DOCSLIB.ORG

Regulation of Cancer Stemness in Breast Ductal Carcinoma in Situ by Vitamin D Compounds

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Regulation of Cancer Stemness in Breast Ductal Carcinoma in Situ by Vitamin D Compounds Author Manuscript Published OnlineFirst on May 28, 2020; DOI: 10.1158/1940-6207.CAPR-19-0566 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Analysis of the Transcriptome: Regulation of Cancer Stemness in Breast Ductal Carcinoma In Situ by Vitamin D Compounds Naing Lin Shan1, Audrey Minden1,5, Philip Furmanski1,5, Min Ji Bak1, Li Cai2,5, Roman Wernyj1, Davit Sargsyan3, David Cheng3, Renyi Wu3, Hsiao-Chen D. Kuo3, Shanyi N. Li3, Mingzhu Fang4, Hubert Maehr1, Ah-Ng Kong3,5, Nanjoo Suh1,5 1Department of Chemical Biology, Ernest Mario School of Pharmacy; 2Department of Biomedical Engineering, School of Engineering; 3Department of Pharmaceutics, Ernest Mario School of Pharmacy; 4Environmental and Occupational Health Sciences Institute and School of Public Health, 5Rutgers Cancer Institute of New Jersey, New Brunswick; Rutgers, The State University of New Jersey, NJ, USA Running title: Regulation of cancer stemness by vitamin D compounds Key words: Breast cancer, cancer stemness, gene expression, DCIS, vitamin D compounds Financial Support: This research was supported by the National Institutes of Health grant R01 AT007036, R01 AT009152, ES005022, Charles and Johanna Busch Memorial Fund at Rutgers University and the New Jersey Health Foundation. Corresponding author: Dr. Nanjoo Suh, Department of Chemical Biology, Ernest Mario School of Pharmacy, Rutgers, The State University of New Jersey, 164 Frelinghuysen Road, Piscataway, New Jersey 08854. Tel: 848-445-8030, Fax: 732-445-0687; e-mail: [email protected] Disclosure of Conflict of Interest: “The authors declare no potential conflicts of interest” 1 Downloaded from cancerpreventionresearch.aacrjournals.org on October 1, 2021. © 2020 American Association for Cancer Research. Author Manuscript Published OnlineFirst on May 28, 2020; DOI: 10.1158/1940-6207.CAPR-19-0566 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Article Type: Research Article Word count: 5,286 Total number of figures and tables: Figures-4 and Tables-2 2 Downloaded from cancerpreventionresearch.aacrjournals.org on October 1, 2021. © 2020 American Association for Cancer Research. Author Manuscript Published OnlineFirst on May 28, 2020; DOI: 10.1158/1940-6207.CAPR-19-0566 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. ABSTRACT Ductal carcinoma in situ (DCIS), which accounts for one out of every five new breast cancer diagnoses, will progress to potentially lethal invasive ductal carcinoma (IDC) in about 50% of cases. Vitamin D compounds have been shown to inhibit progression to IDC in the MCF10DCIS model. This inhibition appears to involve a reduction in the cancer stem cell-like population in MCF10DCIS tumors. To identify genes that are involved in the vitamin D effects, a global transcriptomic analysis was undertaken of MCF10DCIS cells grown in mammosphere cultures, in which cancer stem-like cells grow preferentially and produce colonies by self-renewal and maturation, in the presence and absence of 1α25(OH)2D3 and a vitamin D analog, BXL0124. Using next-generation RNA sequencing, we found that vitamin D compounds down-regulated genes involved in maintenance of breast cancer stem-like cells (e.g. GDF15), epithelial-mesenchymal transition, invasion and metastasis (e.g. LCN2, S100A4), chemo- resistance (e.g. NGFR, PPP1R1B, AGR2), while up-regulating genes associated with a basal-like phenotype (e.g. KRT6A, KRT5) and negative regulators of breast tumorigenesis (e.g. EMP1). Gene methylation status was analyzed to determine whether the changes in expression induced by vitamin D compounds occurred via this mechanism. Ingenuity pathway analysis was performed to identify upstream regulators and downstream signaling pathway genes differentially regulated by vitamin D, including TP63 and vitamin D receptor (VDR) mediated canonical pathways in particular. This study provides a global profiling of changes in the gene signature of DCIS regulated by vitamin D compounds and possible targets for chemoprevention of DCIS progression to IDC in patients. 3 Downloaded from cancerpreventionresearch.aacrjournals.org on October 1, 2021. © 2020 American Association for Cancer Research. Author Manuscript Published OnlineFirst on May 28, 2020; DOI: 10.1158/1940-6207.CAPR-19-0566 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Introduction Breast cancer is the most common cancer and the second leading cause of cancer related deaths in women worldwide [1]. Based on the presence or absence of estrogen receptor (ER), progesterone receptor (PR) and human epidermal growth factor receptor-2 (HER2), breast cancers are divided into subtypes: luminal A (ER+ and/or PR+; HER2–), luminal B (ER+ and/or PR+; HER2+), basal-like (ER–, PR–, and HER2–), and HER2-enriched (ER–, PR–, and HER2+) [2]. Breast cancer development is a multi-step process that involves epigenetic and genetic changes contributing to aberrant cell growth [3]. Histologically, breast cancer can be staged into invasive ductal carcinoma, ductal carcinoma in situ (DCIS) and invasive lobular carcinoma. About 20% of breast cancers newly diagnosed in 2019 among US women will be classified as DCIS, amounting to over 48,000 cases [4]. DCIS is an early stage, non- invasive type characterized by proliferation of malignant epithelial cells in the ducts [5]. It arises from atypical ductal hyperplasia and may progress to invasive ductal carcinoma (IDC) and metastatic cancer [5]. It is predicted that up to 50% of the DCIS cases will progress to IDC within 10 years of initial diagnosis [6]. Gene expression and microRNA analyses have been performed to elucidate the molecular characteristics of DCIS progression to IDC [7, 8]. However, the natural history of progression of DCIS to IDC is yet to be fully determined. Cancer stem cells (CSCs) were first identified in breast cancer using the cell surface markers CD44+/CD24- [9]. This population is characterized by a stem-cell gene expression signatures, drug- resistant phenotype and self-renewal capacity in vitro and in vivo [10]. Human DCIS lesions form spheroids and duct-like structures in ex vivo organoid culture and tumors in immunodeficient mice, suggestive of the presence of CSC-like cells in these early tumors [11]. MCF10DCIS.COM was derived from the non-tumorigenic MCF10A human breast cell line and exhibits basal-like subtype properties [12]. It is similar to human DCIS with bi-potentiality that can give rise to both myoepithelial and luminal cells and spontaneous progression to invasive breast cancer in vivo [13], and it is widely used as a model for IDC development from precursor lesions. MCF10DCIS.COM cultures and tumors contain high ALDH1+ 4 Downloaded from cancerpreventionresearch.aacrjournals.org on October 1, 2021. © 2020 American Association for Cancer Research. Author Manuscript Published OnlineFirst on May 28, 2020; DOI: 10.1158/1940-6207.CAPR-19-0566 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. and CD44+/CD49f+/CD24− subpopulations with increased self-renewal and tumor development capabilities, similar to CSCs of fully invasive tumors [14]. Vitamin D signaling is known to be a potential target for breast cancer chemoprevention [15]. Our laboratory has shown that vitamin D compounds inhibit triple negative breast cancer tumorigenesis by reducing expression of cancer stem-cell associated genes, including OCT4 and CD44, and by inducing differentiation and up-regulating myoepithelial markers [16]. These compounds reduce in vitro mammosphere formation and in vivo tumorigenesis, although the molecular mechanisms of these effects are not known. BXL0124 is an analog of calcitriol (1α25(OH)2D3) modified with an additional side chain at C21-methyl group, endowing it with more biological activity at lower concentrations without causing hypercalcemia, a limiting side effect of vitamin D [17]. BXL0124 also inhibits MCF10DCIS xenograft tumorigenesis more potently than 1α25(OH)2D3, apparently through the similar mechanism of suppressing cancer stem cells [18]. The present study was undertaken to develop global profiles of changes in gene expression and CpG methylation in MCF10DCIS cells induced by vitamin D compounds, to gain an understanding of the pathways involved in their overall effects and the molecular basis of their activities, and to identify potential targets that could be exploited in the chemoprevention of breast cancer progression from DCIS to IDC. Materials and methods Reagents and cell culture 1α25(OH)2D3 and a Gemini vitamin D analog (BXL0124; 1α,25-dihydroxy-20R-21(3-hydroxy-3- deuteromethyl-4,4,4-trideuterobutyl)-23-yne-26,27-hexafluoro-cholecalciferol, >95% purity) were provided by BioXell, Inc. (Nutley, NJ) [17]. Vitamin D compounds were dissolved in DMSO. MCF10DCIS.com human breast cancer cells (MCF10DCIS, RRID: CVCL_5552) were provided by Dr. Fred Miller at the Barbara Ann Karmanos Cancer Institute (Detroit, MI). Cells were maintained in DMEM/F12 medium supplemented with 5% horse serum, 1% penicillin/streptomycin, and 1% HEPES 5 Downloaded from cancerpreventionresearch.aacrjournals.org on October 1, 2021. © 2020 American Association for Cancer Research. Author Manuscript Published OnlineFirst on May 28, 2020; DOI: 10.1158/1940-6207.CAPR-19-0566 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. solution
Load more

Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • Screening and Identification of Key Biomarkers in Clear Cell Renal Cell Carcinoma Based on Bioinformatics Analysis
    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Screening and identification of key biomarkers in clear cell renal cell carcinoma based on bioinformatics analysis Basavaraj Vastrad1, Chanabasayya Vastrad*2 , Iranna Kotturshetti 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. 3. Department of Ayurveda, Rajiv Gandhi Education Society`s Ayurvedic Medical College, Ron, Karnataka 562209, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Clear cell renal cell carcinoma (ccRCC) is one of the most common types of malignancy of the urinary system. The pathogenesis and effective diagnosis of ccRCC have become popular topics for research in the previous decade. In the current study, an integrated bioinformatics analysis was performed to identify core genes associated in ccRCC. An expression dataset (GSE105261) was downloaded from the Gene Expression Omnibus database, and included 26 ccRCC and 9 normal kideny samples. Assessment of the microarray dataset led to the recognition of differentially expressed genes (DEGs), which was subsequently used for pathway and gene ontology (GO) enrichment analysis.
    [Show full text]
  • Transcription Factor Creb3l1 Regulates the Synthesis of Prohormone Convertase Enzyme PC1/3 in Endocrine Cells
    Greenwood, M., Paterson, A., Rahman, P. A., Gillard, B. T., Langley, S., Iwasaki, Y., Murphy, D., & Greenwood, M. P. (2020). Transcription factor Creb3l1 regulates the synthesis of prohormone convertase enzyme PC1/3 in endocrine cells. Journal of Neuroendocrinology, 32(4), [E12851]. https://doi.org/10.1111/jne.12851 Publisher's PDF, also known as Version of record License (if available): CC BY Link to published version (if available): 10.1111/jne.12851 Link to publication record in Explore Bristol Research PDF-document This is the final published version of the article (version of record). It first appeared online via Wiley at https://onlinelibrary.wiley.com/doi/full/10.1111/jne.12851 . Please refer to any applicable terms of use of the publisher. University of Bristol - Explore Bristol Research General rights This document is made available in accordance with publisher policies. Please cite only the published version using the reference above. Full terms of use are available: http://www.bristol.ac.uk/red/research-policy/pure/user-guides/ebr-terms/ Received: 11 November 2019 | Revised: 31 March 2020 | Accepted: 31 March 2020 DOI: 10.1111/jne.12851 ORIGINAL ARTICLE Transcription factor Creb3l1 regulates the synthesis of prohormone convertase enzyme PC1/3 in endocrine cells Mingkwan Greenwood1 | Alex Paterson1 | Parveen Akhter Rahman1 | Benjamin Thomas Gillard1 | Sydney Langley1 | Yasumasa Iwasaki2 | David Murphy1 | Michael Paul Greenwood1 1Translational Health Sciences, Bristol Medical School, University of Bristol, Bristol, Abstract UK Transcription factor cAMP responsive element-binding protein 3 like 1 (Creb3l1) is a 2 Health Care Center, Kochi University, non-classical endoplasmic reticulum stress molecule that is emerging as an important Kochi, Japan component for cellular homeostasis, particularly within cell types with high peptide Correspondence secretory capabilities.
    [Show full text]
  • Atlas Antibodies in Breast Cancer Research Table of Contents
    ATLAS ANTIBODIES IN BREAST CANCER RESEARCH TABLE OF CONTENTS The Human Protein Atlas, Triple A Polyclonals and PrecisA Monoclonals (4-5) Clinical markers (6) Antibodies used in breast cancer research (7-13) Antibodies against MammaPrint and other gene expression test proteins (14-16) Antibodies identified in the Human Protein Atlas (17-14) Finding cancer biomarkers, as exemplified by RBM3, granulin and anillin (19-22) Co-Development program (23) Contact (24) Page 2 (24) Page 3 (24) The Human Protein Atlas: a map of the Human Proteome The Human Protein Atlas (HPA) is a The Human Protein Atlas consortium cell types. All the IHC images for Swedish-based program initiated in is mainly funded by the Knut and Alice the normal tissue have undergone 2003 with the aim to map all the human Wallenberg Foundation. pathology-based annotation of proteins in cells, tissues and organs expression levels. using integration of various omics The Human Protein Atlas consists of technologies, including antibody- six separate parts, each focusing on References based imaging, mass spectrometry- a particular aspect of the genome- 1. Sjöstedt E, et al. (2020) An atlas of the based proteomics, transcriptomics wide analysis of the human proteins: protein-coding genes in the human, pig, and and systems biology. mouse brain. Science 367(6482) 2. Thul PJ, et al. (2017) A subcellular map of • The Tissue Atlas shows the the human proteome. Science. 356(6340): All the data in the knowledge resource distribution of proteins across all eaal3321 is open access to allow scientists both major tissues and organs in the 3.
    [Show full text]
  • View Is Portrayed Schematically in Figure 7B
    BASIC RESEARCH www.jasn.org Recombination Signal Binding Protein for Ig-kJ Region Regulates Juxtaglomerular Cell Phenotype by Activating the Myo-Endocrine Program and Suppressing Ectopic Gene Expression † † ‡ Ruth M. Castellanos-Rivera,* Ellen S. Pentz,* Eugene Lin,* Kenneth W. Gross, † Silvia Medrano,* Jing Yu,§ Maria Luisa S. Sequeira-Lopez,* and R. Ariel Gomez* *Department of Pediatrics, School of Medicine, †Department of Biology, Graduate School of Arts and Sciences, and §Department of Cell Biology, University of Virginia, Charlottesville, Virginia; and ‡Department of Molecular and Cellular Biology, Roswell Park Cancer Institute, Buffalo, New York ABSTRACT Recombination signal binding protein for Ig-kJ region (RBP-J), the major downstream effector of Notch signaling, is necessary to maintain the number of renin-positive juxtaglomerular cells and the plasticity of arteriolar smooth muscle cells to re-express renin when homeostasis is threatened. We hypothesized that RBP-J controls a repertoire of genes that defines the phenotype of the renin cell. Mice bearing a bacterial artificial chromosome reporter with a mutated RBP-J binding site in the renin promoter had markedly reduced reporter expression at the basal state and in response to a homeostatic challenge. Mice with conditional deletion of RBP-J in renin cells had decreased expression of endocrine (renin and Akr1b7)and smooth muscle (Acta2, Myh11, Cnn1,andSmtn) genes and regulators of smooth muscle expression (miR- 145, SRF, Nfatc4, and Crip1). To determine whether RBP-J deletion decreased the endowment of renin cells, we traced the fate of these cells in RBP-J conditional deletion mice. Notably, the lineage staining patterns in mutant and control kidneys were identical, although mutant kidneys had fewer or no renin- expressing cells in the juxtaglomerular apparatus.
    [Show full text]
  • Single Amino Acid Repeats in the Proteome World: Structural, Functional, and Evolutionary Insights
    RESEARCH ARTICLE Single Amino Acid Repeats in the Proteome World: Structural, Functional, and Evolutionary Insights Amitha Sampath Kumar, Divya Tej Sowpati, Rakesh K. Mishra* Centre for Cellular and Molecular Biology, Council of Scientific and Industrial Research, Uppal Road, Hyderabad, 500007, India * [email protected] a11111 Abstract Microsatellites or simple sequence repeats (SSR) are abundant, highly diverse stretches of short DNA repeats present in all genomes. Tandem mono/tri/hexanucleotide repeats in the coding regions contribute to single amino acids repeats (SAARs) in the proteome. While SSRs in the coding region always result in amino acid repeats, a majority of SAARs arise due to a combination of various codons representing the same amino acid and not as a con- OPEN ACCESS sequence of SSR events. Certain amino acids are abundant in repeat regions indicating a Citation: Kumar AS, Sowpati DT, Mishra RK (2016) Single Amino Acid Repeats in the Proteome positive selection pressure behind the accumulation of SAARs. By analysing 22 proteomes World: Structural, Functional, and Evolutionary including the human proteome, we explored the functional and structural relationship of Insights. PLoS ONE 11(11): e0166854. amino acid repeats in an evolutionary context. Only ~15% of repeats are present in any doi:10.1371/journal.pone.0166854 known functional domain, while ~74% of repeats are present in the disordered regions, sug- Editor: Eugene A. Permyakov, Russian Academy of gesting that SAARs add to the functionality of proteins by providing flexibility, stability and Medical Sciences, RUSSIAN FEDERATION act as linker elements between domains. Comparison of SAAR containing proteins across Received: August 28, 2016 species reveals that while shorter repeats are conserved among orthologs, proteins with Accepted: November 5, 2016 longer repeats, >15 amino acids, are unique to the respective organism.
    [Show full text]
  • A Cell Line P53 Mutation Type UM
    A Cell line p53 mutation Type UM-SCC 1 wt UM-SCC5 Exon 5, 157 GTC --> TTC Missense mutation by transversion (Valine --> Phenylalanine UM-SCC6 wt UM-SCC9 wt UM-SCC11A wt UM-SCC11B Exon 7, 242 TGC --> TCC Missense mutation by transversion (Cysteine --> Serine) UM-SCC22A Exon 6, 220 TAT --> TGT Missense mutation by transition (Tyrosine --> Cysteine) UM-SCC22B Exon 6, 220 TAT --> TGT Missense mutation by transition (Tyrosine --> Cysteine) UM-SCC38 Exon 5, 132 AAG --> AAT Missense mutation by transversion (Lysine --> Asparagine) UM-SCC46 Exon 8, 278 CCT --> CGT Missense mutation by transversion (Proline --> Alanine) B 1 Supplementary Methods Cell Lines and Cell Culture A panel of ten established HNSCC cell lines from the University of Michigan series (UM-SCC) was obtained from Dr. T. E. Carey at the University of Michigan, Ann Arbor, MI. The UM-SCC cell lines were derived from eight patients with SCC of the upper aerodigestive tract (supplemental Table 1). Patient age at tumor diagnosis ranged from 37 to 72 years. The cell lines selected were obtained from patients with stage I-IV tumors, distributed among oral, pharyngeal and laryngeal sites. All the patients had aggressive disease, with early recurrence and death within two years of therapy. Cell lines established from single isolates of a patient specimen are designated by a numeric designation, and where isolates from two time points or anatomical sites were obtained, the designation includes an alphabetical suffix (i.e., "A" or "B"). The cell lines were maintained in Eagle's minimal essential media supplemented with 10% fetal bovine serum and penicillin/streptomycin.
    [Show full text]
  • Of Keeping and Tipping the Balance: Host Regulation and Viral Modulation of IRF3-Dependent IFNB1 Expression
    viruses Review Of Keeping and Tipping the Balance: Host Regulation and Viral Modulation of IRF3-Dependent IFNB1 Expression Hella Schwanke 1,2 , Markus Stempel 1,2 and Melanie M. Brinkmann 1,2,* 1 Institute of Genetics, Technische Universität Braunschweig, 38106 Braunschweig, Germany; [email protected] (H.S.); [email protected] (M.S.) 2 Viral Immune Modulation Research Group, Helmholtz Centre for Infection Research, 38124 Braunschweig, Germany * Correspondence: [email protected]; Tel.: +49-531-6181-3069 Received: 15 June 2020; Accepted: 3 July 2020; Published: 7 July 2020 Abstract: The type I interferon (IFN) response is a principal component of our immune system that allows to counter a viral attack immediately upon viral entry into host cells. Upon engagement of aberrantly localised nucleic acids, germline-encoded pattern recognition receptors convey their find via a signalling cascade to prompt kinase-mediated activation of a specific set of five transcription factors. Within the nucleus, the coordinated interaction of these dimeric transcription factors with coactivators and the basal RNA transcription machinery is required to access the gene encoding the type I IFN IFNβ (IFNB1). Virus-induced release of IFNβ then induces the antiviral state of the system and mediates further mechanisms for defence. Due to its key role during the induction of the initial IFN response, the activity of the transcription factor interferon regulatory factor 3 (IRF3) is tightly regulated by the host and fiercely targeted by viral proteins at all conceivable levels. In this review, we will revisit the steps enabling the trans-activating potential of IRF3 after its activation and the subsequent assembly of the multi-protein complex at the IFNβ enhancer that controls gene expression.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • CREB3L1 Antibody (C-Term) Purified Rabbit Polyclonal Antibody (Pab) Catalog # Ap6589b
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 CREB3L1 Antibody (C-term) Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP6589b Specification CREB3L1 Antibody (C-term) - Product Information Application WB, IHC-P, FC,E Primary Accession Q96BA8 Other Accession NP_443086 Reactivity Human, Mouse Host Rabbit Clonality Polyclonal Isotype Rabbit Ig Calculated MW 57005 Antigen Region 481-509 CREB3L1 Antibody (C-term) - Additional Information Western blot analysis of CREB3L1 Antibody Gene ID 90993 (C-term) (Cat. #AP6589b) in mouse stomach tissue lysates (35ug/lane). CREB3L1 (arrow) Other Names Cyclic AMP-responsive element-binding was detected using the purified Pab. protein 3-like protein 1, cAMP-responsive element-binding protein 3-like protein 1, Old astrocyte specifically-induced substance, OASIS, Processed cyclic AMP-responsive element-binding protein 3-like protein 1, CREB3L1, OASIS Target/Specificity This CREB3L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 481-509 amino acids from the C-terminal region of human CREB3L1. Dilution WB~~1:8000 IHC-P~~1:50~100 FC~~1:10~50 Anti-CREB3L1 Antibody (C-term) at 1:8000 Format dilution + HepG2 whole cell lysate Purified polyclonal antibody supplied in PBS Lysates/proteins at 20 µg per lane. with 0.09% (W/V) sodium azide. This Secondary Goat Anti-Rabbit IgG, (H+L), antibody is prepared by Saturated Peroxidase conjugated at 1/10000 dilution. Ammonium Sulfate (SAS) precipitation Predicted band size : 57 kDa followed by dialysis against PBS. Blocking/Dilution buffer: 5% NFDM/TBST. Storage Maintain refrigerated at 2-8°C for up to 2 Page 1/3 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 weeks.
    [Show full text]
  • Emerging Roles of the Endoplasmic Reticulum Associated Unfolded Protein Response in Cancer Cell Migration and Invasion
    cancers Review Emerging Roles of the Endoplasmic Reticulum Associated Unfolded Protein Response in Cancer Cell Migration and Invasion Celia Maria Limia 1,2,3,4,5, Chloé Sauzay 1,2, Hery Urra 3,4 , Claudio Hetz 3,4,5,6,7, Eric Chevet 1,2,8 and Tony Avril 1,2,8,* 1 Proteostasis & Cancer Team, Institut National de la Santé Et la Recherche Médicale U1242 Chemistry, Oncogenesis, Stress and Signaling, Université de Rennes, 35042 Rennes, France; [email protected] (C.M.L.); [email protected] (C.S.); [email protected] (E.C.) 2 Centre Eugène Marquis, 35042 Rennes, France 3 Biomedical Neuroscience Institute, University of Chile, 8380453 Santiago, Chile; [email protected] (H.U.); [email protected] (C.H.) 4 Center for Geroscience, Brain Health and Metabolism (GERO), 8380453 Santiago, Chile 5 Institute of Biomedical Sciences (ICBM), Faculty of Medicine, University of Chile, 8380453 Santiago, Chile 6 The Buck Institute for Research in Aging, Novato, CA 94945, USA 7 Department of Immunology and Infectious Diseases, Harvard School of Public Health, Boston, MA 02115, USA 8 Rennes Brain Cancer Team (REACT), 35042 Rennes, France * Correspondence: [email protected] Received: 9 April 2019; Accepted: 1 May 2019; Published: 6 May 2019 Abstract: Endoplasmic reticulum (ER) proteostasis is often altered in tumor cells due to intrinsic (oncogene expression, aneuploidy) and extrinsic (environmental) challenges. ER stress triggers the activation of an adaptive response named the Unfolded Protein Response (UPR), leading to protein translation repression, and to the improvement of ER protein folding and clearance capacity. The UPR is emerging as a key player in malignant transformation and tumor growth, impacting on most hallmarks of cancer.
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]