabolism), IVS14+1G>A variant _____ c F13B (coagulation factor XIII, B polypeptide) (e.g., hereditary hypercoagulability), V34L variant _____ c F2 (coagulation factor 2) (e.g.,
  • Regulation of Cancer Stemness in Breast Ductal Carcinoma in Situ by Vitamin D Compounds

    Regulation of Cancer Stemness in Breast Ductal Carcinoma in Situ by Vitamin D Compounds

    Author Manuscript Published OnlineFirst on May 28, 2020; DOI: 10.1158/1940-6207.CAPR-19-0566 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Analysis of the Transcriptome: Regulation of Cancer Stemness in Breast Ductal Carcinoma In Situ by Vitamin D Compounds Naing Lin Shan1, Audrey Minden1,5, Philip Furmanski1,5, Min Ji Bak1, Li Cai2,5, Roman Wernyj1, Davit Sargsyan3, David Cheng3, Renyi Wu3, Hsiao-Chen D. Kuo3, Shanyi N. Li3, Mingzhu Fang4, Hubert Maehr1, Ah-Ng Kong3,5, Nanjoo Suh1,5 1Department of Chemical Biology, Ernest Mario School of Pharmacy; 2Department of Biomedical Engineering, School of Engineering; 3Department of Pharmaceutics, Ernest Mario School of Pharmacy; 4Environmental and Occupational Health Sciences Institute and School of Public Health, 5Rutgers Cancer Institute of New Jersey, New Brunswick; Rutgers, The State University of New Jersey, NJ, USA Running title: Regulation of cancer stemness by vitamin D compounds Key words: Breast cancer, cancer stemness, gene expression, DCIS, vitamin D compounds Financial Support: This research was supported by the National Institutes of Health grant R01 AT007036, R01 AT009152, ES005022, Charles and Johanna Busch Memorial Fund at Rutgers University and the New Jersey Health Foundation. Corresponding author: Dr. Nanjoo Suh, Department of Chemical Biology, Ernest Mario School of Pharmacy, Rutgers, The State University of New Jersey, 164 Frelinghuysen Road, Piscataway, New Jersey 08854. Tel: 848-445-8030, Fax: 732-445-0687; e-mail: [email protected] Disclosure of Conflict of Interest: “The authors declare no potential conflicts of interest” 1 Downloaded from cancerpreventionresearch.aacrjournals.org on October 1, 2021.