Systematic Description of the Expression and Prognostic Value of M6A Regulators in Human Ovarian Cancer

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Systematic Description of the Expression and Prognostic Value of M6A Regulators in Human Ovarian Cancer Yuwei Chen Fujian Medical University Fujian Cancer Hospital Yang Sun ( [email protected] ) Fujian Cancer Hospital https://orcid.org/0000-0003-4224-8832 Xinbei Chen Fujian Medical University Fujian Cancer Hospital Siming Li Fujian Medical University Fujian Cancer Hospital Hongmei Xia Fujian Cancer Hospital Research Keywords: m6A regulators, m6A, ovarian cancer, Prognostic values, bioinformatics analysis. Posted Date: December 22nd, 2020 DOI: https://doi.org/10.21203/rs.3.rs-131682/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Systematic description of the expression and prognostic value of m6A regulators in human ovarian cancer 1 Yuwei Chen1, Yang Sun1*, Xinbei Chen1, Siming Li1, Hongmei Xia1 2 * Correspondence: 3 Yang Sun 4 [email protected] 5 Total words:5253 6 Total Figures and Tables: 11 Figures and 3 Tables 7 Keywords: m6A regulators, m6A, ovarian cancer, Prognostic values, 8 bioinformatics analysis. 9 Abstract 10 Background: N6-methyladenine (m6A) methylation, known as a kind of RNA 11 methylation regulator, has become a hotspot for research in the life sciences in recent 12 years. The existing studies revealed that m6A regulators helped to regulate the 13 progression of several malignant tumors. However, the expression mode and 14 prognostic value of m6A regulators in ovarian cancer have not been fully elucidated. 15 Methods: ONCOMINE, GEPIA, Human protein atlas, Kaplan-meier, UALCAN, 16 cBioPortal, GeneMANIA, DAVID, Sring, and Metascape were utilized in this study. 17 Results: In this study, through a comprehensive use of multiple database systems, 18 m6A regulators-induced mRNA and protein expression levels and their prognostic 19 value in the epithelial ovarian cancer of various histological types were analyzed. 20 Moreover, the interaction, epigenetic changes and functional enrichment of m6A 21 regulators in ovarian cancer were also discussed. By analyzing the transcription levels 22 and survival curves of m6A regulators in serous and endometrioid ovarian cancers, it 23 was found that FTO, YTHDF1, YTHDF2 and IGF2BP1 could be used as the 24 therapeutic target for serous ovarian cancer. YTHDC2 and IGF2BP2 could serve as 25 endometrioid ovarian cancer’s therapeutic target and potential prognostic biomarker, 26 respectively. 27 Conclusions: Our results may provide novel insights for the selection of therapeutic 28 targets and prognostic biomarkers for serous and endometrioid ovarian cancers. 29 1 Background 1 30 Ovarian cancer, one of the most common malignant tumors in female genitalia, was 31 identified with an ever-increasing incidence and high mortality(1). According to 32 cancer statistics in 2020, about 21,750 patients were diagnosed with ovarian cancer, 33 and 13,940 ovarian cancer-related deaths occurred in the United States (2). Although 34 the combination of cytoreductive surgery and neoadjuvant chemotherapy had 35 increased the survival time of such patients (3), the 5-year overall survival rate (OS) 36 of patients with ovarian cancers was still less than 30% (4). In recent years, many 37 researchers have shifted their attention to some biomarkers, such as Cancer antigen- 38 125 (CA-125), HE4, osteopontin, mesothelin, and E2FS family members, and some 39 progress has been made (4-6). 40 However, there is still a long way to go, and more therapeutic targets and prognostic 41 markers need to be identified. 42 Epigenetic modification refers to reversible and heritable changes in gene function 43 without variations in genomic DNA sequence. Aside from DNA methylation and 44 histone acetylation, N6-methyladenine (m6A) was also one of the most common and 45 abundant epigenetic modifications (7). Studies showed that N6-methyladenine was 46 involved in translation control, RNA splicing defects, and many cancer types (8). 47 RNA methylation was dynamically regulated by three types of regulators, including 48 methyltransferases ("writers"), RNA-binding proteins ("readers"), and demethylases 49 ("erasers") (9). Abnormal regulation of RNA m6A modification was closely related to 50 the development of central nervous system diseases, embryonic dysplasia, and tumor 51 radio-resistance(10-12). Cumulative evidence indicated that abnormal changes of m6A 52 regulators played an important role in the occurrence and development of malignant 53 tumors(13-16). In recent years, their role in tumor biology and cancer stem cells has 54 been increasingly highlighted in the field of tumorigenesis and potential biological 55 target screening. However, the underlying mechanisms and unique functions of N6- 56 methyladenine in regulating epithelial ovarian cancer have not been fully elucidated. 57 With the rapid development of methylation sequencing technology and the 58 establishment of various databases, comprehensive analysis of RNA methylation has 59 become possible. In this study, based on major open databases, the relationship 60 between 14 widely reported N6-methyladenine regulators and epithelial ovarian 61 cancer progression and prognosis was analyzed comprehensively. 62 2 Methods 63 2.1 Oncomine dataset 64 Oncomine (www.oncomine.org) is the largest cancer gene chip database and 65 integrated data-mining platform globally, aiming at mining cancer gene information 2 66 (17, 18). Data were extracted to evaluate the expression of m6A regulators in ovarian 67 cancer. The thresholds were restricted as follows: P-value = 0.05; fold-change = 2; 68 and data type, mRNA. Then, the expressions of these m6A regulators in clinical 69 cancer specimens and normal controls were systematically compared. 70 2.2 GEPIA dataset 71 GEPIA (http://gepia.cancer-pku.cn/index.html) is an analysis tool developed by 72 Peking University. With RNA sequence expression data of 9,736 tumor samples and 73 8,587 normal tissue samples, GEPIA has extended the quantification of gene 74 expression from gene level to transcriptional level and could support the analysis and 75 comparison of specific cancer subtypes. It provides many functions such as 76 tumor/normal differential expression analysis, profiling according to cancer types or 77 pathological stages, patient survival analysis, similar gene detection, correlation 78 analysis, and dimensionality reduction analysis (19). Correlations between the 79 expression level of m6A regulators and clinical characteristics in ovarian cancer were 80 assessed according to the GEPIA dataset. 81 2.3 Human protein atlas dataset 82 The Human Protein Atlas (HPA) (https://www.proteinatlas.org/) is a freely accessed 83 website which aims to study the expression of proteins in human tissues and cells 84 (20). By taking advantage of the website, the protein expressions of m6A regulators in 85 ovarian cancer and normal tissues were analyzed by means of immunohistochemistry 86 images. 87 2.4 The Kaplan Meier plotter analysis 88 The prognostic value of m6A regulators in mRNA expression was evaluated using an 89 online database. Kaplan Mayer plotter (www.kmplot.com), which incorporates 90 microarray gene expression data and survival information derived from 91 comprehensive TCGA gene expression-related database and cancer biomedical 92 information grid, especially 1,816 clinical primary cancer patients' gene expression 93 data and survival information (21). To analyze the overall survival (OS), progression- 94 free survival (PFS), and post-progression survival (PPS) of patients with ovarian 95 cancer, patient samples were split into two groups by median expression (high versus 96 low expression) and assessed by a Kaplan-Meier survival plot, with the hazard ratio 97 (HR) with 95% confidence intervals (CIs) and log-rank p-value. Only the JetSet best 98 probe set was chosen to obtain Kaplan-Meier plots. 99 2.5 The cBioPortal for Cancer Genomics 3 100 The cBioPortal (http://www.cbioportal.org/) can be utilized for the visualization, 101 analysis, and download of large-scale cancer genome datasets. Based on the TCGA 102 database, genetic alterations (amplification, deep deletion, and missense mutations) 103 and copy number variances of m6A regulators were obtained from cBioPortal (22), 104 and mRNA expression z-scores (RNA Seq V2 RSEM) were assessed using the 105 cBioPortal for Cancer Genomics database and TCGA. 106 2.6 UALCAN dataset 107 UALCAN (http://ualcan.path.uab.edu/analysis.html) is a comprehensive, user- 108 friendly, and interactive web resource for cancer analysis based on the Cancer 109 Genome Atlas (TCGA) and MET500 cohort data (23). In our study, with the help of 110 this website, the top 20 genes co-expressed with each m6A regulator in ovarian cancer 111 were downloaded. 112 2.7 Functional Enrichment Analysis 113 David (https://david.ncifcrf.gov/home.jsp)is a comprehensive functional annotation 114 website to help researchers better clarify the biological function of submitted 115 genes(24). In this study, GO annotation analysis and the KEGG pathway 116 (https://www.kegg.jp/kegg/pathway.html) enrichment analysis were performed to 117 predict pathways and BPs of m6A regulators by using DAVID. 118 2.8 GeneMANIA dataset 119 GeneMANIA (http://www.genemania.org) is a powerful website that provides 120 information on protein and genetic interactions, pathways, co-expression, and co- 121 localization (25, 26). 122 2.9 String dataset 123 The main role of String (https://string-db.org/) is to collect, score, and integrate all 124 publicly available protein-protein
Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • A Novel Hypoxic Long Noncoding RNA KB-1980E6.3 Maintains Breast Cancer Stem Cell Stemness Via Interacting with IGF2BP1 to Facilitate C-Myc Mrna Stability

    A Novel Hypoxic Long Noncoding RNA KB-1980E6.3 Maintains Breast Cancer Stem Cell Stemness Via Interacting with IGF2BP1 to Facilitate C-Myc Mrna Stability

    Oncogene (2021) 40:1609–1627 https://doi.org/10.1038/s41388-020-01638-9 ARTICLE A novel hypoxic long noncoding RNA KB-1980E6.3 maintains breast cancer stem cell stemness via interacting with IGF2BP1 to facilitate c-Myc mRNA stability 1 2 3 4 1 1 1 1 1 Pengpeng Zhu ● Fang He ● Yixuan Hou ● Gang Tu ● Qiao Li ● Ting Jin ● Huan Zeng ● Yilu Qin ● Xueying Wan ● 1 1 5 1 Yina Qiao ● Yuxiang Qiu ● Yong Teng ● Manran Liu Received: 15 June 2020 / Revised: 13 November 2020 / Accepted: 18 December 2020 / Published online: 19 January 2021 © The Author(s), under exclusive licence to Springer Nature Limited 2021. This article is published with open access Abstract The hostile hypoxic microenvironment takes primary responsibility for the rapid expansion of breast cancer tumors. However, the underlying mechanism is not fully understood. Here, using RNA sequencing (RNA-seq) analysis, we identified a hypoxia-induced long noncoding RNA (lncRNA) KB-1980E6.3, which is aberrantly upregulated in clinical breast cancer tissues and closely correlated with poor prognosis of breast cancer patients. The enhanced lncRNA KB- 1980E6.3 facilitates breast cancer stem cells (BCSCs) self-renewal and tumorigenesis under hypoxic microenvironment both 1234567890();,: 1234567890();,: in vitro and in vivo. Mechanistically, lncRNA KB-1980E6.3 recruited insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) to form a lncRNA KB-1980E6.3/IGF2BP1/c-Myc signaling axis that retained the stability of c-Myc mRNA through increasing binding of IGF2BP1 with m6A-modified c-Myc coding region instability determinant (CRD) mRNA. In conclusion, we confirm that lncRNA KB-1980E6.3 maintains the stemness of BCSCs through lncRNA KB-1980E6.3/ IGF2BP1/c-Myc axis and suggest that disrupting this axis might provide a new therapeutic target for refractory hypoxic tumors.
  • The VE-Cadherin/Amotl2 Mechanosensory Pathway Suppresses Aortic In�Ammation and the Formation of Abdominal Aortic Aneurysms

    The VE-Cadherin/Amotl2 Mechanosensory Pathway Suppresses Aortic InAmmation and the Formation of Abdominal Aortic Aneurysms

    The VE-cadherin/AmotL2 mechanosensory pathway suppresses aortic inammation and the formation of abdominal aortic aneurysms Yuanyuan Zhang Karolinska Institute Evelyn Hutterer Karolinska Institute Sara Hultin Karolinska Institute Otto Bergman Karolinska Institute Maria Forteza Karolinska Institute Zorana Andonovic Karolinska Institute Daniel Ketelhuth Karolinska University Hospital, Stockholm, Sweden Joy Roy Karolinska Institute Per Eriksson Karolinska Institute Lars Holmgren ( [email protected] ) Karolinska Institute Article Keywords: arterial endothelial cells (ECs), vascular disease, abdominal aortic aneurysms Posted Date: June 15th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-600069/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License The VE-cadherin/AmotL2 mechanosensory pathway suppresses aortic inflammation and the formation of abdominal aortic aneurysms Yuanyuan Zhang1, Evelyn Hutterer1, Sara Hultin1, Otto Bergman2, Maria J. Forteza2, Zorana Andonovic1, Daniel F.J. Ketelhuth2,3, Joy Roy4, Per Eriksson2 and Lars Holmgren1*. 1Department of Oncology-Pathology, BioClinicum, Karolinska Institutet, Stockholm, Sweden. 2Department of Medicine Solna, BioClinicum, Karolinska Institutet, Karolinska University Hospital, Stockholm, Sweden. 3Department of Cardiovascular and Renal Research, Institutet of Molecular Medicine, Univ. of Southern Denmark, Odense, Denmark 4Department of Molecular Medicine and Surgery, Karolinska Institutet, Karolinska University Hospital, Stockholm,
  • Figure S1. Reverse Transcription‑Quantitative PCR Analysis of ETV5 Mrna Expression Levels in Parental and ETV5 Stable Transfectants

    Figure S1. Reverse transcription‑quantitative PCR analysis of ETV5 mRNA expression levels in parental and ETV5 stable transfectants. (A) Hec1a and Hec1a‑ETV5 EC cell lines; (B) Ishikawa and Ishikawa‑ETV5 EC cell lines. **P<0.005, unpaired Student's t‑test. EC, endometrial cancer; ETV5, ETS variant transcription factor 5. Figure S2. Survival analysis of sample clusters 1‑4. Kaplan Meier graphs for (A) recurrence‑free and (B) overall survival. Survival curves were constructed using the Kaplan‑Meier method, and differences between sample cluster curves were analyzed by log‑rank test. Figure S3. ROC analysis of hub genes. For each gene, ROC curve (left) and mRNA expression levels (right) in control (n=35) and tumor (n=545) samples from The Cancer Genome Atlas Uterine Corpus Endometrioid Cancer cohort are shown. mRNA levels are expressed as Log2(x+1), where ‘x’ is the RSEM normalized expression value. ROC, receiver operating characteristic. Table SI. Clinicopathological characteristics of the GSE17025 dataset. Characteristic n % Atrophic endometrium 12 (postmenopausal) (Control group) Tumor stage I 91 100 Histology Endometrioid adenocarcinoma 79 86.81 Papillary serous 12 13.19 Histological grade Grade 1 30 32.97 Grade 2 36 39.56 Grade 3 25 27.47 Myometrial invasiona Superficial (<50%) 67 74.44 Deep (>50%) 23 25.56 aMyometrial invasion information was available for 90 of 91 tumor samples. Table SII. Clinicopathological characteristics of The Cancer Genome Atlas Uterine Corpus Endometrioid Cancer dataset. Characteristic n % Solid tissue normal 16 Tumor samples Stagea I 226 68.278 II 19 5.740 III 70 21.148 IV 16 4.834 Histology Endometrioid 271 81.381 Mixed 10 3.003 Serous 52 15.616 Histological grade Grade 1 78 23.423 Grade 2 91 27.327 Grade 3 164 49.249 Molecular subtypeb POLE 17 7.328 MSI 65 28.017 CN Low 90 38.793 CN High 60 25.862 CN, copy number; MSI, microsatellite instability; POLE, DNA polymerase ε.
  • Migration of Thymic Pre-T Cells Regulates Development

    Migration of Thymic Pre-T Cells Regulates Development

    Alternative Splicing Controlled by Heterogeneous Nuclear Ribonucleoprotein L Regulates Development, Proliferation, and Migration of Thymic Pre-T Cells This information is current as of October 2, 2021. Marie-Claude Gaudreau, Florian Heyd, Rachel Bastien, Brian Wilhelm and Tarik Möröy J Immunol published online 20 April 2012 http://www.jimmunol.org/content/early/2012/04/20/jimmun ol.1103142 Downloaded from Supplementary http://www.jimmunol.org/content/suppl/2012/04/20/jimmunol.110314 Material 2.DC1 http://www.jimmunol.org/ Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication by guest on October 2, 2021 *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2012 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published April 20, 2012, doi:10.4049/jimmunol.1103142 The Journal of Immunology Alternative Splicing Controlled by Heterogeneous Nuclear Ribonucleoprotein L Regulates Development, Proliferation, and Migration of Thymic Pre-T Cells Marie-Claude Gaudreau,*,† Florian Heyd,‡ Rachel Bastien,* Brian Wilhelm,x and Tarik Mo¨ro¨y*,† The regulation of posttranscriptional modifications of pre-mRNA by alternative splicing is important for cellular function, devel- opment, and immunity.
  • A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family

    A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family

    Rockefeller University Digital Commons @ RU Student Theses and Dissertations 2018 A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family Linda Molla Follow this and additional works at: https://digitalcommons.rockefeller.edu/ student_theses_and_dissertations Part of the Life Sciences Commons A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY A Thesis Presented to the Faculty of The Rockefeller University in Partial Fulfillment of the Requirements for the degree of Doctor of Philosophy by Linda Molla June 2018 © Copyright by Linda Molla 2018 A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY Linda Molla, Ph.D. The Rockefeller University 2018 APOBEC2 is a member of the AID/APOBEC cytidine deaminase family of proteins. Unlike most of AID/APOBEC, however, APOBEC2’s function remains elusive. Previous research has implicated APOBEC2 in diverse organisms and cellular processes such as muscle biology (in Mus musculus), regeneration (in Danio rerio), and development (in Xenopus laevis). APOBEC2 has also been implicated in cancer. However the enzymatic activity, substrate or physiological target(s) of APOBEC2 are unknown. For this thesis, I have combined Next Generation Sequencing (NGS) techniques with state-of-the-art molecular biology to determine the physiological targets of APOBEC2. Using a cell culture muscle differentiation system, and RNA sequencing (RNA-Seq) by polyA capture, I demonstrated that unlike the AID/APOBEC family member APOBEC1, APOBEC2 is not an RNA editor. Using the same system combined with enhanced Reduced Representation Bisulfite Sequencing (eRRBS) analyses I showed that, unlike the AID/APOBEC family member AID, APOBEC2 does not act as a 5-methyl-C deaminase.
  • RNA M6 a Modification Enzymes Shape Innate Responses to DNA by Regulating Interferon Β

    RNA M6 a Modification Enzymes Shape Innate Responses to DNA by Regulating Interferon Β

    Downloaded from genesdev.cshlp.org on October 1, 2021 - Published by Cold Spring Harbor Laboratory Press RNA m6A modification enzymes shape innate responses to DNA by regulating interferon β Rosa M. Rubio,1 Daniel P. Depledge,1 Christopher Bianco,1 Letitia Thompson,1 and Ian Mohr1,2 1Department of Microbiology, 2Laura and Isaac Perlmutter Cancer Institute, New York University School of Medicine, New York, New York 10016, USA Modification of mRNA by N6-adenosine methylation (m6A) on internal bases influences gene expression in eukaryotes. How the dynamic genome-wide landscape of m6A-modified mRNAs impacts virus infection and host immune responses remains poorly understood. Here, we show that type I interferon (IFN) production triggered by dsDNA or human cytomegalovirus (HCMV) is controlled by the cellular m6A methyltrasferase subunit METTL14 and ALKBH5 demethylase. While METTL14 depletion reduced virus reproduction and stimulated dsDNA- or HCMV-induced IFNB1 mRNA accumulation, ALKBH5 depletion had the opposite effect. Depleting METTL14 increased both nascent IFNB1 mRNA production and stability in response to dsDNA. In contrast, ALKBH5 deple- tion reduced nascent IFNB1 mRNA production without detectably influencing IFN1B mRNA decay. Genome-wide transcriptome profiling following ALKBH5 depletion identified differentially expressed genes regulating antiviral immune responses, while METTL14 depletion altered pathways impacting metabolic reprogramming, stress responses, and aging. Finally, we determined that IFNB1 mRNA was m6A-modified within both the coding sequence and the 3′ untranslated region (UTR). This establishes that the host m6A modification machinery controls IFNβ production triggered by HCMV or dsDNA. Moreover, it demonstrates that responses to nonmicrobial dsDNA in uninfected cells, which shape host immunity and contribute to autoimmune disease, are regulated by enzymes controlling m6A epitranscriptomic changes.
  • M6a)-Dependent Fate Decision for the Lncrna THOR Hongmei Liu1,Yuxinxu1,Bingyao1, Tingting Sui1,Liangxuelai1,2,3,4 and Zhanjun Li1

    M6a)-Dependent Fate Decision for the Lncrna THOR Hongmei Liu1,Yuxinxu1,Bingyao1, Tingting Sui1,Liangxuelai1,2,3,4 and Zhanjun Li1

    Liu et al. Cell Death and Disease (2020) 11:613 https://doi.org/10.1038/s41419-020-02833-y Cell Death & Disease ARTICLE Open Access A novel N6-methyladenosine (m6A)-dependent fate decision for the lncRNA THOR Hongmei Liu1,YuxinXu1,BingYao1, Tingting Sui1,LiangxueLai1,2,3,4 and Zhanjun Li1 Abstract Previous studies have revealed the critical roles of the N6-methyladenosine (m6A) modification of long non-coding RNAs (lncRNAs) in cancers, but the relationship between the oncogenic role of the lncRNA THOR (a representative of cancer/testis lncRNAs) and m6A modification remains unclear. Here, we show that the internal m6A modification of the lncRNA THOR via an m6A-reader-dependent modality regulates the proliferation of cancer cells. Our findings demonstrated that the loss of the lncRNA THOR inhibits the proliferation, migration, and invasion of cancer cells in vitro and in vivo. In addition, m6A is highly enriched on lncRNA THOR transcripts, which contain GA (m6A) CA, GG (m6A) CU, and UG (m6A) CU sequence motifs. RIP-qRT-PCR and RNA pull-down assay results revealed that the specific m6A readers YTHDF1 and YTHDF2 can read the m6A motifs and regulate the stability of the lncRNA THOR (stabilization and decay). These m6A-dependent RNA-protein interactions can maintain the oncogenic role of the lncRNA THOR. Collectively, these findings highlight the critical role of the m6A modification in oncogenic lncRNA THOR and reveal a novel long non-coding RNA regulatory mechanism, providing a new way to explore RNA epigenetic regulatory patterns in the future. 1234567890():,; 1234567890():,; 1234567890():,; 1234567890():,; Introduction Dysregulated expression of lncRNA THOR has been Long non-coding RNA (lncRNA), which is an abundant reported to modulate the progression of various types of and functionally diverse species of non-coding RNA cancers, such as melanoma, non-small cell lung cancer, – (ncRNA), is more than 200 nt transcripts long with lim- osteosarcoma and renal cell carcinoma10 12.
  • Whole Genome Sequencing Identifies Homozygous BRCA2 Deletion Guiding Treatment in De-Differentiated Prostate Cancer

    Whole Genome Sequencing Identifies Homozygous BRCA2 Deletion Guiding Treatment in De-Differentiated Prostate Cancer

    Downloaded from molecularcasestudies.cshlp.org on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Whole Genome Sequencing identifies homozygous BRCA2 deletion guiding treatment in de-differentiated prostate cancer Karin Purshouse1~, Anna Schuh2~, Benjamin P Fairfax1, 5, Sam Knight3, Pavlos Antoniou2, Helene Dreau2, Niko Popitsch3, Kevin Gatter4, Ian Roberts5, Lisa Browning6, Zoe Traill7, David Kerr1, Clare Verrill6, Mark Tuthill1, Jenny C Taylor2,3*, Andrew Protheroe1* ~ joint first authors * Joint senior authors 1 - Oxford Cancer and Haematology Centre, Churchill Hospital, Headington, Oxford, OX3 7LE, UK. 2- Oxford National Institute for Health Research, Biomedical Research Centre/NHS Translational Diagnostics Centre, The Joint Research Office, Block 60, The Churchill Hospital, Old Road, Headington, Oxford, OX3 7LE, UK 3- Wellcome Trust Centre for Human Genetics, University of Oxford, Roosevelt Drive, Oxford, OX3 7BN, UK 4- Nuffield Division of Clinical Laboratory Sciences, Radcliffe Department of Medicine, University of Oxford, John Radcliffe Hospital, Oxford, OX3 9DU, UK. 5- Molecular Oncology and Haematology Unit, Weatherall Institute of Molecular Medicine, John Radcliffe Hospital, Oxford, OX3 9DS, UK 6- Department of Cellular Pathology, John Radcliffe Hospital, Oxford University Hospitals NHS Foundation Trust, Oxford, OX3 9DU, UK. 7- Department of Radiology, John Radcliffe Hospital, Oxford University Hospitals NHS Foundation Trust, Oxford, OX3 9DU, UK. Downloaded from molecularcasestudies.cshlp.org on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Abstract Whole genome sequencing (WGS) has transformed the understanding of the genetic drivers of cancer and is increasingly being used in cancer medicine to identify personalised therapies. Here we describe a case where the application of WGS identified a tumoural BRCA2 deletion in a patient with aggressive dedifferentiated prostate cancer that was repeat biopsied after disease progression.
  • A Heroin Addiction Severity-Associated Intronic Single

    A Heroin Addiction Severity-Associated Intronic Single

    11048 • The Journal of Neuroscience, August 13, 2014 • 34(33):11048–11066 Cellular/Molecular A Heroin Addiction Severity-Associated Intronic Single Nucleotide Polymorphism Modulates Alternative Pre-mRNA Splicing of the ␮ Opioid Receptor Gene OPRM1 via hnRNPH Interactions Jin Xu,1* Zhigang Lu,1* Mingming Xu,1 Ling Pan,1 Yi Deng,1 Xiaohu Xie,3 Huifen Liu,3 Shixiong Ding,4 Yasmin L. Hurd,5 X Gavril W. Pasternak,1 X Robert J. Klein,2 Luca Cartegni,6 X Wenhua Zhou,3† and Ying-Xian Pan1† 1Department of Neurology and the Molecular Pharmacology & Chemistry Program, and 2Department of Medicine, Memorial Sloan Kettering Cancer Center, New York, New York 10065, 3Laboratory of Behavioral Neuroscience, Ningbo Addiction Research and Treatment Center, School of Medicine, Ningbo University, Ningbo, Zhejiang 315211, People’s Republic of China, 4Laboratory of Clinical Biochemistry, Ningbo No. 2 Hospital, Zhejiang 315100, People’s Republic of China, 5Departments of Psychiatry and Neuroscience, Icahn School of Medicine at Mount Sinai, New York, New York 10029, and 6Susan Lehman Cullman Laboratory for Cancer Research, Ernest Mario School of Pharmacy, Rutgers, The State University of New Jersey, Piscataway, New Jersey 08854 Single nucleotide polymorphisms (SNPs) in the OPRM1 gene have been associated with vulnerability to opioid dependence. The current study identifies an association of an intronic SNP (rs9479757) with the severity of heroin addiction among Han-Chinese male heroin addicts. Individual SNP analysis and haplotype-based analysis with additional SNPs in the OPRM1 locus showed that mild heroin addiction was associated with the AG genotype, whereas severe heroin addiction was associated with the GG genotype.
  • A Plant-Like Mechanism Coupling M6a Reading to Polyadenylation

    A Plant-Like Mechanism Coupling M6a Reading to Polyadenylation

    RESEARCH ARTICLE A plant-like mechanism coupling m6A reading to polyadenylation safeguards transcriptome integrity and developmental gene partitioning in Toxoplasma Dayana C Farhat1, Matthew W Bowler2, Guillaume Communie3, Dominique Pontier4, Lucid Belmudes5, Caroline Mas6, Charlotte Corrao1, Yohann Coute´ 5, Alexandre Bougdour1, Thierry Lagrange4, Mohamed-Ali Hakimi1†*, Christopher Swale1†* 1IAB,Team Host-Pathogen Interactions & Immunity to Infection, INSERMU1209, CNRSUMR5309, Grenoble Alpes University, Grenoble, France; 2European Molecular Biology Laboratory, Grenoble, France; 3Institut Laue-Langevin, Grenoble, France; 4Laboratoire Genome et Developpement des Plantes (LGDP), UMR5096, Centre National de la Recherche Scientifique (CNRS), Universitede Perpignan via Domitia (UPVD), Perpignan, France; 5Univ. Grenoble Alpes, INSERM, CEA, UMR BioSante´ U1292, CNRS, CEA, Grenoble, France; 6Integrated Structural Biology Grenoble (ISBG) CNRS, CEA, Universite´ Grenoble Alpes, EMBL, Grenoble, France *For correspondence: [email protected] Abstract Correct 3’end processing of mRNAs is one of the regulatory cornerstones of gene (M-AH); expression. In a parasite that must adapt to the regulatory requirements of its multi-host life style, christopher.swale@univ-grenoble- there is a need to adopt additional means to partition the distinct transcriptional signatures of the alpes.fr (CS) closely and tandemly arranged stage-specific genes. In this study, we report our findings in T. †These authors contributed gondii of an m6A-dependent 3’end polyadenylation serving as a transcriptional barrier at these loci. equally to this work We identify the core polyadenylation complex within T. gondii and establish CPSF4 as a reader for Competing interests: The m6A-modified mRNAs, via a YTH domain within its C-terminus, a feature which is shared with authors declare that no plants.