X-Linked Diseases: Susceptible Females

Total Page:16

File Type:pdf, Size:1020Kb

Load more

REVIEW ARTICLE X-linked diseases: susceptible females Barbara R. Migeon, MD 1 The role of X-inactivation is often ignored as a prime cause of sex data include reasons why women are often protected from the differences in disease. Yet, the way males and females express their deleterious variants carried on their X chromosome, and the factors X-linked genes has a major role in the dissimilar phenotypes that that render women susceptible in some instances. underlie many rare and common disorders, such as intellectual deficiency, epilepsy, congenital abnormalities, and diseases of the Genetics in Medicine (2020) 22:1156–1174; https://doi.org/10.1038/s41436- heart, blood, skin, muscle, and bones. Summarized here are many 020-0779-4 examples of the different presentations in males and females. Other INTRODUCTION SEX DIFFERENCES ARE DUE TO X-INACTIVATION Sex differences in human disease are usually attributed to The sex differences in the effect of X-linked pathologic variants sex specific life experiences, and sex hormones that is due to our method of X chromosome dosage compensation, influence the function of susceptible genes throughout the called X-inactivation;9 humans and most placental mammals – genome.1 5 Such factors do account for some dissimilarities. compensate for the sex difference in number of X chromosomes However, a major cause of sex-determined expression of (that is, XX females versus XY males) by transcribing only one disease has to do with differences in how males and females of the two female X chromosomes. X-inactivation silences all X transcribe their gene-rich human X chromosomes, which is chromosomes but one; therefore, both males and females have a often underappreciated as a cause of sex differences in single active X.10,11 disease.6 Males are the usual ones affected by X-linked For 46 XY males, that X is the only one they have; it always pathogenic variants.6 Females are biologically superior; a comes from their mother, as fathers contribute their Y female usually has no disease, or much less severe disease chromosome. However, because X chromosomes are silenced than the male with the same variant, unless she is in a random fashion, females usually have two kinds of cells in homozygousforthedeleteriousallele,oritislethalfor every tissue; those with their maternal X active and those with males. an active paternal X. Females are protected to a large extent The X chromosome carries 867 known protein coding because their two X chromosomes most often differ in genetic genes.7 Clearly, pathogenic variants that induce complete loss content. of function may be lethal to fetuses of both sexes; however, a Sex differences in diseases due to deleterious variants number of these pathogenic variants—less severe, or occur- encoded by the X chromosome originate from the sex ring in less-essential genes—cause at least 533 X-linked difference in the expression of the variant allele; if present diseases8 that affect males more severely.8 Rather in male tissues, it is expressed in every cell, but if present in than influencing sexual development, most of these genes female tissues, the variant is usually expressed in only half the play a role in nonreproductive human tissues, including cells (Fig. 1). brain, bone, blood, ears, heart, liver, kidney, retina, skin, and teeth. FEMALES ARE MOSAICS Table 1 provides data about a substantial number of X- A woman is less susceptible to the pathogenic variants in linked disorders obtained in large part from OMIM8 that genes on her active X chromosome because the variant is not confirm the lesser susceptibility of females. The table is not expressed in all her cells.12 all-inclusive, but it provides enough data to show the greater severity of these diseases in males, and to illustrate why FEMALES CAN AMELIORATE THE EFFECTS OF some,butnotall,femaleswiththesameX-linked PATHOGENIC VARIANTS deleterious allele are protected from its effects. This paper Most women do not manifest X-linked disorders because (1) is motivated by the question: When so many women are they are not homozygous for the pathogenic variant, and (2) protected from manifesting severe X-linked diseases, why their variant cells (those expressing the deleterious allele) are some of them susceptible? receive sufficient gene product to carry out the essential 1Departments of Genetic Medicine and Pediatrics, The Johns Hopkins Medical Institutions, Baltimore, MD, USA. Correspondence: Barbara R. Migeon ([email protected]) Submitted 24 September 2019; accepted: 5 March 2020 Published online: 14 April 2020 1156 Volume 22 | Number 7 | July 2020 | GENETICS in MEDICINE 1234567890():,; GENETICS in MEDICINE MIGEON Table. 1 Effect of X-inactivation (XI) on phenotype and cell selection in X-linked disorders. X-linked disease X Map Gene OMIM Phenotype: males Phenotype: females Cell selection Tissue XI skewing assay Aarskog–Scott syndrome Xp11.2 FGD1 305400 Faciogenital dysplasia Subtle features as widows ND allelic with XLMR 16 54,445,453 premature termination; (ocular hypertelorism, peak or short stature truncation shawl scrotum) with Skewing toward mutant attention deficit increases severity (i.e., hyperactivity, also XLID translocation) | FGD1 Volume 22 XLMR 16 Xp11.22 305400 ID only No affected females ND 54,445,453 missense Acrogigantism X-LAG Xq26.3 CD40LG 300942 Microduplications: only Females are like mosaic Microduplications have Lymphocytes AR allelic with X-linked 136,648,176 300386 mosaic males are cited, so males; acrogiantism, but no random XI immunodeficiency with microduplication may be lethal in most immunodeficiency Affected females may not | Number 7 hyper IGM males; mosaic males have Elevated growth hormone & be skewed until older age acrogigantism, but no prolactin immunodeficiency Immunodeficiency with Xq26.3 CD40LG (CD40 ligand on 308230 Decreased IgG, IgA, & IgE; Heterozygotes have normal Not convincing as reports T and B cells & | hyper IGM (HIGM) 136,648,176 T cells) susceptibility to levels of IgG, IgA, IgM, & IgE conflict; it seems that half fibroblasts July 2020 Immunodeficiency 3 variants opportunistic bacterial normal is enough to protect diseases, leading to liver females disease; most have severe infections & shortened life spans Adrenoleukodystrophy Xq28 ABCD1 300100 Demyelinization of brain, Adrenomyeloneuropathy; Yes, gradual. Favors WBC, RBC, skin G6PD & 153,724,850 spinal cord, & adrenals. spastic paraplegia with age mutant allele fibroblasts clones fatty acids Often death in first decade Alport syndrome Xq22.3 COL4A5 301050 End stage renal disease; Milder renal disease Severity related to skewing WBC HPRT & PGK. 108,439,837 hearing loss; ocular Severity related to skewing toward mutant allele Kidney glomeruli COL45A malformations Immunolabel Amelogenesis imperfecta Xp22.2 AMELX 301200 Hypoplastic amelogenesis Vertically grooved teeth; One homozygous female WBC AR 11,293,412 imperfecta; variable depending on was affected like her Mottled teeth (fluoride skew of XI hemizygous father, and independent); more severe than her Homogeneous pattern of heterozygous mother; abnormality mother 25% skewed AMELY expressed at 10% toward mutant, reflected in activity of AMELX degree of grooving Androgen insensitivity Xq12 AR 300068 Feminization or No affected females ND Skin fibroblast Androgen 67,544,020 loss of function hypospadias and Not severe (two clonal clones, both binding hypomorphic micropenis populations, but lower normal and binding in heterozygotes) mutant present Kennedy spinal bulbar & Xq12 AR 313200 36–62 repeats in males; Affected, if homozygous, but ND muscular atrophy 67,544,020 trinucleotide repeat onset: 3rd–5th decade; less affected because of expansion slowly progressive muscle higher androgens in males; atrophy; progressive heterozygotes usually decrease in sperm normal, but some production muscle cramps ATRX syndrome Xq21.1 ATRX 301040 ID, thalassemia, Hemoglobin H inclusions Yes, severe toward wild WBC, AR ɑ-thalessemia/ID syndrome 77,504,877 300032 genital abnormalities Mild retardation, usually type allele buccal smear attributable to variants in unaffected PHD domain REVIEW ARTICLE ɑ-thalessemia Xq21.1 ATRX 300448 Severe variant reducing No affected females Yes, severe toward wild WBC AR Myelodysplastic syndrome 77,504,877 activity to 3–4% normal type allele MR-hypotonic facies Xq21.1 ATRX 309580 Not so severe variants or No affected females Yes, severe toward wild WBC AR syndrome 77,504,877 those in the helical domain type allele No genital abnormalities Barth syndrome Xq28 TAZ 302060 Idiopathic cardiomyopathy No affected females Yes, severe toward wild WBC, fibroblasts AR in obligate 154,411,517 Methylglutaconic type allele heterozygotes aciduria Abnormal mitochondria Death in childhood Borjeson–Forssman–Lehmann Xq26.2-3 PHF6 301900 ID, obesity, Mild ID Yes, severe toward wild WBC FMR1, AR PGK1 syndrome 134,373,311 hypogonadism, epilepsy, 11 females with de novo type allele 1157 facial dysmorphism variants have Coffin–Siris If unskewed, then phenotype all skewed 100% manifesting at least a little 1158 REVIEW ARTICLE Table 1 continued X-linked disease X Map Gene OMIM Phenotype: males Phenotype: females Cell selection Tissue XI skewing assay toward mutant allele, female If skewed severely toward with 70% skewing had mutant, then severe disease milder symptoms Bruton agammaglobulinemia Xq22.1 BTK 300300 B-cell deficiency; boys lack No affected females Yes, severe >95% B cells AR 101,349,446 circulating B cells; they are overcome by bacterial infections Cataract 40 Xp22.1-22.2 NHS
Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
  • CLCN5 Gene Chloride Voltage-Gated Channel 5

    CLCN5 Gene Chloride Voltage-Gated Channel 5

    CLCN5 gene chloride voltage-gated channel 5 Normal Function The CLCN5 gene provides instructions for making a protein called ClC-5 that transports charged atoms (ions) across cell membranes. Specifically, ClC-5 exchanges negatively charged atoms of chlorine (chloride ions) for positively charged atoms of hydrogen ( protons or hydrogen ions). Based on this function, ClC-5 is known as a H+/Cl- exchanger. ClC-5 is found primarily in the kidneys, particularly in structures called proximal tubules. These structures help to reabsorb nutrients, water, and other materials that have been filtered from the bloodstream. The kidneys reabsorb needed materials into the blood and excrete everything else into the urine. Within proximal tubule cells, ClC-5 is embedded in specialized compartments called endosomes. Endosomes are formed at the cell surface to carry proteins and other molecules to their destinations within the cell. ClC-5 transports hydrogen ions into endosomes and chloride ions out, which helps these compartments maintain the proper acidity level (pH). Endosomal pH levels must be tightly regulated for proximal tubule cells to function properly. Health Conditions Related to Genetic Changes Dent disease About 150 mutations in the CLCN5 gene have been found to cause Dent disease 1, a chronic kidney disorder that can cause kidney failure. Most of the mutations lead to the production of an abnormally short, nonfunctional version of ClC-5 or prevent cells from producing any of this protein. A loss of ClC-5 alters the regulation of endosomal pH, which disrupts the overall function of proximal tubule cells and prevents them from reabsorbing proteins and other materials into the bloodstream.
  • Human Identification by Amelogenin Test in Libyans

    Human Identification by Amelogenin Test in Libyans

    American Journal of www.biomedgrid.com Biomedical Science & Research ISSN: 2642-1747 --------------------------------------------------------------------------------------------------------------------------------- Research Article Copyright@ Samir Elmrghni Human Identification by Amelogenin Test in Libyans Samir Elmrghni* and Mahmoud Kaddura Department of Forensic Medicine and Toxicology, University of Benghazi, Libya *Corresponding author: Samir Elmrghni, Faculty of Medicine, Department of Forensic Medicine and Toxicology, University of Benghazi-Libya, Benghazi, Libya. To Cite This Article: Samir Elmrghni. Human Identification by Amelogenin Test in Libyans. Am J Biomed Sci & Res. 2019 - 3(6). AJBSR. MS.ID.000737. DOI: 10.34297/AJBSR.2019.03.000737 Received: May 25, 2019 | Published: July 11, 2019 Abstract Sex typing is essential in medical diagnosis of sex-linked disease and forensic science. Gender for criminal evidence of offender is usually as reported the anomalous amelogenin results of 2 male samples (out of 238 males) represented as females (Y deletions) and another 2 samples the initial information for investigation. For individualization, identification of gender is performed in addition to the STR markers recently. We amelogenin results of the controversial samples, DNA was further used in SRY and Y-STR typing. All samples typed as males but two showed with with (X deletions) in Benghazi (Libya). The frequency in both was about 0.8%. Higher than those of the other populations reported. To confirm X chromosomes. From the results, it was highly suggested that for the controversial cases of human gender identification with amelogenin tests, amplificationKeywords: Amelogenin; of SRY gene Libyans or/and Y-STR markers will be adopted to confirm the gender [1]. Introduction gene (AMG) was precisely mapped in the p22 region on the X systems used to determine if the sample being tested is of male gene was first isolated and sequenced [2].
  • Childhood Cerebral X-Linked Adrenoleukodystrophy with Atypical Neuroimaging Abnormalities and a No…

    Childhood Cerebral X-Linked Adrenoleukodystrophy with Atypical Neuroimaging Abnormalities and a No…

    9/28/2018 Journal of Postgraduate Medicine: Childhood cerebral X-linked adrenoleukodystrophy with atypical neuroimaging abnormalities and a no… Open access journal indexed with Index Medicus & EMBASE Home | Subscribe | Feedback [Download PDF] CASE REPORT Year : 2018 | Volume : 64 | Issue : 1 | Page : 59-63 Childhood cerebral X-linked adrenoleukodystrophy with atypical neuroimaging abnormalities and a novel mutation M Muranjan1, S Karande1, S Sankhe2, S Eichler3, 1 Department of Pediatrics, Seth GS Medical College and KEM Hospital, Parel, Mumbai, Maharashtra, India 2 Department of Radiology, Seth GS Medical College and KEM Hospital, Parel, Mumbai, Maharashtra, India 3 Centogene AG, Schillingallee 68, Rostock, Germany Correspondence Address: Dr. M Muranjan Department of Pediatrics, Seth GS Medical College and KEM Hospital, Parel, Mumbai, Maharashtra India Abstract Childhood cerebral X-linked adrenoleukodystrophy (XALD) typically manifests with symptoms of adrenocortical insufficiency and a variety of neurocognitive and behavioral abnormalities. A major diagnostic clue is the characteristic neuroinflammatory parieto-occipital white matter lesions on magnetic resonance imaging. This study reports a 5-year 10-month old boy presenting with generalized skin hyperpigmentation since 3 years of age. Over the past 9 months, he had developed right-sided hemiparesis and speech and behavioral abnormalities, which had progressed over 5 months to bilateral hemiparesis. Retrospective analyses of serial brain magnetic resonance images revealed an unusual pattern of lesions involving the internal capsules, corticospinal tracts in the midbrain and brainstem, and cerebellar white matter. The clinical diagnosis of childhood cerebral adrenoleukodystrophy was confirmed by elevated basal levels of adrenocorticotropin hormone and plasma very long chain fatty acid levels. Additionally, sequencing of the ABCD1 gene revealed a novel mutation.
  • An Overview of Lesch-Nyhan Syndrome

    An Overview of Lesch-Nyhan Syndrome

    An Overview of Lesch-Nyhan Syndrome Abstract Lesch-Nyhan Syndrome is a disorder that strikes the sufferer with debilitating motor and cognitive problems, hyperuricemia, and the urge to do harm to yourself with acts of self-injurious behavior. Research has lead to the discovery of a genetic sequence that results in a defective enzyme, but researchers are still unsure how this leads to the neurological and behavioral problems that are the hallmark of the disorder. Treatments as simple as wearing oven mitts and as complicated as electrical wiring in the brain have been used to help LNS patients, but no cure for the syndrome seems in sight. Lars Sorensen Prof. Stanley Vitello : IDD : 293:522 : Fall 2008 Rutgers University - Graduate School of Education Introduction In the world of developmental and physical disorders none is stranger than Lesch-Nyhan Syndrome. It brings with it a variety of physical ailments but the defining feature of the condition is behavioral. The sufferer seems to be overtaken with an involuntary uncontrollable compulsion to destroy themselves and those around them. In the autumn of 1962, a young mother brought her four year old son to the pediatric emergency room at Johns Hopkins medical center. The boy had previously been diagnosed with cerebral palsy and could not walk or sit up. He was experiencing pain when he urinated. His mother told the resident who was examining the boy that he had “sand in his diaper” (Preston, 2007). The young boy was admitted to the hospital. The resident and an intern began examining the “sand” from the boy's diaper.
  • (Hunter Syndrome) Complicated by Autoimmune Hemolytic Anemia

    (Hunter Syndrome) Complicated by Autoimmune Hemolytic Anemia

    Bone Marrow Transplantation (2000) 25, 1093–1099 2000 Macmillan Publishers Ltd All rights reserved 0268–3369/00 $15.00 www.nature.com/bmt Case report Unrelated umbilical cord blood transplantation in infancy for mucopolysaccharidosis type IIB (Hunter syndrome) complicated by autoimmune hemolytic anemia CA Mullen1,2, JN Thompson3, LA Richard and KW Chan1 Departments of 1Pediatrics and 2Immunology, University of Texas MD Anderson Cancer Center, Houston, Texas; 3Laboratory of Medical Genetics, University of Alabama at Birmingham, Birmingham, Alabama, USA Summary: a median of 21 years in type IIB.8 Allogeneic BMT has been used to treat Hunter disease, but remains controversial This report describes unrelated umbilical cord blood since it often fails to reverse CNS impairment9–11 and car- transplantation for a 10-month-old infant boy with ries with it substantial early mortality and morbidity. Here, mucopolysaccharidosis IIB (Hunter syndrome), an X- we report treatment of an infant with mucopolysacch- linked metabolic storage disorder due to deficiency of arisosis type IIB with transplantation of unrelated umbilical iduronate sulfatase. Two years after transplant ෂ55% cord blood cells and its complication by autoimmune hemo- normal plasma enzyme activity has been restored and lytic anemia. abnormal urinary excretion of glycosaminoglycans has nearly completely resolved. The boy has exhibited nor- mal growth and development after transplant. Nine Case report months after transplant he developed severe auto- immune hemolytic anemia and required 14 months of The patient is the only child of a couple with a maternal corticosteroid treatment to prevent clinically significant family history of Hunter syndrome. The mother’s brother anemia. Bone marrow transplantation for Hunter syn- was diagnosed with Hunter syndrome in 1979 at age 3 years drome and post-transplant hemolytic anemia are when he exhibited the physical stigmata of the disorder.
  • Hereditary Kidney Disorders

    Hereditary Kidney Disorders

    A. Stavljenić-Rukavina Hereditary kidney disorders How to Cite this article: Hereditary Kidney Disorders- eJIFCC 20/01 2009 http://www.ifcc.org 5. HEREDITARY KIDNEY DISORDERS Ana Stavljenić-Rukavina 5.1 Introduction Hereditary kidney disorders represent significant risk for the development of end stage renal desease (ESRD). Most of them are recognized in childhood, or prenataly particularly those phenotypicaly expressed as anomalies on ultrasound examination (US) during pregnancy. They represent almost 50% of all fetal malformations detected by US (1). Furthermore many of urinary tract malformations are associated with renal dysplasia which leeds to renal failure. Recent advances in molecular genetics have made a great impact on better understanding of underlying molecular mechanisms in different kidney and urinary tract disorders found in childhood or adults. Even some of clinical syndromes were not recognized earlier as genetic one. In monogenic kidney diseases gene mutations have been identified for Alport syndrome and thin basement membrane disease, autosomal dominant polycystic kidney disease, and tubular transporter disorders. There is evident progress in studies of polygenic renal disorders as glomerulopathies and diabetic nephropathy. The expanded knowledge on renal physiology and pathophysiology by analyzing the phenotypes caused by defected genes might gain to earlier diagnosis and provide new diagnostic and prognostic tool. The global increasing number of patients with ESRD urges the identification of molecular pathways involved in renal pathophysiology in order to serve as targets for either prevention or intervention. Molecular genetics nowadays possess significant tools that can be used to identify genes involved in renal disease including gene expression arrays, linkage analysis and association studies.
  • Incontinentia Pigmenti

    Incontinentia Pigmenti

    Incontinentia Pigmenti Authors: Prof Nikolaos G. Stavrianeas1,2, Dr Michael E. Kakepis Creation date: April 2004 1Member of The European Editorial Committee of Orphanet Encyclopedia 2Department of Dermatology and Venereology, A. Sygros Hospital, National and Kapodistrian University of Athens, Athens, Greece. [email protected] Abstract Keywords Definition Epidemiology Etiology Clinical features Course and prognosis Pathology Differential diagnosis Antenatal diagnosis Treatment References Abstract Incontinentia pigmenti (IP) is an X-linked dominant single-gene disorder of skin pigmentation with neurologic, ophthalmologic, and dental involvement. IP is characterized by abnormalities of the tissues and organs derived from the ectoderm and mesoderm. The locus for IP is genetically linked to the factor VIII gene on chromosome band Xq28. Mutations in NEMO/IKK-y, which encodes a critical component of the nuclear factor-kB (NF-kB) signaling pathway, are responsible for IP. IP is a rare disease (about 700 cases reported) with a worldwide distribution, more common among white patients. Characteristic skin lesions are usually present at birth in approximately 90% of patients, or they develop in early infancy. The skin changes evolve in 4 stages in a fixed chronological order. Skin, hair, nails, dental abnormalities, seizures, developmental delay, mental retardation, ataxia, spastic abnormalities, microcephaly, cerebral atrophy, hypoplasia of the corpus callosum, periventricular cerebral edema may occur in more than 50% of reported cases. Ocular defects, atrophic patchy alopecia, dwarfism, clubfoot, spina bifida, hemiatrophy, and congenital hip dislocation, are reported. Treatment of cutaneous lesions is usually not required. Standard wound care should be provided in case of inflammation. Regular dental care is necessary. Pediatric ophthalmologist or retinal specialist consultations are essential.
  • Tooth Enamel and Its Dynamic Protein Matrix

    Tooth Enamel and Its Dynamic Protein Matrix

    International Journal of Molecular Sciences Review Tooth Enamel and Its Dynamic Protein Matrix Ana Gil-Bona 1,2,* and Felicitas B. Bidlack 1,2,* 1 The Forsyth Institute, Cambridge, MA 02142, USA 2 Department of Developmental Biology, Harvard School of Dental Medicine, Boston, MA 02115, USA * Correspondence: [email protected] (A.G.-B.); [email protected] (F.B.B.) Received: 26 May 2020; Accepted: 20 June 2020; Published: 23 June 2020 Abstract: Tooth enamel is the outer covering of tooth crowns, the hardest material in the mammalian body, yet fracture resistant. The extremely high content of 95 wt% calcium phosphate in healthy adult teeth is achieved through mineralization of a proteinaceous matrix that changes in abundance and composition. Enamel-specific proteins and proteases are known to be critical for proper enamel formation. Recent proteomics analyses revealed many other proteins with their roles in enamel formation yet to be unraveled. Although the exact protein composition of healthy tooth enamel is still unknown, it is apparent that compromised enamel deviates in amount and composition of its organic material. Why these differences affect both the mineralization process before tooth eruption and the properties of erupted teeth will become apparent as proteomics protocols are adjusted to the variability between species, tooth size, sample size and ephemeral organic content of forming teeth. This review summarizes the current knowledge and published proteomics data of healthy and diseased tooth enamel, including advancements in forensic applications and disease models in animals. A summary and discussion of the status quo highlights how recent proteomics findings advance our understating of the complexity and temporal changes of extracellular matrix composition during tooth enamel formation.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • ATRX Protects Cells Against Replication-Induced Genomic Instability

    ATRX Protects Cells Against Replication-Induced Genomic Instability

    ATRX Protects Cells Against Replication-Induced Genomic Instability Danton Ivanochko M.Sc. Thesis This thesis is submitted to the Faculty of Graduate and Postdoctoral Studies in partial fulfillment of the requirements for the degree of Master of Science in Biochemistry with a specialization in Human and Molecular Genetics Department of Biochemistry, Microbiology, and Immunology Faculty of Medicine University of Ottawa, Ontario, Ontario, Canada © Danton Ivanochko, Ottawa, Canada, 2016 Dedicated to my parents. ii Abstract Expansive proliferation of neural progenitor cells (NPCs) is a prerequisite to the temporal waves of neuronal differentiation that generate the six-layered cerebral cortex. NPC expansion places a heavy burden on proteins that regulate chromatin packaging and genome integrity, which is further reflected by the growing number of developmental disorders caused by mutations in chromatin regulators. Accordingly, mutations in ATRX, a chromatin remodelling protein required for heterochromatin maintenance at telomeres and simple repeats, cause the ATR-X syndrome. Here, we demonstrate that proliferating ATRX-null cells accumulate DNA damage, while also exhibiting sensitivity to hydroxyurea-induced replication fork stalling. Specifically, PARP1 hyperactivation and replication-dependent double strand DNA breakage indicated replication fork protection defects, while DNA fiber assays confirmed that ATRX was required to protect replication forks from degradation. Interestingly, inhibition of the exonuclease MRE11 by the small molecule mirin could prevent degradation. Thus, ATRX is required to limit replication stress during NPC expansion. iii Acknowledgements First and foremost, I would like to thank my supervisor, Dr. David Picketts, for his guidance and support during my undergraduate and graduate studies. Thanks to the members of my thesis advisory committee, Dr.
  • Covid-19 and Ectodermal Dysplasia Article

    Covid-19 and Ectodermal Dysplasia Article

    COVID-19 and ectodermal dysplasias. Recommendations are necessary. Michele Callea: Unit of Dentistry, Bambino Gesù Children's Hospital, IRCCS, Rome, Italy [email protected] Colin Eric Willoughby: Ulster University and Belfast Health and Social Care Trust, NI, UK [email protected] Diana Perry: UK Ectodermal Dysplasia Society President [email protected] Ulrike Holzer: Leader of EDIN Ectodermal Dysplasia International Network. Austria [email protected] Giulia Fedele: Presidente ANDE, Associazione Nazionale Displasia Ectodermica. Italy [email protected] Antonio Cárdenas Tadich: Pediatrics Service, Regional Hospital of Antofagasta, Chile [email protected] Francisco Cammarata-Scalisi: Pediatrics Service, Regional Hospital of Antofagasta, Chile [email protected] Conflict of interest: None Running title: COVID-19 and ectodermal dysplasias Sources of support if any: None Disclaimer: “We confirm that the manuscript has been read and approved by all the authors, that the requirements for authorship as stated earlier in this document have been met, and that each author believes that the manuscript represents honest work” Corresponding author: This article has been accepted for publication and undergone full peer review but has not been through the copyediting, typesetting, pagination and proofreading process which may lead to differences between this version and the Version of Record.This Please article cite this is protected article as doi:by copyright. 10.1111/dth.13702 All rights reserved. Francisco Cammarata-Scalisi: