DOCSLIB.ORG

SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. E2F4, ABL1, BCAR1, BCR, CDCP1, DRD4, ERBB2, ETS1, ETS2, GJA1, GJB1, HNRNPK, KHDRBS1, MUC1, PDE4D, PDGFRB, PTK2, PTK2, PTPN2, RGS16, SHB, SHC1, SRC, ABL1, ACTN1, ADAM12, ADAM15, ADRB2, ADRB3, ADRBK1, AFAP1, AFAP1L2, AKT1, ANKRD11, ANXA1, ANXA2, AR, ARHGAP1, ARHGAP32, ARHGAP35, ARR3, ASAP1, ATP2B4, AXL, BCAR1, BCR, BMX, CAV1, CAV2, CBL, CBLC, CD2AP, CD33, CD36, CD46, CD59, CDCP1, CDH5, CDK5, CDKN1B, CEACAM1, CEACAM3, CHUK, CNTNAP1, CSK, CTNNB1, CTNND1, CTTN, DAB1, DAB2, DAG1, DAPP1, DDR2, DGKA, DGKZ, DLG4, DNM1, DNM2, DOK1, DOK2, DOK4, EFNB1, EFNB2, EGFR, EPHB2, EPS8, ERBB2, ESR1, ESR2, ETS1, ETS2, EVL, FARP2, FASLG, FGR, FHIT, FOXO1, FRS2, FYB, GAB2, GAB3, GFAP, GIT1, GJA1, GJB1, GNB2L1, GRB10, GRB2, GRIN2A, GRIN2B, GTF2I, GUCY2C, HLA-A, HLA-B, HNF1A, HNRNPK, HRAS, HSP90AA1, IGF1R, IKBKB, IKBKG, IL6R, INPPL1, INSR, ITGB3, JUP, KCNA5, KCNB1, KCNQ5, KDR, KHDRBS1, KIFAP3, KIT, LRP1, MAPK15, MATK, MED28, MET, MPZL1, MST1R, MUC1, MYLK, ND2, NFKBIA, NMT1, NOS2, NPHS1, NR1I2, P2RY2, PAK2, PDCD6IP, PDE6G, PDGFRB, PDPK1, PECAM1, PGR, PIK3R1, PKD1, PLCG1, PPARD, PPP2R4, PRKACA, PRKCA, PRKCD, PRKCE, PRKCH, PRKCI, PRKCZ, PRKD1, PTK2, PTK2B, PTPN1, PTPN11, PTPN18, PTPN2, PTPN21, PTPN6, PTPRA, PTPRE, Partner Proteins PXN, RAF1, RASA1, RET, RGS16, RXRA, SH2D3C, SH3BP1, SH3PXD2A, SHB, SHC1, SKAP1, SLC9A2, SMARCB1, SMARCE1, SPTAN1, SRC, SRF, STAP2, STAT1, STAT3, STAT5A, STAT5B, STAT6, SYK, SYN1, TERT, THRA, TIAM1, TNFRSF11A, TRAF1, TRAF3, TRAF6, TRAT1, TRIP10, TRIP6, TRPC6, TRPV4, TUB, TXK, TYRO3, VCL, VIL1, WAS, WBP11, WWOX, YTHDC1, YWHAB, YWHAE, YWHAG, YWHAH, ABL1, ADRB2, ADRB3, ADRBK1, AHR, AR, ARHGAP1, ARHGAP17, ARHGAP32, ARHGAP32, ARNT, ARR3, ASAP1, ASAP2, AXL, Adrb3, BCAR1, BMX, BRCA1, CARM1, CAV1, CAV2, CBL, CBL, CD44, CD46, CDC25C, CDC37, CDH1, CREBBP, CRK, CSF1R, CSK, CTNND1, DAB2, DAG1, DDR2, DOCK1, DOK1, DOK4, EFNA5, EFNB1, EGFR, EP300, EPHA3, EPHA4, EPHB2, EPS8, ERBB2, ESR1, ESR2, ETS1, ETS2, EVL, FGFR1, FLNA, FOXO1, FYN, GAB2, GAB3, GNB2L1, GRB10, GRB2, GRIN2A, GSN, HCK, HDAC3, HNF1A, HSP82, HSP90AA1, ITK, KHDRBS1, KIFAP3, LRP1, LYN, MAP2, MAPK8IP3, MATK, MET, MICAL1, MPZL1, MUC1, MYLK, NCOA6, ND2, NR3C1, NR4A1, PDE6G, PDGFRB, PECAM1, PELP1, PIK3R1, PLCG1, PLD1, PLD2, PLSCR1, PPARA, PPARD, PPARGC1B, PRDM2, PRKCZ, PTK2, PTK2B, PTPN21, PTPRA, PXN, RAF1, RARA, RASA1, RET, RPL10, RPS6KB1, RPS6KB2, RXRA, SF1, SH3BP1, SHB, SKAP1, SLC9A2, SMAD3, SMARCC1, SNURF, SNW1, SRF, STAT1, STAT3, SYK, SYN1, THRA, THRB, TNFSF11, TRAF1, TRAF3, TRAF6, TRIP4, TRIP6, TRPC6, TRPV4, TYRO3, VDR, WAS, nef Reconstitution and Add 50 ul of distilled water. Final anti-SRC antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-SRC antibody is Catalog # AAP32476 (Previous Catalog # AAPP03475) Immunogen The immunogen for anti-SRC antibody: synthetic peptide directed towards the N terminal of human SRC Swissprot Id P12931 Swissprot Id P12931 Protein Name Proto-oncogene tyrosine-protein kinase Src Protein Accession # NP_005408 Purification Affinity Purified Species Reactivity Bovine, Dog, Pig, Rabbit, Guinea pig, Mouse, Human, Rat Application WB Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% Sequence Human 293T WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/ml Image 1 ELISA Titer: 1:312500 Positive Control: 293T cell lysate __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Load more

Recommended publications
  • Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB
    Table S1. Kinase clones included in human kinase cDNA library for yeast two-hybrid screening Gene Symbol Gene Description ACVR1B activin A receptor, type IB ADCK2 aarF domain containing kinase 2 ADCK4 aarF domain containing kinase 4 AGK multiple substrate lipid kinase;MULK AK1 adenylate kinase 1 AK3 adenylate kinase 3 like 1 AK3L1 adenylate kinase 3 ALDH18A1 aldehyde dehydrogenase 18 family, member A1;ALDH18A1 ALK anaplastic lymphoma kinase (Ki-1) ALPK1 alpha-kinase 1 ALPK2 alpha-kinase 2 AMHR2 anti-Mullerian hormone receptor, type II ARAF v-raf murine sarcoma 3611 viral oncogene homolog 1 ARSG arylsulfatase G;ARSG AURKB aurora kinase B AURKC aurora kinase C BCKDK branched chain alpha-ketoacid dehydrogenase kinase BMPR1A bone morphogenetic protein receptor, type IA BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) BRAF v-raf murine sarcoma viral oncogene homolog B1 BRD3 bromodomain containing 3 BRD4 bromodomain containing 4 BTK Bruton agammaglobulinemia tyrosine kinase BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) C9orf98 chromosome 9 open reading frame 98;C9orf98 CABC1 chaperone, ABC1 activity of bc1 complex like (S. pombe) CALM1 calmodulin 1 (phosphorylase kinase, delta) CALM2 calmodulin 2 (phosphorylase kinase, delta) CALM3 calmodulin 3 (phosphorylase kinase, delta) CAMK1 calcium/calmodulin-dependent protein kinase I CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha CAMK2B calcium/calmodulin-dependent
    [Show full text]
  • Interplay Between Coding and Exonic Splicing Regulatory Sequences
    Downloaded from genome.cshlp.org on October 4, 2021 - Published by Cold Spring Harbor Laboratory Press Research Interplay between coding and exonic splicing regulatory sequences Nicolas Fontrodona,1,4 Fabien Aubé,1,4 Jean-Baptiste Claude,1 Hélène Polvèche,1,5 Sébastien Lemaire,1 Léon-Charles Tranchevent,2 Laurent Modolo,3 Franck Mortreux,1 Cyril F. Bourgeois,1 and Didier Auboeuf1 1Université Lyon, ENS de Lyon, Université Claude Bernard, CNRS UMR 5239, INSERM U1210, Laboratory of Biology and Modelling of the Cell, F-69007, Lyon, France; 2Proteome and Genome Research Unit, Department of Oncology, Luxembourg Institute of Health (LIH), L-1445 Strassen, Luxembourg; 3LBMC Biocomputing Center, CNRS UMR 5239, INSERM U1210, F-69007, Lyon, France The inclusion of exons during the splicing process depends on the binding of splicing factors to short low-complexity reg- ulatory sequences. The relationship between exonic splicing regulatory sequences and coding sequences is still poorly un- derstood. We demonstrate that exons that are coregulated by any given splicing factor share a similar nucleotide composition bias and preferentially code for amino acids with similar physicochemical properties because of the nonran- domness of the genetic code. Indeed, amino acids sharing similar physicochemical properties correspond to codons that have the same nucleotide composition bias. In particular, we uncover that the TRA2A and TRA2B splicing factors that bind to adenine-rich motifs promote the inclusion of adenine-rich exons coding preferentially for hydrophilic amino acids that correspond to adenine-rich codons. SRSF2 that binds guanine/cytosine-rich motifs promotes the inclusion of GC-rich exons coding preferentially for small amino acids, whereas SRSF3 that binds cytosine-rich motifs promotes the inclusion of exons coding preferentially for uncharged amino acids, like serine and threonine that can be phosphorylated.
    [Show full text]
  • Splicing Regulatory Factors in Breast Cancer Hallmarks and Disease Progression
    www.oncotarget.com Oncotarget, 2019, Vol. 10, (No. 57), pp: 6021-6037 Review Splicing regulatory factors in breast cancer hallmarks and disease progression Esmee Koedoot1, Liesanne Wolters1, Bob van de Water1 and Sylvia E. Le Dévédec1 1Division of Drug Discovery and Safety, LACDR, Leiden University, Leiden, The Netherlands Correspondence to: Sylvia E. Le Dévédec, email: [email protected] Keywords: hallmarks of cancer; breast cancer; alternative splicing; splice factors; RNA sequencing Received: April 23, 2019 Accepted: August 29, 2019 Published: October 15, 2019 Copyright: Koedoot et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT By regulating transcript isoform expression levels, alternative splicing provides an additional layer of protein control. Recent studies show evidence that cancer cells use different splicing events to fulfill their requirements in order to develop, progress and metastasize. However, there has been less attention for the role of the complex catalyzing the complicated multistep splicing reaction: the spliceosome. The spliceosome consists of multiple sub-complexes in total comprising 244 proteins or splice factors and 5 associated RNA molecules. Here we discuss the role of splice factors in the oncogenic processes tumors cells need to fulfill their oncogenic properties (the so-called the hallmarks of cancer). Despite the fact that splice factors have been investigated only recently, they seem to play a prominent role in already five hallmarks of cancer: angiogenesis, resisting cell death, sustaining proliferation, deregulating cellular energetics and invasion and metastasis formation by affecting major signaling pathways such as epithelial-to-mesenchymal transition, the Warburg effect, DNA damage response and hormone receptor dependent proliferation.
    [Show full text]
  • University of Groningen BRCA2 Deficiency Instigates Cgas
    University of Groningen BRCA2 deficiency instigates cGAS-mediated inflammatory signaling and confers sensitivity to tumor necrosis factor-alpha-mediated cytotoxicity Heijink, Anne Margriet; Talens, Francien; Jae, Lucas T; van Gijn, Stephanie E; Fehrmann, Rudolf S N; Brummelkamp, Thijn R; van Vugt, Marcel A T M Published in: Nature Communications DOI: 10.1038/s41467-018-07927-y IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's PDF) if you wish to cite from it. Please check the document version below. Document Version Publisher's PDF, also known as Version of record Publication date: 2019 Link to publication in University of Groningen/UMCG research database Citation for published version (APA): Heijink, A. M., Talens, F., Jae, L. T., van Gijn, S. E., Fehrmann, R. S. N., Brummelkamp, T. R., & van Vugt, M. A. T. M. (2019). BRCA2 deficiency instigates cGAS-mediated inflammatory signaling and confers sensitivity to tumor necrosis factor-alpha-mediated cytotoxicity. Nature Communications, 10(1), [100]. https://doi.org/10.1038/s41467-018-07927-y Copyright Other than for strictly personal use, it is not permitted to download or to forward/distribute the text or part of it without the consent of the author(s) and/or copyright holder(s), unless the work is under an open content license (like Creative Commons). The publication may also be distributed here under the terms of Article 25fa of the Dutch Copyright Act, indicated by the “Taverne” license. More information can be found on the University of Groningen website: https://www.rug.nl/library/open-access/self-archiving-pure/taverne- amendment.
    [Show full text]
  • Stefano Sellitto 19-05-2020.Pdf
    RNA Binding Proteins: from physiology to pathology An update Stefano Sellitto RBPs regulate the RNA metabolism A ‘conventional’ RNA-Binding Protein (RBP) participates in the formation of ribonucleoprotein (RNP) complexes that are principally involved in gene expression. Keene, 2007 High-Throughuput sequencing to study the RBPs world RIP-Seq (i)CLIP PAR-CLIP Hentze et al., 2018 The concept of RNA operon The RBPs profile is highly dynamic The combinatorial association of many RBPs acting in trans on RNA molecules results in the metabolic regulation of a distinct RNA subpopulations. Keene, 2007 The molecular features of protein-RNA interactions "Classical" RNA-Binding Domains Lunde et al., 2007 "Classical" RNA-Binding Domains RNA-recognition motif (RRM) double-stranded RNA-binding motif (dsRBM) Zinc-finger motif Stefl et al., 2005 Modularity of RBPs RBPs are usually composed by several repeated domains Lunde et al., 2007 Expanding the concept of the RNA Binding Hentze et al., 2018 Novel types of RNA binding Hentze et al., 2018 Lunde et al., 2007 RNA metabolism and neurological diseases RNA binding proteins preserves neuronal integrity De Conti et al., 2017 Alterations of RBPs in neurological disorders Nussbacher et al., 2019 Microsatellite expansion in FXS: reduced FMR1 transcription The reduction of FMRP levels induces an overexpressed LTD activity Bassell & Warren, 2008 Huber et al., 2002 Microsatellite expansion in FXTAS: FMR1 RNA-meidated toxicity FMR1 expanded RNA impairs the miRNA processing Sellier et al., 2013 Loss-of-function VS Gain-of-function Park et al., 2015 TDP-43 and FUS/TLS Ling et al., 2013 TDP-43 and FUS/TLS in ALS and FTD Ling et al., 2013 Cookson, 2017 Loss-of-function VS Gain-of-function Nucelar clearance (LOF) TDP-43 Nuclear TDP-43 (LOF) Loss of TDP-43 negative autoregulation Nucleus Abolishing RNA binding ability Cytoplasmatic stress (GOF) mitigates mutant TDP-43 toxicity Prevent mutant TDP-43 toxic activity on RNAs (GOF) Ihara et al., 2013 .
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Review Tec Kinases: a Family with Multiple Roles in Immunity
    Immunity, Vol. 12, 373±382, April, 2000, Copyright 2000 by Cell Press Tec Kinases: A Family Review with Multiple Roles in Immunity Wen-Chin Yang,*³§ Yves Collette,*³ inositol phosphates, but they are thought to be relevant Jacques A. NuneÁ s,*³ and Daniel Olive*² for binding of PtdIns lipids to the same sites. In most *INSERM U119 cases, PH domains bind preferentially to PtdIns (4,5)P2 Universite de la Me diterrane e and inositol (1,4,5) P3 (Ins (1,4,5) P3). However, the Btk 13009 Marseille PH domain binds PtdIns (3,4,5)P3 and Ins (1, 3, 4, 5)P4 France the tightest. PtdIns (3, 4, 5)P3, one of the products of the action of PI3K, is thought to act as a second messen- ger to recruit regulatory proteins to the plasma mem- brane via their PH domains (see below). Many of the Antigen receptors on T, B, and mast cells are multimo- mutations in Btk that lead to XLA are point mutations lecular complexes that are activated by interactions with that cluster at one end of the PH domain and could be external signals. These signals are then transmitted to predicted to impair binding to Ins (3,4,5)P (for review regulate gene expression and posttranscriptional modi- 3 see Satterthwaite et al., 1998a) (Figure 1b). Similarly, fications. Nonreceptor tyrosine kinases (NRTK) are key CBA/N xid mice carry an R28C mutation in the Btk PH players that relay and integrate these signals. NRTK are domain. The recent structure of the PH domain from divided into distinct families defined by a prototypic Btk complexed with Ins (1,3,4,5)P4 provides an explana- member: Src, Tec, Syk, Csk, Fes, Abl, Jak, Fak, Ack, tion for several mutations associated with XLA: mis- Brk, and Srm (Bolen and Brugge, 1997).
    [Show full text]
  • Systematic Description of the Expression and Prognostic Value of M6A Regulators in Human Ovarian Cancer
    Systematic Description of the Expression and Prognostic Value of M6A Regulators in Human Ovarian Cancer Yuwei Chen Fujian Medical University Fujian Cancer Hospital Yang Sun ( [email protected] ) Fujian Cancer Hospital https://orcid.org/0000-0003-4224-8832 Xinbei Chen Fujian Medical University Fujian Cancer Hospital Siming Li Fujian Medical University Fujian Cancer Hospital Hongmei Xia Fujian Cancer Hospital Research Keywords: m6A regulators, m6A, ovarian cancer, Prognostic values, bioinformatics analysis. Posted Date: December 22nd, 2020 DOI: https://doi.org/10.21203/rs.3.rs-131682/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Systematic description of the expression and prognostic value of m6A regulators in human ovarian cancer 1 Yuwei Chen1, Yang Sun1*, Xinbei Chen1, Siming Li1, Hongmei Xia1 2 * Correspondence: 3 Yang Sun 4 [email protected] 5 Total words：5253 6 Total Figures and Tables: 11 Figures and 3 Tables 7 Keywords: m6A regulators, m6A, ovarian cancer, Prognostic values, 8 bioinformatics analysis. 9 Abstract 10 Background: N6-methyladenine (m6A) methylation, known as a kind of RNA 11 methylation regulator, has become a hotspot for research in the life sciences in recent 12 years. The existing studies revealed that m6A regulators helped to regulate the 13 progression of several malignant tumors. However, the expression mode and 14 prognostic value of m6A regulators in ovarian cancer have not been fully elucidated. 15 Methods: ONCOMINE, GEPIA, Human protein atlas, Kaplan-meier, UALCAN, 16 cBioPortal, GeneMANIA, DAVID, Sring, and Metascape were utilized in this study. 17 Results: In this study, through a comprehensive use of multiple database systems, 18 m6A regulators-induced mRNA and protein expression levels and their prognostic 19 value in the epithelial ovarian cancer of various histological types were analyzed.
    [Show full text]
  • Save Pdf (0.04
    58 cambridge.org/jcts 2172 with these clinical observations, we observed altered myelopoiesis in HnrnpkTg mice. These mice demonstrate increased CD11b + Gr1 + populations in the Association between CYP450 polymorphisms and the bone marrow and peripheral blood. Indeed, these mice develop myeloid use of complementary medicine among patients with leukemia, indicated by >20% of circulating white blood cells harboring markers drug-resistant epilepsy in Puerto Rico of immature stem cells in conjunction with positive myeloperoxidase staining Bianca A. Torres-Hernández, Miriam E. Ríos Motta, Adrián Llerenaes and blast-appearing morphology. RPPA revealed expression of c-Myc positively correlated with increased hnRNP K levels. In HnrnpkTg mice, c-Myc protein and Jorge Duconge was increased, yet MYC RNA was invariably decreased compared to wildtype. University of Puerto Rico-Medical Sciences Campus, San Juan, Puerto To decipher a mechanism by which this may occur, we demonstrated a post- Rico transcriptional interaction between hnRNP K and c-Myc in vivo. JQ1, a BRD4 inhibitor, that epigenetically decreases c-Myc expression showed preferential activity against myeloid cells expressing high levels of hnRNP K both in vitro and OBJECTIVES/SPECIFIC AIMS: Patients with epilepsy often combine their in vivo. DISCUSSION/SIGNIFICANCE OF IMPACT: These preliminary studies antiepileptic drugs (AEDs) with complementary medicine (CM). They use CM demonstrate that hnRNP K overexpression causes myeloid malignancies in to treat their symptoms of comorbidities disorder, to reduce the side effect of both mouse and man. We have determined that c-Myc contributes in part to the AEDs or trying to achieve better control of their seizures. However, the hnRNP K-mediated leukemogenesis, and that targeting c-Myc may be an inconsistent patters of the use of CM among countries have been attributed to effective strategy for hnRNP K-overexpressing AML.
    [Show full text]
  • Transcriptional Regulation of Kinases Downstream of the T Cell Receptor
    Petrillo et al. BMC Pharmacology and Toxicology 2014, 15:35 http://www.biomedcentral.com/2050-6511/15/35 RESEARCH ARTICLE Open Access Transcriptional regulation of kinases downstream of the T cell receptor: another immunomodulatory mechanism of glucocorticoids Maria Grazia Petrillo1†, Katia Fettucciari2†, Paolo Montuschi3†, Simona Ronchetti1, Luigi Cari1, Graziella Migliorati1, Emanuela Mazzon4, Oxana Bereshchenko1, Stefano Bruscoli1, Giuseppe Nocentini1,5* and Carlo Riccardi1 Abstract Background: Glucocorticoids affect peripheral immune responses, including modulation of T-cell activation, differentiation, and apoptosis. The quantity and quality of T-cell receptor (TCR)-triggered intracellular signals modulate T-cell function. Thus, glucocorticoids may affect T cells by interfering with the TCR signaling cascade. The purpose of the study was to search for glucocorticoid-modulated kinases downstream of the TCR. Methods: Gene modulation in lymphoid cells either treated with glucocorticoids or from glucocorticoid-treated mice was studied using a RNase protection assay, real-time PCR, and western blotting. The sensitivity of genetically modified thymocytes to glucocorticoid-induced apoptosis was studied by performing hypotonic propidium iodide staining and flow cytometry. The Student’s t-test was employed for statistical evaluation. Results: We found that transcription of Itk, a non-receptor tyrosine kinase of the Tec family, was up-regulated in a mouse T-cell hybridoma by the synthetic glucocorticoid dexamethasone. In contrast, dexamethasone down-regulated the expression of Txk, a Tec kinase that functions redundantly with Itk, and Lck, the Src kinase immediately downstream of the TCR. We investigated the expression of Itk, Txk,andLck in thymocytes and mature lymphocytes following in vitro and in vivo dexamethasone treatment at different time points and doses.
    [Show full text]
  • Stimulation of Endogenous GH and Interleukin-6 Receptors Selectively Activates Different Jaks and Stats, with a Stat5 Specific Synergistic Effect of Dexamethasone
    301 Stimulation of endogenous GH and interleukin-6 receptors selectively activates different Jaks and Stats, with a Stat5 specific synergistic effect of dexamethasone S von Laue1, J Finidori3, M Maamra1, X-Y Shen1, S Justice1, P R M Dobson2 and R J M Ross1 1Division of Clinical Sciences, University of Sheffield, UK 2Institute for Cancer Studies, University of Sheffield, UK 3INSERM, Unité 344, Faculté de Médecine Necker, Paris, France (Requests for offprints should be addressed to S von Laue, INSERM U344, Laboratoire d’Endocrinologie Moléculaire, Faculté de Médecine Necker-Enfants Malades, 156, rue de Vaugirard, 75 730 Paris cedex 15, France; Email: [email protected]) Abstract The interaction of GH, interleukin (IL)-6 and glucocorti- Stat3 activation. In contrast, the reporter gene containing coids is likely to be important in regulating the GH- the Stat3 responsive element (SIE) was IL-6 specific. The insulin-like growth factor (IGF)-I axis. The signalling levels of gene induction by GH and IL-6 were not altered cascades activated by GH and IL-6 appear to be very by the co-stimulation with GH and IL-6, suggesting that similar, as demonstrated by studies using overexpression of there is little cross-talk at the Jak–Stat activation level the receptor and other components of the Jak-Stat and between the two cytokines. Neither GH nor IL-6 acti- mitogen-activated protein (MAP) kinase pathways. Here vated the MAP-kinase responsive serum response element we show that the human embryonic kidney cell line 293 (SRE), unless GH receptors or gp130 were overexpressed. (HEK293) expresses GH and IL-6 receptors endogenously.
    [Show full text]
  • New Developments in Charcot–Marie–Tooth Neuropathy and Related Diseases
    CE: Alpana; WCO 300505; Total nos of Pages: 10; WCO 300505 REVIEW CURRENT OPINION New developments in Charcot–Marie–Tooth neuropathy and related diseases Davide Pareyson, Paola Saveri, and Chiara Pisciotta Purpose of review Charcot–Marie–Tooth disease (CMT) and related neuropathies represent a heterogeneous group of hereditary disorders. The present review will discuss the most recent advances in the field. Recent findings Knowledge of CMT epidemiology and frequency of the main associated genes is increasing, with an overall prevalence estimated at 10–28/100 000. In the last years, the huge number of newly uncovered genes, thanks to next-generation sequencing techniques, is challenging the current classification of CMT. During the last 18 months other genes have been associated with CMT, such as PMP2, MORC2, NEFH, MME, and DGAT2. For the most common forms of CMT, numerous promising compounds are under study in cellular and animal models, mainly targeting either the protein degradation pathway or the protein overexpression. Consequently, efforts are devoted to develop responsive outcome measures and biomarkers for this overall slowly progressive disorder, with quantitative muscle MRI resulting the most sensitive-to-change measure. Summary This is a rapidly evolving field where better understanding of pathophysiology is paving the way to develop potentially effective treatments, part of which will soon be tested in patients. Intense research is currently devoted to prepare clinical trials and develop responsive outcome measures. Keywords
    [Show full text]