DOCSLIB.ORG

Regulation of BCR-ABL Expression Via Its 3' Untranslated Region

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Regulation of BCR-ABL Expression Via Its 3' Untranslated Region Regulation of BCR-ABL expression via its 3’untranslated region Bradley Chereda A thesis submitted for the degree of Doctor of Philosophy to the University of Adelaide December 2012 School of Medicine Leukaemia Biology Group Faculty of Health Sciences Centre for Cancer Biology University of Adelaide IMVS, SA Pathology ii Declaration Declaration This work contains no material which has been accepted for the award of any other degree or diploma in any university or other tertiary institution to Bradley Chereda and, to the best of my knowledge and belief, contains no material previously published or written by another person, except where due reference has been made in the text. I give consent to this copy of my thesis, when deposited in the University Library, being made available for loan and photocopying, subject to the provisions of the Copyright Act 1968. I also give permission for the digital version of my thesis to be made available on the web, via the University‟s digital research repository, the Library catalogue, the Australasian Digital Theses Program (ADTP) and also through web search engines, unless permission has been granted by the University to restrict access for a period of time. Bradley Chereda December 2012 iii iv Table of Contents Table of contents Declaration.................................................................................................................................................... III Table of contents........................................................................................................................................... V Abstract....................................................................................................................................................... XII Acknowledgements................................................................................................................................... XIII Abbreviations.............................................................................................................................................. XV Chapter 1 .......................................................................................................................................................... 1 Chronic myeloid leukaemia .............................................................................................................................. 1 1.1 Preface ....................................................................................................................................................... 2 1.2 Chronic myeloid leukaemia ........................................................................................................................ 2 1.3 Disease pathogenesis ................................................................................................................................ 3 1.3.1 Chronic phase .................................................................................................................................. 4 1.3.2 Blast crisis ......................................................................................................................................... 4 1.3.3 Treatment ........................................................................................................................................ 4 1.4 BCR-ABL ..................................................................................................................................................... 5 1.4.1 BCR-ABL signalling in disease ........................................................................................................... 7 1.4.1.1 Proliferation and apoptosis .................................................................................................... 8 1.4.1.2 Genomic instability ................................................................................................................. 9 1.4.2 Expression patterns of BCR-ABL in CML ......................................................................................... 10 1.4.3 BCR-ABL dosage ............................................................................................................................. 12 1.4.3.1 Association with blast crisis .................................................................................................. 12 1.4.3.1.1 Dose-dependent downregulation of C/EBPα .................................................................. 12 1.4.3.1.2 Dose-dependent inhibition of DNA repair ....................................................................... 13 1.4.3.2 BCR-ABL levels and imatinib resistance ................................................................................ 13 1.4.3.3 BCR-ABL expression and TKI-sensitivity in leukaemic stem cells .......................................... 14 1.4.4 Control of BCR-ABL expression ...................................................................................................... 15 1.4.4.1 The BCR Promoter ................................................................................................................ 16 1.4.4.2 DNA/histone modifications relative to BCR-ABL .................................................................. 17 1.4.4.3 The BCR-ABL 3’UTR ............................................................................................................... 18 1.4.4.4 BCR-ABL is abnormal ............................................................................................................ 18 1.4.4.5 The key regulators of BCR-ABL expression are known, now what? ..................................... 19 1.5 Specific aims ............................................................................................................................................ 21 v Table of Contents Chapter 2 ....................................................................................................................................................... 22 Characterisation of the ABL1 3’UTR ............................................................................................................... 22 2.1 Introduction............................................................................................................................................. 23 2.1.1 The 3’UTR ...................................................................................................................................... 23 2.1.1.1 The PAS ................................................................................................................................ 24 2.1.1.2 MicroRNAs ........................................................................................................................... 24 2.1.1.3 RNA-binding proteins ........................................................................................................... 25 2.1.1.4 3’UTR avoidance .................................................................................................................. 25 2.1.2 The BCR-ABL 3’UTR ........................................................................................................................ 28 2.1.2.1 What is known about the BCR-ABL 3’UTR ........................................................................... 28 2.1.2.2 3’UTR shortening of ABL1 .................................................................................................... 31 2.1.2.3 Investigating the BCR-ABL 3’UTR ......................................................................................... 31 2.2 Methods .................................................................................................................................................. 33 2.2.1 Renilla reporter constructs ............................................................................................................ 33 2.2.1.1 ABL1 3’UTR reporters (PCR-based) ...................................................................................... 34 2.2.1.1.1 PCR .................................................................................................................................. 34 2.2.1.1.2 Restriction digest cloning ................................................................................................ 36 2.2.1.2 ABL1 3’UTR reporters (restriction site-based) ..................................................................... 36 2.2.1.3 ABL1 3’UTR reporters (restriction site insertion-based) ...................................................... 36 2.2.1.4 Blunt-end cloning: phRL-ABL1 3’UTR (1-840) ...................................................................... 39 2.2.1.5 Duplex insertion: phRL-FL_ABL1 (PAS) and phRL-FL_ABL1 (SAP) ........................................ 39 2.2.1.5.1 Oligo-duplex annealing ................................................................................................... 40 2.2.1.5.2 Restriction digest cloning ................................................................................................ 40 2.2.1.6 phRL-ABL1 (1116-1257) and phRL-ABL1 (1116-1257)ΔTTP ................................................. 41 2.2.1.7 Transformation .................................................................................................................... 42 2.2.1.8 DNA plasmid prep ................................................................................................................ 42 2.2.1.9 Plasmid amplification ..........................................................................................................
Load more

Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Systematic Description of the Expression and Prognostic Value of M6A Regulators in Human Ovarian Cancer
    Systematic Description of the Expression and Prognostic Value of M6A Regulators in Human Ovarian Cancer Yuwei Chen Fujian Medical University Fujian Cancer Hospital Yang Sun ( [email protected] ) Fujian Cancer Hospital https://orcid.org/0000-0003-4224-8832 Xinbei Chen Fujian Medical University Fujian Cancer Hospital Siming Li Fujian Medical University Fujian Cancer Hospital Hongmei Xia Fujian Cancer Hospital Research Keywords: m6A regulators, m6A, ovarian cancer, Prognostic values, bioinformatics analysis. Posted Date: December 22nd, 2020 DOI: https://doi.org/10.21203/rs.3.rs-131682/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Systematic description of the expression and prognostic value of m6A regulators in human ovarian cancer 1 Yuwei Chen1, Yang Sun1*, Xinbei Chen1, Siming Li1, Hongmei Xia1 2 * Correspondence: 3 Yang Sun 4 [email protected] 5 Total words：5253 6 Total Figures and Tables: 11 Figures and 3 Tables 7 Keywords: m6A regulators, m6A, ovarian cancer, Prognostic values, 8 bioinformatics analysis. 9 Abstract 10 Background: N6-methyladenine (m6A) methylation, known as a kind of RNA 11 methylation regulator, has become a hotspot for research in the life sciences in recent 12 years. The existing studies revealed that m6A regulators helped to regulate the 13 progression of several malignant tumors. However, the expression mode and 14 prognostic value of m6A regulators in ovarian cancer have not been fully elucidated. 15 Methods: ONCOMINE, GEPIA, Human protein atlas, Kaplan-meier, UALCAN, 16 cBioPortal, GeneMANIA, DAVID, Sring, and Metascape were utilized in this study. 17 Results: In this study, through a comprehensive use of multiple database systems, 18 m6A regulators-induced mRNA and protein expression levels and their prognostic 19 value in the epithelial ovarian cancer of various histological types were analyzed.
    [Show full text]
  • CRISPR-Cas9–Based Treatment of Myocilin-Associated Glaucoma
    CRISPR-Cas9–based treatment of myocilin- associated glaucoma Ankur Jaina, Gulab Zodeb,1, Ramesh B. Kasettib, Fei A. Ranc, Winston Yanc, Tasneem P. Sharmad, Kevin Buggea, Charles C. Searbya, John H. Fingertd, Feng Zhangc, Abbot F. Clarkb, and Val C. Sheffielda,d,1 aDepartment of Pediatrics, Carver College of Medicine, University of Iowa, Iowa City, IA 52242; bNorth Texas Eye Research Institute, University of North Texas Health Science Center, Fort Worth, TX 76107; cMcGovern Institute for Brain Research, Massachusetts Institute of Technology, Cambridge, MA 02142; and dStephen A. Wynn Institute for Vision Research, Department of Ophthalmology, Carver College of Medicine, University of Iowa, Iowa City, IA 52242 Edited by Donald J. Zack, Johns Hopkins University, Baltimore, MD, and accepted by Editorial Board Member Jeremy Nathans August 25, 2017 (received for review April 22, 2017) Primary open-angle glaucoma (POAG) is a leading cause of protein itself (transcription or translational inhibition). While irreversible vision loss worldwide, with elevated intraocular pres- siRNA and shRNA provide potentially viable treatment op- sure (IOP) a major risk factor. Myocilin (MYOC) dominant gain-of- tions (31), we elected to directly target the MYOC gene using function mutations have been reported in ∼4% of POAG cases. gene editing with clustered regularly interspaced short palindromic MYOC mutations result in protein misfolding, leading to endoplas- repeats (CRISPR)-Cas9 technology to treat myocilin-associated mic reticulum (ER) stress in the trabecular meshwork (TM), the tis- glaucoma. sue that regulates IOP. We use CRISPR-Cas9–mediated genome Originally part of the prokaryotic adaptive immune system, the editing in cultured human TM cells and in a MYOC mouse model CRISPR-Cas9 system has been adapted as a genome-editing tool, of POAG to knock down expression of mutant MYOC, resulting in in which the Cas9 endonuclease is directed by a guide RNA relief of ER stress.
    [Show full text]
  • Supp Material.Pdf
    Supplementary Information Estrogen-mediated Epigenetic Repression of Large Chromosomal Regions through DNA Looping Pei-Yin Hsu, Hang-Kai Hsu, Gregory A. C. Singer, Pearlly S. Yan, Benjamin A. T. Rodriguez, Joseph C. Liu, Yu-I Weng, Daniel E. Deatherage, Zhong Chen, Julia S. Pereira, Ricardo Lopez, Jose Russo, Qianben Wang, Coral A. Lamartiniere, Kenneth P. Nephew, and Tim H.-M. Huang S1 Method Immunofluorescence staining Approximately 2,000 mammosphere-derived epithelial cells (MDECs) cells seeded collagen I-coated coverslips were fixed with methanol/acetone for 10 min. After blocking with 2.5% bovine serum albumin (Sigma) for 1 hr, these cells were incubated with anti-ESR1 antibody (Santa Cruz) overnight at 4˚C. The corresponding secondary FITC-conjugated antibody was applied followed by DAPI staining (Molecular Probes) for the nuclei. Photographs were captured by Zeiss fluorescence microscopy (Zeiss). The percentages of ESR1 subcellular localization were calculated in ten different optical fields (~10 cells per field) by two independent researchers. References Carroll, J.S., Meyer, C.A., Song, J., Li, W., Geistlinger, T.R., Eeckhoute, J., Brodsky, A.S., Keeton, E.K., Fertuck, K.C., Hall, G.F., et al. 2006. Genome-wide analysis of estrogen receptor binding sites. Nat. Genet. 38: 1289-1297. Neve, R.M., Chin, K., Fridlyand, J., Yeh, J., Baehner, F.L., Fevr, T., Clark, L., Bayani, N., Coppe, J.P., Tong, F., et al. 2006. A collection of breast cancer cell lines for the study of functionally distinct cancer subtypes. Cancer Cell 10: 515-527. S2 Hsu et al. Supplementary Information A Figure S1. Integrative mapping of large genomic regions subjected to ERα-mediated epigenetic repression.
    [Show full text]
  • Extensive Characterization of IFN-Induced Gtpases Mgbp1 to Mgbp10 Involved in Host Defense
    Extensive Characterization of IFN-Induced GTPases mGBP1 to mGBP10 Involved in Host Defense This information is current as Daniel Degrandi, Carolin Konermann, Cornelia of October 1, 2021. Beuter-Gunia, Alexandra Kresse, Jan Würthner, Stefanie Kurig, Sandra Beer and Klaus Pfeffer J Immunol 2007; 179:7729-7740; ; doi: 10.4049/jimmunol.179.11.7729 http://www.jimmunol.org/content/179/11/7729 Downloaded from Supplementary http://www.jimmunol.org/content/suppl/2008/03/10/179.11.7729.DC1 Material http://www.jimmunol.org/ References This article cites 56 articles, 23 of which you can access for free at: http://www.jimmunol.org/content/179/11/7729.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists by guest on October 1, 2021 • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2007 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Extensive Characterization of IFN-Induced GTPases mGBP1 to mGBP10 Involved in Host Defense1 Daniel Degrandi,2 Carolin Konermann,2 Cornelia Beuter-Gunia,2 Alexandra Kresse, Jan Wu¨rthner, Stefanie Kurig, Sandra Beer,3 and Klaus Pfeffer3 IFN-␥ orchestrates a potent antimicrobial host response.
    [Show full text]
  • WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization I International Bureau (10) International Publication Number (43) International Publication Date WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT (51) International Patent Classification: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DJ, DK, DM, DO, C12Q 1/68 (2018.01) A61P 31/18 (2006.01) DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, C12Q 1/70 (2006.01) HR, HU, ID, IL, IN, IR, IS, JO, JP, KE, KG, KH, KN, KP, KR, KW, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, (21) International Application Number: MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, PCT/US2018/056167 OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, (22) International Filing Date: SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, 16 October 2018 (16. 10.2018) TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. (25) Filing Language: English (84) Designated States (unless otherwise indicated, for every kind of regional protection available): ARIPO (BW, GH, (26) Publication Language: English GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, (30) Priority Data: UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, RU, TJ, 62/573,025 16 October 2017 (16. 10.2017) US TM), European (AL, AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HR, HU, ΓΕ , IS, IT, LT, LU, LV, (71) Applicant: MASSACHUSETTS INSTITUTE OF MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TECHNOLOGY [US/US]; 77 Massachusetts Avenue, TR), OAPI (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, Cambridge, Massachusetts 02139 (US).
    [Show full text]
  • A Novel Hypoxic Long Noncoding RNA KB-1980E6.3 Maintains Breast Cancer Stem Cell Stemness Via Interacting with IGF2BP1 to Facilitate C-Myc Mrna Stability
    Oncogene (2021) 40:1609–1627 https://doi.org/10.1038/s41388-020-01638-9 ARTICLE A novel hypoxic long noncoding RNA KB-1980E6.3 maintains breast cancer stem cell stemness via interacting with IGF2BP1 to facilitate c-Myc mRNA stability 1 2 3 4 1 1 1 1 1 Pengpeng Zhu ● Fang He ● Yixuan Hou ● Gang Tu ● Qiao Li ● Ting Jin ● Huan Zeng ● Yilu Qin ● Xueying Wan ● 1 1 5 1 Yina Qiao ● Yuxiang Qiu ● Yong Teng ● Manran Liu Received: 15 June 2020 / Revised: 13 November 2020 / Accepted: 18 December 2020 / Published online: 19 January 2021 © The Author(s), under exclusive licence to Springer Nature Limited 2021. This article is published with open access Abstract The hostile hypoxic microenvironment takes primary responsibility for the rapid expansion of breast cancer tumors. However, the underlying mechanism is not fully understood. Here, using RNA sequencing (RNA-seq) analysis, we identified a hypoxia-induced long noncoding RNA (lncRNA) KB-1980E6.3, which is aberrantly upregulated in clinical breast cancer tissues and closely correlated with poor prognosis of breast cancer patients. The enhanced lncRNA KB- 1980E6.3 facilitates breast cancer stem cells (BCSCs) self-renewal and tumorigenesis under hypoxic microenvironment both 1234567890();,: 1234567890();,: in vitro and in vivo. Mechanistically, lncRNA KB-1980E6.3 recruited insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) to form a lncRNA KB-1980E6.3/IGF2BP1/c-Myc signaling axis that retained the stability of c-Myc mRNA through increasing binding of IGF2BP1 with m6A-modified c-Myc coding region instability determinant (CRD) mRNA. In conclusion, we confirm that lncRNA KB-1980E6.3 maintains the stemness of BCSCs through lncRNA KB-1980E6.3/ IGF2BP1/c-Myc axis and suggest that disrupting this axis might provide a new therapeutic target for refractory hypoxic tumors.
    [Show full text]
  • The VE-Cadherin/Amotl2 Mechanosensory Pathway Suppresses Aortic InAmmation and the Formation of Abdominal Aortic Aneurysms
    The VE-cadherin/AmotL2 mechanosensory pathway suppresses aortic inammation and the formation of abdominal aortic aneurysms Yuanyuan Zhang Karolinska Institute Evelyn Hutterer Karolinska Institute Sara Hultin Karolinska Institute Otto Bergman Karolinska Institute Maria Forteza Karolinska Institute Zorana Andonovic Karolinska Institute Daniel Ketelhuth Karolinska University Hospital, Stockholm, Sweden Joy Roy Karolinska Institute Per Eriksson Karolinska Institute Lars Holmgren ( [email protected] ) Karolinska Institute Article Keywords: arterial endothelial cells (ECs), vascular disease, abdominal aortic aneurysms Posted Date: June 15th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-600069/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License The VE-cadherin/AmotL2 mechanosensory pathway suppresses aortic inflammation and the formation of abdominal aortic aneurysms Yuanyuan Zhang1, Evelyn Hutterer1, Sara Hultin1, Otto Bergman2, Maria J. Forteza2, Zorana Andonovic1, Daniel F.J. Ketelhuth2,3, Joy Roy4, Per Eriksson2 and Lars Holmgren1*. 1Department of Oncology-Pathology, BioClinicum, Karolinska Institutet, Stockholm, Sweden. 2Department of Medicine Solna, BioClinicum, Karolinska Institutet, Karolinska University Hospital, Stockholm, Sweden. 3Department of Cardiovascular and Renal Research, Institutet of Molecular Medicine, Univ. of Southern Denmark, Odense, Denmark 4Department of Molecular Medicine and Surgery, Karolinska Institutet, Karolinska University Hospital, Stockholm,
    [Show full text]
  • Open Data for Differential Network Analysis in Glioma
    International Journal of Molecular Sciences Article Open Data for Differential Network Analysis in Glioma , Claire Jean-Quartier * y , Fleur Jeanquartier y and Andreas Holzinger Holzinger Group HCI-KDD, Institute for Medical Informatics, Statistics and Documentation, Medical University Graz, Auenbruggerplatz 2/V, 8036 Graz, Austria; [email protected] (F.J.); [email protected] (A.H.) * Correspondence: [email protected] These authors contributed equally to this work. y Received: 27 October 2019; Accepted: 3 January 2020; Published: 15 January 2020 Abstract: The complexity of cancer diseases demands bioinformatic techniques and translational research based on big data and personalized medicine. Open data enables researchers to accelerate cancer studies, save resources and foster collaboration. Several tools and programming approaches are available for analyzing data, including annotation, clustering, comparison and extrapolation, merging, enrichment, functional association and statistics. We exploit openly available data via cancer gene expression analysis, we apply refinement as well as enrichment analysis via gene ontology and conclude with graph-based visualization of involved protein interaction networks as a basis for signaling. The different databases allowed for the construction of huge networks or specified ones consisting of high-confidence interactions only. Several genes associated to glioma were isolated via a network analysis from top hub nodes as well as from an outlier analysis. The latter approach highlights a mitogen-activated protein kinase next to a member of histondeacetylases and a protein phosphatase as genes uncommonly associated with glioma. Cluster analysis from top hub nodes lists several identified glioma-associated gene products to function within protein complexes, including epidermal growth factors as well as cell cycle proteins or RAS proto-oncogenes.
    [Show full text]
  • Supplemental Figure and Table Legends
    Supplemental figure and table legends Supplementary Figure 1: KIAA1841 is well conserved among vertebrates. NCBI HomoloGene pairwise alignment scores of human KIAA1841 sequence compared to other vertebrate orthologs. Supplementary Figure 2: µ-germline transcripts (GLT) and AID mRNA expression are not affected by overexpression of KIAA1841. Splenic B cells were isolated from wild-type mice, and transduced with retroviral vector control (pMIG) or a vector expressing KIAA1841. Levels of µ-GLT and AID mRNA were determined at 72h post-infection by RT-qPCR, and normalized to -actin mRNA and the pMIG control. The mean of three independent experiments +/- SD is shown. NS, p = not significant, p 0.05, two-tailed paired student’s t-test. Supplementary Figure 3: Overexpression of untagged and Xpress-tagged KIAA1841 does not affect cell proliferation. Splenic B cells were isolated from wild-type mice, stimulated with LPS+IL4, and transduced with retroviral vector control (pMIG) or a vector expressing KIAA1841 or Xpress (Xp)-tagged KIAA1841. Cells are labeled with seminaphthorhodafluor (SNARF) cell tracking dye and SNARF intensity was measured at 0h, 24h, and 48h after retroviral infection. Histograms of transduced cells (GFP+) for pMIG control, KIAA1841 and Xp-KIAA1841 were superimposed at each time point. Three independent retroviral infection experiments are shown. Supplementary Figure 4: Sequence alignment of the putative SANT domain of KIAA1841 with the SANT domain of SWI3. Alignment was performed using ClustalOmega; *, conserved residue, :, strongly similar residues, ., weakly similar residues. Numbers indicate amino acid residues in each sequence. Helix 3, which has been reported to be important for the chromatin remodeling function of SWI3 (Boyer et.
    [Show full text]
  • Mouse Celf5 Conditional Knockout Project (CRISPR/Cas9)
    https://www.alphaknockout.com Mouse Celf5 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Celf5 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Celf5 gene (NCBI Reference Sequence: NM_176954 ; Ensembl: ENSMUSG00000034818 ) is located on Mouse chromosome 10. 12 exons are identified, with the ATG start codon in exon 1 and the TGA stop codon in exon 12 (Transcript: ENSMUST00000118763). Exon 2 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Celf5 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP24-277O5 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 2 starts from about 12.32% of the coding region. The knockout of Exon 2 will result in frameshift of the gene. The size of intron 1 for 5'-loxP site insertion: 5509 bp, and the size of intron 2 for 3'-loxP site insertion: 5511 bp. The size of effective cKO region: ~583 bp. The cKO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele gRNA region 5' gRNA region 3' 1 2 12 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Celf5 Homology arm cKO region loxP site Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats.
    [Show full text]