SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. E2F4, ABL1, BCAR1, BCR, CDCP1, DRD4, ERBB2, ETS1, ETS2, GJA1, GJB1, HNRNPK, KHDRBS1, MUC1, PDE4D, PDGFRB, PTK2, PTK2, PTPN2, RGS16, SHB, SHC1, SRC, ABL1, ACTN1, ADAM12, ADAM15, ADRB2, ADRB3, ADRBK1, AFAP1, AFAP1L2, AKT1, ANKRD11, ANXA1, ANXA2, AR, ARHGAP1, ARHGAP32, ARHGAP35, ARR3, ASAP1, ATP2B4, AXL, BCAR1, BCR, BMX, CAV1, CAV2, CBL, CBLC, CD2AP, CD33, CD36, CD46, CD59, CDCP1, CDH5, CDK5, CDKN1B, CEACAM1, CEACAM3, CHUK, CNTNAP1, CSK, CTNNB1, CTNND1, CTTN, DAB1, DAB2, DAG1, DAPP1, DDR2, DGKA, DGKZ, DLG4, DNM1, DNM2, DOK1, DOK2, DOK4, EFNB1, EFNB2, EGFR, EPHB2, EPS8, ERBB2, ESR1, ESR2, ETS1, ETS2, EVL, FARP2, FASLG, FGR, FHIT, FOXO1, FRS2, FYB, GAB2, GAB3, GFAP, GIT1, GJA1, GJB1, GNB2L1, GRB10, GRB2, GRIN2A, GRIN2B, GTF2I, GUCY2C, HLA-A, HLA-B, HNF1A, HNRNPK, HRAS, HSP90AA1, IGF1R, IKBKB, IKBKG, IL6R, INPPL1, INSR, ITGB3, JUP, KCNA5, KCNB1, KCNQ5, KDR, KHDRBS1, KIFAP3, KIT, LRP1, MAPK15, MATK, MED28, MET, MPZL1, MST1R, MUC1, MYLK, ND2, NFKBIA, NMT1, NOS2, NPHS1, NR1I2, P2RY2, PAK2, PDCD6IP, PDE6G, PDGFRB, PDPK1, PECAM1, PGR, PIK3R1, PKD1, PLCG1, PPARD, PPP2R4, PRKACA, PRKCA, PRKCD, PRKCE, PRKCH, PRKCI, PRKCZ, PRKD1, PTK2, PTK2B, PTPN1, PTPN11, PTPN18, PTPN2, PTPN21, PTPN6, PTPRA, PTPRE, Partner Proteins PXN, RAF1, RASA1, RET, RGS16, RXRA, SH2D3C, SH3BP1, SH3PXD2A, SHB, SHC1, SKAP1, SLC9A2, SMARCB1, SMARCE1, SPTAN1, SRC, SRF, STAP2, STAT1, STAT3, STAT5A, STAT5B, STAT6, SYK, SYN1, TERT, THRA, TIAM1, TNFRSF11A, TRAF1, TRAF3, TRAF6, TRAT1, TRIP10, TRIP6, TRPC6, TRPV4, TUB, TXK, TYRO3, VCL, VIL1, WAS, WBP11, WWOX, YTHDC1, YWHAB, YWHAE, YWHAG, YWHAH, ABL1, ADRB2, ADRB3, ADRBK1, AHR, AR, ARHGAP1, ARHGAP17, ARHGAP32, ARHGAP32, ARNT, ARR3, ASAP1, ASAP2, AXL, Adrb3, BCAR1, BMX, BRCA1, CARM1, CAV1, CAV2, CBL, CBL, CD44, CD46, CDC25C, CDC37, CDH1, CREBBP, CRK, CSF1R, CSK, CTNND1, DAB2, DAG1, DDR2, DOCK1, DOK1, DOK4, EFNA5, EFNB1, EGFR, EP300, EPHA3, EPHA4, EPHB2, EPS8, ERBB2, ESR1, ESR2, ETS1, ETS2, EVL, FGFR1, FLNA, FOXO1, FYN, GAB2, GAB3, GNB2L1, GRB10, GRB2, GRIN2A, GSN, HCK, HDAC3, HNF1A, HSP82, HSP90AA1, ITK, KHDRBS1, KIFAP3, LRP1, LYN, MAP2, MAPK8IP3, MATK, MET, MICAL1, MPZL1, MUC1, MYLK, NCOA6, ND2, NR3C1, NR4A1, PDE6G, PDGFRB, PECAM1, PELP1, PIK3R1, PLCG1, PLD1, PLD2, PLSCR1, PPARA, PPARD, PPARGC1B, PRDM2, PRKCZ, PTK2, PTK2B, PTPN21, PTPRA, PXN, RAF1, RARA, RASA1, RET, RPL10, RPS6KB1, RPS6KB2, RXRA, SF1, SH3BP1, SHB, SKAP1, SLC9A2, SMAD3, SMARCC1, SNURF, SNW1, SRF, STAT1, STAT3, SYK, SYN1, THRA, THRB, TNFSF11, TRAF1, TRAF3, TRAF6, TRIP4, TRIP6, TRPC6, TRPV4, TYRO3, VDR, WAS, nef Reconstitution and Add 50 ul of distilled water. Final anti-SRC antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-SRC antibody is Catalog # AAP32476 (Previous Catalog # AAPP03475) Immunogen The immunogen for anti-SRC antibody: synthetic peptide directed towards the N terminal of human SRC Swissprot Id P12931 Swissprot Id P12931 Protein Name Proto-oncogene tyrosine-protein kinase Src Protein Accession # NP_005408 Purification Affinity Purified Species Reactivity Bovine, Dog, Pig, Rabbit, Guinea pig, Mouse, Human, Rat Application WB Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% Sequence Human 293T WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/ml Image 1 ELISA Titer: 1:312500 Positive Control: 293T cell lysate __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-