Review Tec Kinases: a Family with Multiple Roles in Immunity

Total Page:16

File Type:pdf, Size:1020Kb

Review Tec Kinases: a Family with Multiple Roles in Immunity Immunity, Vol. 12, 373±382, April, 2000, Copyright 2000 by Cell Press Tec Kinases: A Family Review with Multiple Roles in Immunity Wen-Chin Yang,*³§ Yves Collette,*³ inositol phosphates, but they are thought to be relevant Jacques A. NuneÁ s,*³ and Daniel Olive*² for binding of PtdIns lipids to the same sites. In most *INSERM U119 cases, PH domains bind preferentially to PtdIns (4,5)P2 Universite de la Me diterrane e and inositol (1,4,5) P3 (Ins (1,4,5) P3). However, the Btk 13009 Marseille PH domain binds PtdIns (3,4,5)P3 and Ins (1, 3, 4, 5)P4 France the tightest. PtdIns (3, 4, 5)P3, one of the products of the action of PI3K, is thought to act as a second messen- ger to recruit regulatory proteins to the plasma mem- brane via their PH domains (see below). Many of the Antigen receptors on T, B, and mast cells are multimo- mutations in Btk that lead to XLA are point mutations lecular complexes that are activated by interactions with that cluster at one end of the PH domain and could be external signals. These signals are then transmitted to predicted to impair binding to Ins (3,4,5)P (for review regulate gene expression and posttranscriptional modi- 3 see Satterthwaite et al., 1998a) (Figure 1b). Similarly, fications. Nonreceptor tyrosine kinases (NRTK) are key CBA/N xid mice carry an R28C mutation in the Btk PH players that relay and integrate these signals. NRTK are domain. The recent structure of the PH domain from divided into distinct families defined by a prototypic Btk complexed with Ins (1,3,4,5)P4 provides an explana- member: Src, Tec, Syk, Csk, Fes, Abl, Jak, Fak, Ack, tion for several mutations associated with XLA: mis- Brk, and Srm (Bolen and Brugge, 1997). In 1993, several sense mutations either directly affect the interaction reports identified the first hereditary immunodeficiency with the phosphate of the lipid head group or change linked to the NRTK Btk, a member of the Tec family. electrostatic properties of the lipid binding site (Baraldi These immunodeficiencies are X-linked agammaglobu- et al., 1999). The crystal structure of BtkE41K complexed linemia (XLA) syndrome in humans and X-linked immuno- with Ins (1,3,4,5)P4 shows that two Ins (1,3,4,5)P4 mole- deficiency (xid) in mice. From these observations, a new cules are associated with this gain-of-function mutant era started for the understanding of the role of Tec family as opposed to the wild-type PH domain, which only kinases in the regulation of immune functions, first in binds one. Assuming that these structures are compati- B cells, then in mast cells, and now in T cells. They ble with the association of the Btk PH domain with PtdIns correspond to the first family of NRTK that integrate (3,4,5) P3, the increase in avidity showed for the PH signals generated not solely by the Src family kinases domain of BtkE41K may explain its constitutive mem- but also by phosphatidylinositol 3-OH kinase (PI3K), pro- brane association and activation. That XLA is also asso- tein kinase C (PKC), Janus kinases (Jak), and heterotri- ciated with a point mutation Q127H that maps to the meric G proteins. The present review discusses recent ␣1 region of the Btk PH domain (Figure 1b) cannot be data regarding the role of Tec family kinases in cells of explained by the crystal structure, suggesting that the the immune system and presents current models for PH domain of Btk carries an additional function (Baraldi their structure, regulation, and functions. The available et al., 1999). A general consensus has emerged that PH information regarding Tec family kinase expression and domains mediate intermolecular interactions and have overall structure are depicted in Table 1. evolved primarily in regulating protein±lipid interactions, yet in some instances PH domains may also mediate The Tec Family Kinases: Structural Features protein±protein interactions (see below). The general domain structure of Tec family kinases is The Tec Homology Domain formed of an N-terminal pleckstrin-homology (PH) do- The Tec homology (TH) domain contains a Btk motif, main; the so-called Tec homology domain (TH), which which is a globular core packed against the PH domain, includes a Btk motif and one or two proline-rich motifs and either one (Itk/Emt, Emb/Bmx, Rlk/Txk, and Tec29) (PR); Src homology 3 (SH3) and SH2 domains; and fi- or two (Btk and Tec) PR motifs linked to the SH3 domain nally, the catalytic kinase domain (SH1). Tec family ki- by the so-called Tec-loop (Figure 1c). The Btk motif nases generally lack the unique domain and myristoyla- contains characteristic conserved cysteine and histidine tion site (and frequently palmitoylation site) found in residues, forming a zinc binding fold. It is always adja- Src family kinases. Moreover, they lack the C-terminal cent to a PH domain and is found in other molecules regulatory tyrosine residue characteristic of Src (see such as Ras GAP. The PR motif adopts the dihedral Figure 1a). angles of a polyproline type II (PPII) helix and can bind The Pleckstrin Homology Domain SH3 domains (Mayer and Eck, 1995). Pleckstrin homology (PH) domains adopt a common fold The Src Homology 3 Domain with electrostatic polarization (Hirata et al., 1998; for The recent solution structures of Btk and of the Itk/Emt review see Rebecchi and Scarlata, 1998) (Figure 1b). Src homology (SH) 3 domains (SH3) show the typical The positively charged end of the module allows binding SH3 topology, consisting of two small ␤ sheets that are packed against each other approximately at right angles to inositol phosphate in vitro with Kds as low as 40 nM. Most of the studies on the interaction of PH domains (Figure 1c). A 21 amino acid deletion in the Btk SH3 with their ligands have been performed using soluble domain leads to a severe B cell defect characteristic of XLA in affected patients (Zhu et al., 1994). The modeled ² To whom correspondence should be addressed (e-mail: olive@ mutant protein exhibits the loss of two C-terminal ␤ marseille.inserm.fr). strands containing several residues critical for the for- ³ These authors contributed equally to this work. mation of the SH3 ligand binding pocket. Remarkably, § Present address: Department of Pathology, University of Massa- Itk SH3 can bind to the intramolecular PR motif (An- chusetts Medical School, Worcester, Massachusetts 01655. dreotti et al., 1997), which may regulate the enzyme Immunity 374 Table 1. Overview of Tec Family Kinases Tissue and Cell Chromosomal Activating Phenotype of Protein Protein Size (kDa) Lineage Expression localization Pathway Single Mutation Tec29/dsrc29A/ 66/55* tissue: embryo, oocyte, polytene unknown embryonic lethality Dsrc29C and imaginal disc chromosome 28C and defective oogenesis Bmx/Etk 80 tissue: bone marrow, Xp22.2 IL-6R unknown lung, testis, colon, (human) G␣12/13 and heart cell: macrophage, ? (mouse) neutrophil Btk 77 tissue: bone marrow, Xq22 BCR, Fc⑀RI, gp130 block in B cell /Bpk/Atk/Emb spleen, lymph node, (human) (IL-6R), IL-5R, development, and fetal liver IL-10R, CD19, CD28, defective BCR cell: B, myeloid, syntenic CD38, CD40 signaling and XLA, erythroid, mast, and Xq22 (mouse) defective degranulation megakaryocyte Itk/Tsk/Emt 72 tissue: thymus, spleen, 5q31-32 TCR, CD28, CD2 Reduction in CD4ϩ and lymph node (human) and FC⑀RI subset and defect cell: T, NK, and ? (mouse) in TCR signaling mast cells Rlk/Txk 52/58* tissue: thymus, spleen, 4p12 (human) TCR subtle, some reduction lymph node, tonsil, of IL-2 production and testis cell: T and myeloid chromosome 5 (mouse) Tec 72/70/66/58* tissue: bone marrow, 4p12 (human) TCR, CD28, BCR, unknown spleen, and thymus CD38, gp130, (IL-3R, cell: T, B, myeloid, and chromosome 5 IL-6R), EpoR, hepatocarcinoma (mouse) G-CSFR, TpoR c-kit, * Alternative splicing site of mRNA or alternative start site yields multiple isoforms. activity and is reminiscent of the recently described fold- B cell defect (for review see Satterthwaite et al., 1998a). ing of the Src kinases (Figure 1c) (Pawson, 1997). Based Immature B cells are arrested at the progression from on this intramolecular structure of Itk, the Tec splice the IgMlo to the IgMhi stage, which could reflect the first variant (Tec III) expressed in vivo and displaying a 66 immune tolerance checkpoint at which autoreactive B bp deletion in the C-terminal portion of the SH3 domain cells become susceptible to apoptosis (Maas et al., encoding region is predicted to make altered intramo- 1999). In addition to the BCR, multiple pathways induce lecular associations, which raises the question of its Btk phosphorylation and activation such as those induc- potential differential function (Merkel et al., 1999). ing the costimulatory molecules CD19 and CD38 and The SH2 Domain cytokine receptors. Btk could also be involved in the SH2 domains bind ligands containing phosphotyrosine homeostasis of the mature B cell population by the regu- residues included within a specific sequence. The three- lation of their emigration and maintenance in the periph- dimensional structure of an SH2 domain from a Tec ery, since a maintenance defect is observed in subsets family kinase is not yet available, but a model structure of B cells in xid mice (Cariappa et al., 1999). The basis based on v-Src suggests that Btk SH2 has a structure for this defect is unknown but could be at the level of very similar to the other SH2 domains (Vihinen et al., the regulation of chemokines or homing receptors and 1994). The binding properties of recombinant fusion pro- may shed light on new functions for Btk (Guinamard et teins containing the Itk SH2 domain suggest that while al., 1999).
Recommended publications
  • Regulation of the Src Family Kinases by Csk Masato Okada
    Int. J. Biol. Sci. 2012, 8 1385 Ivyspring International Publisher International Journal of Biological Sciences 2012; 8(10):1385-1397. doi: 10.7150/ijbs.5141 Review Regulation of the Src Family Kinases by Csk Masato Okada Department of Oncogene Research, Research Institute for Microbial Diseases, Osaka University, 3-1 Yamada-oka, Suita, Osaka 565-0871, JAPAN. Corresponding author: TEL: 81-6-6879-8297 FAX: 81-6-6879-8298, E-mail: [email protected]. © Ivyspring International Publisher. This is an open-access article distributed under the terms of the Creative Commons License (http://creativecommons.org/ licenses/by-nc-nd/3.0/). Reproduction is permitted for personal, noncommercial use, provided that the article is in whole, unmodified, and properly cited. Received: 2012.08.31; Accepted: 2012.10.01; Published: 2012.11.01 Abstract The non-receptor tyrosine kinase Csk serves as an indispensable negative regulator of the Src family tyrosine kinases (SFKs) by specifically phosphorylating the negative regulatory site of SFKs, thereby suppressing their oncogenic potential. Csk is primarily regulated through its SH2 domain, which is required for membrane translocation of Csk via binding to scaffold proteins such as Cbp/PAG1. The binding of scaffolds to the SH2 domain can also upregulate Csk kinase activity. These regulatory features have been elucidated by analyses of Csk structure at the atomic levels. Although Csk itself may not be mutated in human cancers, perturbation of the regulatory system consisting of Csk, Cbp/PAG1, or other scaffolds, and certain tyrosine phosphatases may explain the upregulation of SFKs frequently observed in human cancers. This review focuses on the molecular bases for the function, structure, and regulation of Csk as a unique regulatory tyrosine kinase for SFKs.
    [Show full text]
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB
    Table S1. Kinase clones included in human kinase cDNA library for yeast two-hybrid screening Gene Symbol Gene Description ACVR1B activin A receptor, type IB ADCK2 aarF domain containing kinase 2 ADCK4 aarF domain containing kinase 4 AGK multiple substrate lipid kinase;MULK AK1 adenylate kinase 1 AK3 adenylate kinase 3 like 1 AK3L1 adenylate kinase 3 ALDH18A1 aldehyde dehydrogenase 18 family, member A1;ALDH18A1 ALK anaplastic lymphoma kinase (Ki-1) ALPK1 alpha-kinase 1 ALPK2 alpha-kinase 2 AMHR2 anti-Mullerian hormone receptor, type II ARAF v-raf murine sarcoma 3611 viral oncogene homolog 1 ARSG arylsulfatase G;ARSG AURKB aurora kinase B AURKC aurora kinase C BCKDK branched chain alpha-ketoacid dehydrogenase kinase BMPR1A bone morphogenetic protein receptor, type IA BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) BRAF v-raf murine sarcoma viral oncogene homolog B1 BRD3 bromodomain containing 3 BRD4 bromodomain containing 4 BTK Bruton agammaglobulinemia tyrosine kinase BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) C9orf98 chromosome 9 open reading frame 98;C9orf98 CABC1 chaperone, ABC1 activity of bc1 complex like (S. pombe) CALM1 calmodulin 1 (phosphorylase kinase, delta) CALM2 calmodulin 2 (phosphorylase kinase, delta) CALM3 calmodulin 3 (phosphorylase kinase, delta) CAMK1 calcium/calmodulin-dependent protein kinase I CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha CAMK2B calcium/calmodulin-dependent
    [Show full text]
  • Overexpression of Syk Tyrosine Kinase in Peripheral T-Cell Lymphomas
    Leukemia (2008) 22, 1139–1143 & 2008 Nature Publishing Group All rights reserved 0887-6924/08 $30.00 www.nature.com/leu ORIGINAL ARTICLE Overexpression of Syk tyrosine kinase in peripheral T-cell lymphomas AL Feldman1, DX Sun1, ME Law1, AJ Novak2, AD Attygalle3, EC Thorland1, SR Fink1, JA Vrana1, BL Caron1, WG Morice1, ED Remstein1, KL Grogg1, PJ Kurtin1, WR Macon1 and A Dogan1 1Department of Laboratory Medicine and Pathology, Mayo Clinic, Rochester, MN, USA; 2Department of Hematology, Mayo Clinic, Rochester, MN, USA and 3Department of Histopathology, Royal Marsden Hospital, London, UK Peripheral T-cell lymphomas (PTCLs) are fatal in the majority of Materials and methods patients and novel treatments, such as protein tyrosine kinase (PTK) inhibition, are needed. The recent finding of SYK/ITK translocations in rare PTCLs led us to examine the expression Cases of Syk PTK in 141 PTCLs. Syk was positive by immuno- We studied specimens from 141 patients with PTCL diagnosed 15 histochemistry (IHC) in 133 PTCLs (94%), whereas normal by WHO criteria. There were 86 men and 55 women of a T cells were negative. Western blot on frozen tissue (n ¼ 6) mean age of 59 years (range, 5–88 years). The study was and flow cytometry on cell suspensions (n ¼ 4) correlated with approved by the Institutional Review Board and the Biospeci- IHC results in paraffin. Additionally, western blot demonstrated mens Committee of Mayo Clinic. All patients provided informed that Syk-positive PTCLs show tyrosine (525/526) phosphory- lation, known to be required for Syk activation. Fluorescence consent for the use of their tissues for research purposes.
    [Show full text]
  • Fgr and Hck Neutrophils Requires the Src Family Kinases Adhesion-Dependent Degranulation Of
    Adhesion-Dependent Degranulation of Neutrophils Requires the Src Family Kinases Fgr and Hck This information is current as Attila Mócsai, Erzsébet Ligeti, Clifford A. Lowell and of September 25, 2021. Giorgio Berton J Immunol 1999; 162:1120-1126; ; http://www.jimmunol.org/content/162/2/1120 Downloaded from References This article cites 36 articles, 23 of which you can access for free at: http://www.jimmunol.org/content/162/2/1120.full#ref-list-1 Why The JI? Submit online. http://www.jimmunol.org/ • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average by guest on September 25, 2021 Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 1999 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Adhesion-Dependent Degranulation of Neutrophils Requires the Src Family Kinases Fgr and Hck1 Attila Mo´csai,2*† Erzse´bet Ligeti,† Clifford A. Lowell,‡ and Giorgio Berton3* Polymorphonuclear neutrophils (PMN) adherent to integrin ligands respond to inflammatory mediators by reorganizing their cytoskeleton and releasing reactive oxygen intermediates. As Src family tyrosine kinases are implicated in these responses, we investigated their possible role in regulating degranulation.
    [Show full text]
  • ITK Inhibitors for the Treatment of T-Cell Lymphoproliferative Disorders John C
    ITK Inhibitors for the Treatment of T-Cell Lymphoproliferative Disorders John C. Reneau, MD, PhD1, Steven R. Hwang, MD2, Carlos A. Murga-Zamalloa, MD1, Joseph J. Buggy, PhD3, James W. Janc, PhD3 and Ryan A. Wilcox, MD, PhD1 1University of Michigan, Ann Arbor, MI; 2Mayo Clinic, Rochester, MN; 3Corvus Pharmaceuticals, Inc., Burlingame, CA Introduction Results and Methods Conclusions • T-cell lymphomas (TCL) comprise a rare, aggressive, and Table 1: CPI-818 specifically inhibits ITK Figure 2: CPI-818 has minimal effect on normal T cells • CPI-818 is a potent ITK specific inhibitor, while CPI-893 inhibits both heterogeneous subtype of non-Hodgkin lymphoma B IC50 (nM) A ITK and RLK • Outcomes for patients with TCL remain poor and novel therapies are ITK RLK • Normal T cells express both ITK and RLK which can compensate for needed CPI-818 (ITKi) 2.3 260 inhibition of ITK function CPI-893 (ITK/RLKi) 0.36 0.4 • Engagement of the T-cell receptor (TCR) in malignant T-cells leads to • Malignant T cells almost exclusively express ITK, or express RLK at Kinome screening was performed for CPI-818 (ITKi) and CPI-893 (ITK/RLKi). CPI-818 (ITKi) had high interleukin-2-inudcible T-cell kinase (ITK) dependent activation of NF- specificity for ITK over RLK (IC50 2.3 nM and 260 nM, respectively). In contrast CPI-893 (ITK/RLKi) had a very low levels high affinity for both ITK and RLK (IC50 0.36 nM and 0.4 nM, respectively) 1 κB and GATA3, and promotes chemotherapy resistance . (A) Peripheral blood T cells from healthy donors were isolated by negative selection.
    [Show full text]
  • Evidence for an Interaction Between the Insulin Receptor and Grb7. a Role for Two of Its Binding Domains, PIR and SH2
    Oncogene (2000) 19, 2052 ± 2059 ã 2000 Macmillan Publishers Ltd All rights reserved 0950 ± 9232/00 $15.00 www.nature.com/onc Evidence for an interaction between the insulin receptor and Grb7. A role for two of its binding domains, PIR and SH2 Anne Kasus-Jacobi1,2,3,Ve ronique Be re ziat1,3, Dominique Perdereau1, Jean Girard1 and Anne-FrancËoise Burnol*,1 1Endocrinologie MeÂtabolisme et DeÂveloppement, CNRS, UPR 1524, 9 rue Jules Hetzel, 92190 Meudon, France The molecular adapter Grb7 is likely to be implicated in new family of adapters has recently emerged, the Grb7 the development of certain cancer types. In this study we family of proteins, comprising Grb7, Grb10 and show that Grb7 binds the insulin receptors, when they Grb14. The members of this family were originally are activated and tyrosine phosphorylated. This interac- cloned by interaction with EGF receptor, using the tion is documented by two-hybrid experiments, GST CORT (cloning of receptor target) system (Daly et al., pull-down assays and in vivo coimmunoprecipitations. In 1996; Margolis, 1994; Ooi et al., 1995), and the use of addition, our results argue in favor of a preferential the yeast two-hybrid technology has emphasized their association between Grb7 and the insulin receptors when implication in signal transduction (Daly, 1998). These compared to other tyrosine kinase receptors like the adapters bind also other tyrosine kinase receptors, like EGF receptor, the FGF receptor and Ret. Interestingly, erbB2, Ret, Elk, PDGF receptors, insulin receptors and Grb7 is not a substrate of the insulin receptor tyrosine IGF-1 receptors (Daly et al., 1996; Dey et al., 1996; kinase activity.
    [Show full text]
  • Transcriptional Regulation of Kinases Downstream of the T Cell Receptor
    Petrillo et al. BMC Pharmacology and Toxicology 2014, 15:35 http://www.biomedcentral.com/2050-6511/15/35 RESEARCH ARTICLE Open Access Transcriptional regulation of kinases downstream of the T cell receptor: another immunomodulatory mechanism of glucocorticoids Maria Grazia Petrillo1†, Katia Fettucciari2†, Paolo Montuschi3†, Simona Ronchetti1, Luigi Cari1, Graziella Migliorati1, Emanuela Mazzon4, Oxana Bereshchenko1, Stefano Bruscoli1, Giuseppe Nocentini1,5* and Carlo Riccardi1 Abstract Background: Glucocorticoids affect peripheral immune responses, including modulation of T-cell activation, differentiation, and apoptosis. The quantity and quality of T-cell receptor (TCR)-triggered intracellular signals modulate T-cell function. Thus, glucocorticoids may affect T cells by interfering with the TCR signaling cascade. The purpose of the study was to search for glucocorticoid-modulated kinases downstream of the TCR. Methods: Gene modulation in lymphoid cells either treated with glucocorticoids or from glucocorticoid-treated mice was studied using a RNase protection assay, real-time PCR, and western blotting. The sensitivity of genetically modified thymocytes to glucocorticoid-induced apoptosis was studied by performing hypotonic propidium iodide staining and flow cytometry. The Student’s t-test was employed for statistical evaluation. Results: We found that transcription of Itk, a non-receptor tyrosine kinase of the Tec family, was up-regulated in a mouse T-cell hybridoma by the synthetic glucocorticoid dexamethasone. In contrast, dexamethasone down-regulated the expression of Txk, a Tec kinase that functions redundantly with Itk, and Lck, the Src kinase immediately downstream of the TCR. We investigated the expression of Itk, Txk,andLck in thymocytes and mature lymphocytes following in vitro and in vivo dexamethasone treatment at different time points and doses.
    [Show full text]
  • Lipid-Targeting Pleckstrin Homology Domain Turns Its Autoinhibitory Face Toward the TEC Kinases
    Lipid-targeting pleckstrin homology domain turns its autoinhibitory face toward the TEC kinases Neha Amatyaa, Thomas E. Walesb, Annie Kwonc, Wayland Yeungc, Raji E. Josepha, D. Bruce Fultona, Natarajan Kannanc, John R. Engenb, and Amy H. Andreottia,1 aRoy J. Carver Department of Biochemistry, Biophysics and Molecular Biology, Iowa State University, Ames, IA 50011; bDepartment of Chemistry and Chemical Biology, Northeastern University, Boston, MA 02115; and cInstitute of Bioinformatics and Department of Biochemistry and Molecular Biology, University of Georgia, Athens, GA 30602 Edited by Natalie G. Ahn, University of Colorado Boulder, Boulder, CO, and approved September 17, 2019 (received for review May 3, 2019) The pleckstrin homology (PH) domain is well known for its phos- activation loop phosphorylation site are also controlled by noncatalytic pholipid targeting function. The PH-TEC homology (PHTH) domain domains (17). In addition to the N-terminal PHTH domain, the within the TEC family of tyrosine kinases is also a crucial component TEC kinases contain a proline-rich region (PRR) and Src ho- of the autoinhibitory apparatus. The autoinhibitory surface on the mology 3 (SH3) and Src homology 2 (SH2) domains that impinge PHTH domain has been previously defined, and biochemical investi- on the kinase domain to alter the conformational ensemble and gations have shown that PHTH-mediated inhibition is mutually thus the activation status of the enzyme. A crystal structure of the exclusive with phosphatidylinositol binding. Here we use hydrogen/ BTK SH3-SH2-kinase fragment has been solved (10) showing that deuterium exchange mass spectrometry, nuclear magnetic resonance the SH3 and SH2 domains of BTK assemble onto the distal side of (NMR), and evolutionary sequence comparisons to map where and the kinase domain (the surface opposite the activation loop), how the PHTH domain affects the Bruton’s tyrosine kinase (BTK) stabilizing the autoinhibited form of the kinase in a manner similar domain.
    [Show full text]
  • Src-Family Kinases Impact Prognosis and Targeted Therapy in Flt3-ITD+ Acute Myeloid Leukemia
    Src-Family Kinases Impact Prognosis and Targeted Therapy in Flt3-ITD+ Acute Myeloid Leukemia Title Page by Ravi K. Patel Bachelor of Science, University of Minnesota, 2013 Submitted to the Graduate Faculty of School of Medicine in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Pittsburgh 2019 Commi ttee Membership Pa UNIVERSITY OF PITTSBURGH SCHOOL OF MEDICINE Commi ttee Membership Page This dissertation was presented by Ravi K. Patel It was defended on May 31, 2019 and approved by Qiming (Jane) Wang, Associate Professor Pharmacology and Chemical Biology Vaughn S. Cooper, Professor of Microbiology and Molecular Genetics Adrian Lee, Professor of Pharmacology and Chemical Biology Laura Stabile, Research Associate Professor of Pharmacology and Chemical Biology Thomas E. Smithgall, Dissertation Director, Professor and Chair of Microbiology and Molecular Genetics ii Copyright © by Ravi K. Patel 2019 iii Abstract Src-Family Kinases Play an Important Role in Flt3-ITD Acute Myeloid Leukemia Prognosis and Drug Efficacy Ravi K. Patel, PhD University of Pittsburgh, 2019 Abstract Acute myelogenous leukemia (AML) is a disease characterized by undifferentiated bone-marrow progenitor cells dominating the bone marrow. Currently the five-year survival rate for AML patients is 27.4 percent. Meanwhile the standard of care for most AML patients has not changed for nearly 50 years. We now know that AML is a genetically heterogeneous disease and therefore it is unlikely that all AML patients will respond to therapy the same way. Upregulation of protein-tyrosine kinase signaling pathways is one common feature of some AML tumors, offering opportunities for targeted therapy.
    [Show full text]
  • Itk Promotes the Integration of TCR and CD28 Costimulation, Through Its
    bioRxiv preprint doi: https://doi.org/10.1101/2020.09.11.293316; this version posted September 11, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Hallumi et al. 1 Article 2 Itk promotes the integration of TCR and CD28 3 costimulation, through its direct substrates, SLP-76 4 and Gads 5 Enas Hallumi1, Rose Shalah1, Wan-Lin Lo2, Jasmin Corso3, Ilana Oz1, Dvora Beach1, Samuel 6 Wittman1, Amy Isenberg1, Meirav Sela1, Henning Urlaub3,4, Arthur Weiss2,5 and Deborah 7 Yablonski1* 8 1 Department of Immunology, Ruth and Bruce Rappaport Faculty of Medicine, Technion—Israel Institute of 9 Technology, Haifa 3525433, Israel 10 2 Division of Rheumatology, Rosalind Russell and Ephraim P. Engleman Arthritis Research Center, 11 Department of Medicine, University of California, San Francisco, San Francisco, CA, USA 12 3 Bioanalytical Mass Spectrometry Group, Max Planck Institute for Biophysical Chemistry, Am Fassberg 11, 13 37077 Göttingen, Germany 14 4 Bioanalytics, Institute for Clinical Chemistry, University Medical Center Göttingen, Robert Koch Strasse 40, 15 37075 Göttingen, Germany 16 5 Howard Hughes Medical Institute, University of California, San Francisco, San Francisco, CA, USA 17 * Correspondence: [email protected] 18 Abstract: The costimulatory receptor, CD28, synergizes with the T cell antigen receptor (TCR) to 19 promote IL-2 production, cell survival and proliferation. Despite their profound synergy, the 20 obligatory interdependence of the signaling pathways initiated by these two receptors is not well 21 understood. Upon TCR stimulation, Gads, a Grb2-family adaptor, bridges the interaction of two 22 additional adaptors, LAT and SLP-76, to form a TCR-induced effector signaling complex.
    [Show full text]
  • HCC and Cancer Mutated Genes Summarized in the Literature Gene Symbol Gene Name References*
    HCC and cancer mutated genes summarized in the literature Gene symbol Gene name References* A2M Alpha-2-macroglobulin (4) ABL1 c-abl oncogene 1, receptor tyrosine kinase (4,5,22) ACBD7 Acyl-Coenzyme A binding domain containing 7 (23) ACTL6A Actin-like 6A (4,5) ACTL6B Actin-like 6B (4) ACVR1B Activin A receptor, type IB (21,22) ACVR2A Activin A receptor, type IIA (4,21) ADAM10 ADAM metallopeptidase domain 10 (5) ADAMTS9 ADAM metallopeptidase with thrombospondin type 1 motif, 9 (4) ADCY2 Adenylate cyclase 2 (brain) (26) AJUBA Ajuba LIM protein (21) AKAP9 A kinase (PRKA) anchor protein (yotiao) 9 (4) Akt AKT serine/threonine kinase (28) AKT1 v-akt murine thymoma viral oncogene homolog 1 (5,21,22) AKT2 v-akt murine thymoma viral oncogene homolog 2 (4) ALB Albumin (4) ALK Anaplastic lymphoma receptor tyrosine kinase (22) AMPH Amphiphysin (24) ANK3 Ankyrin 3, node of Ranvier (ankyrin G) (4) ANKRD12 Ankyrin repeat domain 12 (4) ANO1 Anoctamin 1, calcium activated chloride channel (4) APC Adenomatous polyposis coli (4,5,21,22,25,28) APOB Apolipoprotein B [including Ag(x) antigen] (4) AR Androgen receptor (5,21-23) ARAP1 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 (4) ARHGAP35 Rho GTPase activating protein 35 (21) ARID1A AT rich interactive domain 1A (SWI-like) (4,5,21,22,24,25,27,28) ARID1B AT rich interactive domain 1B (SWI1-like) (4,5,22) ARID2 AT rich interactive domain 2 (ARID, RFX-like) (4,5,22,24,25,27,28) ARID4A AT rich interactive domain 4A (RBP1-like) (28) ARID5B AT rich interactive domain 5B (MRF1-like) (21) ASPM Asp (abnormal
    [Show full text]