DOCSLIB.ORG

1199SEIU Benefit Funds

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
1199SEIU Benefit Funds 1199SEIU Benefit Funds The following codes are under management for members who have health benefits covered by 1199SEIU Benefit Funds, administered by eviCore healthcare. Commercial Effective 5/1/14 Claims Policies Effective 7/1/14 Procedure Code Full Description How Code is Managed Effective Date Termination Date Human Platelet Antigen 1 genotyping (HPA-1), ITGB3 (integrin, beta 3 [platelet glycoprotein IIIa], 81105 antigen CD61 [GPIIIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), Claim Policies Apply 01/01/18 None gene analysis, common variant, HPA-1a/b (L33P) Human Platelet Antigen 2 genotyping (HPA-2), GP1BA (glycoprotein Ib [platelet], alpha polypeptide 81106 [GPIba]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), gene Claim Policies Apply 01/01/18 None analysis, common variant, HPA-2a/b (T145M) Human Platelet Antigen 3 genotyping (HPA-3), ITGA2B (integrin, alpha 2b [platelet glycoprotein IIb of 81107 IIb/IIIa complex], antigen CD41 [GPIIb]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post- Claim Policies Apply 01/01/18 None transfusion purpura), gene analysis, common variant, HPA-3a/b (I843S) Human Platelet Antigen 4 genotyping (HPA-4), ITGB3 (integrin, beta 3 [platelet glycoprotein IIIa], 81108 antigen CD61 [GPIIIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), Claim Policies Apply 01/01/18 None gene analysis, common variant, HPA-4a/b (R143Q) Human Platelet Antigen 5 genotyping (HPA-5), ITGA2 (integrin, alpha 2 [CD49B, alpha 2 subunit of 81109 VLA-2 receptor] [GPIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion Claim Policies Apply 01/01/18 None purpura), gene analysis, common variant (eg, HPA-5a/b (K505E)) Human Platelet Antigen 6 genotyping (HPA-6w), ITGB3 (integrin, beta 3 [platelet glycoprotein IIIa, 81110 antigen CD61] [GPIIIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion Claim Policies Apply 01/01/18 None purpura), gene analysis, common variant, HPA-6a/b (R489Q) Human Platelet Antigen 9 genotyping (HPA-9w), ITGA2B (integrin, alpha 2b [platelet glycoprotein IIb 81111 of IIb/IIIa complex, antigen CD41] [GPIIb]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post- Claim Policies Apply 01/01/18 None transfusion purpura), gene analysis, common variant, HPA-9a/b (V837M) Human Platelet Antigen 15 genotyping (HPA-15), CD109 (CD109 molecule) (eg, neonatal alloimmune 81112 thrombocytopenia [NAIT], post-transfusion purpura), gene analysis, common variant, HPA-15a/b Claim Policies Apply 01/01/18 None (S682Y) IDH1 (isocitrate dehydrogenase 1 [NADP+], soluble) (eg, glioma), common variants (eg, R132H, 81120 R132C) Claim Policies Apply 01/01/18 None IDH2 (isocitrate dehydrogenase 2 [NADP+], mitochondrial) (eg, glioma), common variants (eg, 81121 R140W, R172M) Claim Policies Apply 01/01/18 None DMD (dystrophin) (eg, Duchenne/Becker muscular dystrophy) deletion analysis, and duplication Claim Policies Apply 01/01/13 None 81161 analysis, if performed BRCA1 (BRCA1, DNA repair associated), BRCA2 (BRCA2, DNA repair associated) (eg, hereditary 81162 breast and ovarian cancer) gene analysis; full sequence analysis and full duplication/deletion analysis Requires Prior Authorization 01/01/16 None (ie, detection of large gene rearrangements BRCA1 (BRCA1, DNA repair associated), BRCA2 (BRCA2, DNA repair associated) (eg, hereditary Requires Prior Authorization 01/01/19 None 81163 breast and ovarian cancer) gene analysis; full sequence analysis BRCA1 (BRCA1, DNA repair associated), BRCA2 (BRCA2, DNA repair associated) (eg, hereditary 81164 breast and ovarian cancer) gene analysis; full duplication/deletion analysis (ie, detection of large gene Requires Prior Authorization 01/01/19 None rearrangements) BRCA1 (BRCA1, DNA repair associated) (eg, hereditary breast and ovarian cancer) gene analysis; Requires Prior Authorization 01/01/19 None 81165 full sequence analysis BRCA1 (BRCA1, DNA repair associated) (eg, hereditary breast and ovarian cancer) gene analysis; Requires Prior Authorization 01/01/19 None 81166 full duplication/deletion anlaysis (ie, detection of large gene rearrangements) Page 1 of 21 Procedure Code Full Description How Code is Managed Effective Date Termination Date BRCA2 (BRCA2, DNA repair associated) (eg, hereditary breast and ovarian cancer) gene analysis; 01/01/19 None 81167 full duplication/deletion analysis (ie, detection of large gene rearrangements) Requires Prior Authorization ABL1 (ABL proto-oncogene 1, non-receptor tyrosine kinase) (eg, acquired imatinib tyrosine kinase 81170 inhibitor resistance), gene analysis, variants in the kinase domain Claim Policies Apply 01/01/16 None AFF2 (AF4/FMR2 family, member 2 [FMR2]) (eg,fragile X mental retardation 2 [FRAXE]) gene 01/01/19 None 81171 analysis; evaluation to detect abnormal (eg,expanded) alleles Claim Policies Apply AFF2 (AF4/FMR2 family, member 2 [FMR2]) (eg,fragile X mental retardation 2 [FRAXE]) gene 01/01/19 None 81172 analysis; characterization of alleles (eg, expanded size and methylation status) Claim Policies Apply AR (androgen receptor) (eg, spinal and bulbar muscular atrophy, Kennedy disease, X chromosome 01/01/19 None 81173 inactivation) gene analysis; full gene sequence Requires Prior Authorization AR (androgen receptor) (eg, spinal and bulbar muscular atrophy, Kennedy disease, X chromosome 01/01/19 None 81174 inactivation) gene analysis; known familial variant Requires Prior Authorization ASXL1 (additional sex combs like 1, transcriptional regulator) (eg, myelodysplastic syndrome, 81175 myeloproliferative neoplasms, chronic myelomonocytic leukemia), gene analysis; full gene sequence Claim Policies Apply 01/01/18 None ASXL1 (additional sex combs like 1, transcriptional regulator) (eg, myelodysplastic syndrome, 81176 myeloproliferative neoplasms, chronic myelomonocytic leukemia), gene analysis; targeted sequence Claim Policies Apply 01/01/18 None analysis (eg, exon 12) 81177 ATN1 (atrophin 1) (eg, dentatorubral-pallidoluysian atrophy) gene analysis, evaluation to detect Claim Policies Apply 01/01/19 None abnormal (eg, expanded) allele 81178 ATXN1 (ataxin 1) (eg, spinocerebellar ataxia) gene analysis, evaluation to detect abnormal (eg, Claim Policies Apply 01/01/19 None expanded) allele ATXN2 (ataxin 2) (eg, spinocerebellar ataxia) gene analysis, evaluation to detect abnormal (eg, 01/01/19 None 81179 expanded) alleles Claim Policies Apply ATXN3 (ataxin 3) (eg, spinocerebellar ataxia, Machado-Joseph disease) gene analysis, evaluation to 01/01/19 None 81180 detect abnormal (eg, expanded) allele Claim Policies Apply ATXN7 (ataxin 7) (eg, spinocerebellar ataxia) gene analysis, evaluation to detect abnormal (eg, 01/01/19 None 81181 expanded) alleles Claim Policies Apply ATXN8OS (ATXN8 opposite strand [non-protein coding]) (eg, spinocerebellar ataxia) gene analysis, Claim Policies Apply 01/01/19 None 81182 evaluation to detect abnormal (eg, expanded) alleles ATXN10 (ataxin 10) (eg, spinocerebellar ataxia) gene analysis, evaluation to detect abnormal (eg, Claim Policies Apply 01/01/19 None 81183 expanded) alleles CACNA1A (calcium voltage-gated channel subunit alpha1 A) (eg, spinocerebellar ataxia) gene Claim Policies Apply 01/01/19 None 81184 analysis; evaluation to detect abnormal (eg, expanded) alleles CACNA1A (calcium voltage-gated channel subunit alpha1 A) (eg, spinocerebellar ataxia) gene 81185 analysis; full gene sequence Requires Prior Authorization 01/01/19 None CACNA1A (calcium voltage-gated channel subunit alpha1 A) (eg, spinocerebellar ataxia) gene Requires Prior Authorization 01/01/19 None 81186 analysis; known familial variant CNBP (CCHC-type zinc finger nucleic acid binding protein) (eg, myotonic dystrophy type 2) gene Claim Policies Apply 01/01/19 None 81187 analysis, evaluation to detect abnormal (eg, expanded) alleles CSTB (cystatin B) (eg, Unverricht-Lundborg disease) gene analysis; evaluation to detect abnormal Claim Policies Apply 01/01/19 None 81188 (eg, expanded) alleles 81189 CSTB (cystatin B) (eg, Unverricht-Lundborg disease) gene analysis; full gene sequence Requires Prior Authorization 01/01/19 None 81190 CSTB (cystatin B) (eg, Unverricht-Lundborg disease) gene analysis; known familial variant (s) Requires Prior Authorization 01/01/19 None 81200 ASPA (aspartoacylase) (eg, Canavan disease) gene analysis, common variants (eg, E285A, Y231X) Claim Policies Apply 01/01/12 None APC (adenomatous polyposis coli) (eg, familial adenomatosis polyposis [FAP], attenuated FAP) gene Requires Prior Authorization 01/01/13 None 81201 analysis; full gene sequence APC (adenomatous polyposis coli) (eg, familial adenomatosis polyposis [FAP], attenuated FAP) gene Requires Prior Authorization 01/01/13 None 81202 analysis; known familial variants APC (adenomatous polyposis coli) (eg, familial adenomatosis polyposis [FAP], attenuated FAP) gene Requires Prior Authorization 01/01/13 None 81203 analysis; duplication/deletion variants AR (androgen receptor) (eg,spinal and bulbar muscular atrophy, Kennedy disease, X chromosome Claim Policies Apply 01/01/19 None 81204 inactivation) gene analysis; characterization of alleles (eg,expanded size or methylation status) Page 2 of 21 Procedure Code Full Description How Code is Managed Effective Date Termination Date BCKDHB (branched-chain keto acid dehydrogenase E1, beta polypeptide) (eg, maple syrup urine 01/01/12 None 81205 disease) gene analysis, common variants (eg, R183P, G278S, E422X) Claim Policies Apply BCR/ABL1 (t(9;22)) (eg, chronic myelogenous leukemia) translocation
Load more

Recommended publications
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • 0268D98d499c00a44e5d919f5d
    Hindawi Publishing Corporation Stem Cells International Volume 2016, Article ID 5184601, 18 pages http://dx.doi.org/10.1155/2016/5184601 Research Article Phenotypic and Functional Characterization of Mesenchymal Stem/Multipotent Stromal Cells from Decidua Basalis of Human Term Placenta F. M. Abomaray,1,2,3 M. A. Al Jumah,1 K. O. Alsaad,4 D. Jawdat,1 A. Al Khaldi,5 A. S. AlAskar,1 S. Al Harthy,6 A. M. Al Subayyil,1 T. Khatlani,1 A. O. Alawad,6 A. Alkushi,4,7 B. Kalionis,8 and M. H. Abumaree1,7 1 King Abdullah International Medical Research Center, Mail Code 1515, P.O. Box 22490, Riyadh 11426, Saudi Arabia 2Department of Clinical Science, Intervention and Technology, Division of Obstetrics and Gynecology, Karolinska Institutet, 14186 Stockholm, Sweden 3Center for Hematology and Regenerative Medicine, Karolinska Institutet, 14186 Stockholm, Sweden 4King Abdulaziz Medical City, Department of Pathology, P.O. Box 22490, Riyadh 11426, Saudi Arabia 5King Abdulaziz Medical City, Division of Cardiac Surgery, P.O. Box 22490, Riyadh, Saudi Arabia 6National Center for Stem Cell Technology, Life Sciences and Environment Research Institute, King Abdulaziz City for Science and Technology, P.O. Box 6086, Riyadh 11442, Saudi Arabia 7College of Science and Health Professions, King Saud bin Abdulaziz University for Health Sciences, Mail Code 3124, P.O. Box 3660, Riyadh 11481, Saudi Arabia 8Department of Obstetrics and Gynaecology, University of Melbourne and Department of Perinatal Medicine Pregnancy Research Centre, Royal Women’s Hospital, Parkville, VIC 3052, Australia Correspondence should be addressed to M. H. Abumaree; [email protected] Received 5 November 2015; Revised 14 December 2015; Accepted 5 January 2016 Academic Editor: Albert Rizvanov Copyright © 2016 F.
    [Show full text]
  • Supp Table 6.Pdf
    Supplementary Table 6. Processes associated to the 2037 SCL candidate target genes ID Symbol Entrez Gene Name Process NM_178114 AMIGO2 adhesion molecule with Ig-like domain 2 adhesion NM_033474 ARVCF armadillo repeat gene deletes in velocardiofacial syndrome adhesion NM_027060 BTBD9 BTB (POZ) domain containing 9 adhesion NM_001039149 CD226 CD226 molecule adhesion NM_010581 CD47 CD47 molecule adhesion NM_023370 CDH23 cadherin-like 23 adhesion NM_207298 CERCAM cerebral endothelial cell adhesion molecule adhesion NM_021719 CLDN15 claudin 15 adhesion NM_009902 CLDN3 claudin 3 adhesion NM_008779 CNTN3 contactin 3 (plasmacytoma associated) adhesion NM_015734 COL5A1 collagen, type V, alpha 1 adhesion NM_007803 CTTN cortactin adhesion NM_009142 CX3CL1 chemokine (C-X3-C motif) ligand 1 adhesion NM_031174 DSCAM Down syndrome cell adhesion molecule adhesion NM_145158 EMILIN2 elastin microfibril interfacer 2 adhesion NM_001081286 FAT1 FAT tumor suppressor homolog 1 (Drosophila) adhesion NM_001080814 FAT3 FAT tumor suppressor homolog 3 (Drosophila) adhesion NM_153795 FERMT3 fermitin family homolog 3 (Drosophila) adhesion NM_010494 ICAM2 intercellular adhesion molecule 2 adhesion NM_023892 ICAM4 (includes EG:3386) intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)adhesion NM_001001979 MEGF10 multiple EGF-like-domains 10 adhesion NM_172522 MEGF11 multiple EGF-like-domains 11 adhesion NM_010739 MUC13 mucin 13, cell surface associated adhesion NM_013610 NINJ1 ninjurin 1 adhesion NM_016718 NINJ2 ninjurin 2 adhesion NM_172932 NLGN3 neuroligin
    [Show full text]
  • AUSTRALIAN PATENT OFFICE (11) Application No. AU 199875933 B2
    (12) PATENT (11) Application No. AU 199875933 B2 (19) AUSTRALIAN PATENT OFFICE (10) Patent No. 742342 (54) Title Nucleic acid arrays (51)7 International Patent Classification(s) C12Q001/68 C07H 021/04 C07H 021/02 C12P 019/34 (21) Application No: 199875933 (22) Application Date: 1998.05.21 (87) WIPO No: WO98/53103 (30) Priority Data (31) Number (32) Date (33) Country 08/859998 1997.05.21 US 09/053375 1998.03.31 US (43) Publication Date : 1998.12.11 (43) Publication Journal Date : 1999.02.04 (44) Accepted Journal Date : 2001.12.20 (71) Applicant(s) Clontech Laboratories, Inc. (72) Inventor(s) Alex Chenchik; George Jokhadze; Robert Bibilashvilli (74) Agent/Attorney F.B. RICE and CO.,139 Rathdowne Street,CARLTON VIC 3053 (56) Related Art PROC NATL ACAD SCI USA 93,10614-9 ANCEL BIOCHEM 216,299-304 CRENE 156,207-13 OPI DAtE 11/12/98 APPLN. ID 75933/98 AOJP DATE 04/02/99 PCT NUMBER PCT/US98/10561 IIIIIIIUIIIIIIIIIIIIIIIIIIIII AU9875933 .PCT) (51) International Patent Classification 6 ; (11) International Publication Number: WO 98/53103 C12Q 1/68, C12P 19/34, C07H 2UO2, Al 21/04 (43) International Publication Date: 26 November 1998 (26.11.98) (21) International Application Number: PCT/US98/10561 (81) Designated States: AL, AM, AT, AU, AZ, BA, BB, BG, BR, BY, CA, CH, CN, CU, CZ, DE, DK, EE, ES, FI, GB, GE, (22) International Filing Date: 21 May 1998 (21.05.98) GH, GM, GW, HU, ID, IL, IS, JP, KE, KG, KP, KR, KZ, LC, LK, LR, LS, LT, LU, LV, MD, MG, MK, MN, MW, MX, NO, NZ, PL, PT, RO, RU, SD, SE, SG, SI, SK, SL, (30) Priority Data: TJ, TM, TR, TT, UA, UG, US, UZ, VN, YU, ZW, ARIPO 08/859,998 21 May 1997 (21.05.97) US patent (GH, GM, KE, LS, MW, SD, SZ, UG, ZW), Eurasian 09/053,375 31 March 1998 (31.03.98) US patent (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM), European patent (AT, BE, CH, CY, DE, DK, ES, Fl, FR, GB, GR, IE, IT, LU, MC, NL, PT, SE), OAPI patent (BF, BJ, CF, (71) Applicant (for all designated States except US): CLONTECH CG, CI, CM, GA, GN, ML, MR, NE, SN, TD, TG).
    [Show full text]
  • Product Datasheet Integrin Alpha 2B/CD41
    Product Datasheet Integrin alpha 2b/CD41 Antibody NBP1-84581 Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NBP1-84581 Updated 7/27/2021 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NBP1-84581 Page 1 of 4 v.20.1 Updated 7/27/2021 NBP1-84581 Integrin alpha 2b/CD41 Antibody Product Information Unit Size 0.1 ml Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Clonality Polyclonal Preservative 0.02% Sodium Azide Isotype IgG Purity Immunogen affinity purified Buffer PBS (pH 7.2) and 40% Glycerol Product Description Host Rabbit Gene ID 3674 Gene Symbol ITGA2B Species Human Reactivity Notes Immunogen displays the following percentage of sequence identity for non- tested species: Mouse (85%), Rat (82%) Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPI CHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV Product Application Details Applications Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry- Paraffin Recommended Dilutions Western Blot 0.04-0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 Application Notes For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
    [Show full text]
  • Development and Validation of Tumor-Educated Blood Platelets Integrin Alpha 2B
    Int. J. Biol. Sci. 2019, Vol. 15 1977 Ivyspring International Publisher International Journal of Biological Sciences 2019; 15(9): 1977-1992. doi: 10.7150/ijbs.36284 Research Paper Development and Validation of Tumor-educated Blood Platelets Integrin Alpha 2b (ITGA2B) RNA for Diagnosis and Prognosis of Non-small-cell Lung Cancer through RNA-seq Shan Xing1#, Tao Zeng2#, Ning Xue3#, Yi He1, Yan-zhen Lai1, Hui-lan Li1, Qi Huang1, Shu-lin Chen1, 1 Wan-li Liu 1. Department of Clinical Laboratory, State Key Laboratory of Oncology in South China, Collaborative Innovation Center for Cancer Medicine, Sun Yat-sen University Cancer Center, Guangzhou 510060, P. R. China 2. Department of Clinical Laboratory, The Sixth Affiliated Hospital, Sun Yat-sen University, Guangzhou 510060, P. R. China 3. Department of Clinical Laboratory, Affiliated Tumor Hospital of Zhengzhou University, Henan Tumor Hospital, Zhengzhou 450100, P. R. China # Equal contributors Corresponding authors: Shu-lin Chen: [email protected]; Wan-li Liu: Department of Clinical Laboratory, Sun Yat-Sen University Cancer Center, 651 Dongfeng Road East, Guangzhou 510060, Guangdong Province, China. Email: [email protected]; Telephone: +86-020-87343196; Fax: +86-020-87343196 © The author(s). This is an open access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/). See http://ivyspring.com/terms for full terms and conditions. Received: 2019.05.03; Accepted: 2019.06.17; Published: 2019.07.24 Abstract Background: Currently, there are no molecular biomarkers for the early detection of non-small-cell lung cancer (NSCLC). This study focused on identifying RNAs found on tumor-educated blood platelets (TEPs) for detecting stage I NSCLC.
    [Show full text]
  • Genetic Testing Medical Policy – Genetics
    Genetic Testing Medical Policy – Genetics Please complete all appropriate questions fully. Suggested medical record documentation: • Current History & Physical • Progress Notes • Family Genetic History • Genetic Counseling Evaluation *Failure to include suggested medical record documentation may result in delay or possible denial of request. PATIENT INFORMATION Name: Member ID: Group ID: PROCEDURE INFORMATION Genetic Counseling performed: c Yes c No **Please check the requested analyte(s), identify number of units requested, and provide indication/rationale for testing. 81400 Molecular Pathology Level 1 Units _____ c ACADM (acyl-CoA dehydrogenase, C-4 to C-12 straight chain, MCAD) (e.g., medium chain acyl dehydrogenase deficiency), K304E variant _____ c ACE (angiotensin converting enzyme) (e.g., hereditary blood pressure regulation), insertion/deletion variant _____ c AGTR1 (angiotensin II receptor, type 1) (e.g., essential hypertension), 1166A>C variant _____ c BCKDHA (branched chain keto acid dehydrogenase E1, alpha polypeptide) (e.g., maple syrup urine disease, type 1A), Y438N variant _____ c CCR5 (chemokine C-C motif receptor 5) (e.g., HIV resistance), 32-bp deletion mutation/794 825del32 deletion _____ c CLRN1 (clarin 1) (e.g., Usher syndrome, type 3), N48K variant _____ c DPYD (dihydropyrimidine dehydrogenase) (e.g., 5-fluorouracil/5-FU and capecitabine drug metabolism), IVS14+1G>A variant _____ c F13B (coagulation factor XIII, B polypeptide) (e.g., hereditary hypercoagulability), V34L variant _____ c F2 (coagulation factor 2) (e.g.,
    [Show full text]
  • Supplementarytable S1.Xlsx
    Supplementary Table S1: List of proteins in the HCV Core and NS4B extended PPI networks Proteins in the Core extended network Gene ID Symbol Gene Name CORE CORE HCV Core protein 10014 HDAC5 histone deacetylase 5 10060 ABCC9 ATP-bindingg, cassette, sub-family y(), C (CFTR/MRP), member 9 10289 EIF1B eukaryotic translation initiation factor 1B 10301 DLEU1 deleted in lymphocytic leukemia 1 (non-protein coding) 10381 TUBB3 tubulin, beta 3 10382 TUBB4 tubulin, beta 4 10397 NDRG1 N-myc downstream regulated 1 10425 ARIH2 ariadne homolog 2 (Drosophila) 1053053 CEBPEC CCAAT/enhancerCC /e a ce bindin b dg p rotein ote ( (C/C/EBP) ),, e epspsilon o 10563 CXCL13 chemokine (C-X-C motif) ligand 13 10574 CCT7 chaperonin containing TCP1, subunit 7 (eta) 10912 GADD45G growth arrest and DNA-damage-inducible, gamma 11178 LZTS1 leucine zipper, putative tumor suppressor 1 11345 GABARAPL2 GABA(A) receptor-associated protein-like 2 116154 PHACTR3 phosphatase and actin regulator 3 1200 TPP1 tritripeptidylpeptidyl ppeptidaseeptidase I 126272 EID2B EP300 interacting inhibitor of differentiation 2B 1356 CP ceruloplasmin (ferroxidase) 1478 CSTF2 cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa 1511 CTSG cathepsin G 1583 CYP11A1 cytochrome P450, family 11, subfamily A, polypeptide 1 158345 RPL4P5 ribosomal protein L4 pseudogene 5 1588 CYP19A1 ccytochromeytochrome P450P450,, familfamilyy 1919,, subfamilsubfamilyy AA,, ppolypeptideolypeptide 1 1647 GADD45A growth arrest and DNA-damage-inducible, alpha 1736 DKC1 dyskeratosis congenita 1, dyskerin 1762 DMWD dystrophia
    [Show full text]
  • Pathology and Laboratory Cpt Code Changes for 2018
    PATHOLOGY AND LABORATORY CPT CODE CHANGES FOR 2018 Code Long Descriptor New HCPCS-CPT Codes 2018 81105 Human Platelet Antigen 1 genotyping (HPA-1), ITGB3 (integrin, beta 3 [platelet glycoprotein IIIa], antigen CD61 [GPIIIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), gene analysis, common variant, HPA-1a/b (L33P) 81106 Human Platelet Antigen 2 genotyping (HPA-2), GP1BA (glycoprotein Ib [platelet], alpha polypeptide [GPIba]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), gene analysis, common variant, HPA-2a/b (T145M) 81107 Human Platelet Antigen 3 genotyping (HPA-3), ITGA2B (integrin, alpha 2b [platelet glycoprotein IIb of IIb/IIIa complex], antigen CD41 [GPIIb]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), gene analysis, common variant, HPA-3a/b (I843S) 81108 Human Platelet Antigen 4 genotyping (HPA-4), ITGB3 (integrin, beta 3 [platelet glycoprotein IIIa], antigen CD61 [GPIIIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), gene analysis, common variant, HPA-4a/b (R143Q) 81109 Human Platelet Antigen 5 genotyping (HPA-5), ITGA2 (integrin, alpha 2 [CD49B, alpha 2 subunit of VLA-2 receptor] [GPIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion purpura), gene analysis, common variant (eg, HPA-5a/b (K505E)) 81110 Human Platelet Antigen 6 genotyping (HPA-6w), ITGB3 (integrin, beta 3 [platelet glycoprotein IIIa, antigen CD61] [GPIIIa]) (eg, neonatal alloimmune thrombocytopenia [NAIT], post-transfusion
    [Show full text]
  • GG Polymorphism of Platelet ITGA2B Gene Increases the Magnitude of Interleukin-6 Release After Cardiopulmonary Bypass
    Clinical Group Imaging Journal of Clinical and Medical Sciences ISSN: 2455-8702 DOI CC By Koray Ak1,2*, Samet Ergun2,3, Hilal Altınoz2,4, Z Oya Uyguner5 and Research Article 2,6 Sermin Tetik GG Polymorphism of Platelet ITGA2B 1Marmara University School of Medicine Department of Cardiovascular Surgery, Turkey 2Health Sciences Institute Department of Gene Increases the Magnitude Biochemistry, Turkey 3Taksim Education and Research Hospital Pathology of Interleukin-6 Release after Division, Turkey 4Istanbul Süreyyapasa Thoracic Disease and Cardiopulmonary Bypass Thoracic Surgery Education and Research Hospital, Turkey 5Department of Medical Genetics, Istanbul Medical Faculty, Istanbul University, Turkey 6Cyprus International University, Lefkosa, Cyprus Abstract Dates: Received: 02 November, 2016; Accepted: 28 Objective: Cardiopulmonary bypass (CPB) induces a systemic infl ammatory response which is December, 2016; Published: 30 December, 2016 thought to be a signifi cant cause of postoperative organ dysfunction and mortality. In this study we aimed to investigate the effect of ITGA2B (integrin alpha 2b, platelet glycoprotein IIb of IIb/IIIa complex) gene *Corresponding author: Koray Ak, M.D., Ph.D., Associ- polymorphism on the magnitude of infl ammatory response after CPB ate Professor of Cardiovascular Surgery, Marmara University Pendik Training and Research Hospital Methods: Twenty patients undergoing coronary artery bypass grafting were included. Blood samples Fevzi Cakmak Mah. Mimar Sinan Cad. No: 41 Ust- were taken at the three different times for analyses of Interleukin-6, Interleukin-10 and Nuclear Factor kaynarca Pendik Istanbul Turkey, Tel: 00 90 216 625 Kappa B by ELISA (t : before operation, t :10 minutes after removal of aortic cross clamping and t : 24 45 45/2408, E-mail: 1 2 3 hours after operation.
    [Show full text]
  • CD41/Integrin Alpha 2B Polyclonal Antibody Catalog Number:24552-1-AP 11 Publications
    For Research Use Only CD41/Integrin Alpha 2B Polyclonal antibody www.ptglab.com Catalog Number:24552-1-AP 11 Publications Basic Information Catalog Number: GenBank Accession Number: Purification Method: 24552-1-AP BC126442 Antigen affinity purification Size: GeneID (NCBI): Recommended Dilutions: 150ul , Concentration: 600 μg/ml by 3674 WB 1:1000-1:6000 Nanodrop and 453 μg/ml by Bradford Full Name: IP 0.5-4.0 ug for IP and 1:1000-1:4000 method using BSA as the standard; integrin, alpha 2b (platelet for WB Source: glycoprotein IIb of IIb/IIIa complex, IHC 1:20-1:200 Rabbit antigen CD41) Isotype: Calculated MW: IgG 1039 aa, 113 kDa Immunogen Catalog Number: Observed MW: AG19459 125 kDa Applications Tested Applications: Positive Controls: IHC, IP, WB,ELISA WB : human blood, rat blood, mouse spleen tissue Cited Applications: IP : human plasma tissue, IF, IHC, WB Species Specificity: IHC : human spleen tissue, mouse spleen tissue human, rat, mouse Cited Species: human, mouse, pig Note-IHC: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface Background Information ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207).
    [Show full text]
  • Anti-CD41 Antibody (ARG41100)
    Product datasheet [email protected] ARG41100 Package: 50 μg anti-CD41 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes CD41 Tested Reactivity Hu, Ms, Rat Tested Application IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name CD41 Antigen Species Human Immunogen Synthetic peptide corresponding to aa. 677-711 of Human CD41. (EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN) Conjugation Un-conjugated Alternate Names GTA; GT; GPalpha IIb; PPP1R93; CD41; BDPLT2; BDPLT16; GP2B; Integrin alpha-IIb; GPIIb; Platelet membrane glycoprotein IIb; HPA3; CD antigen CD41; CD41B Application Instructions Application table Application Dilution IHC-P 1:200 - 1:1000 WB 1:500 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 113 kDa Observed Size 113 kDa Properties Form Liquid Purification Affinity purification with immunogen. Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. Preservative 0.05% Sodium azide Stabilizer 5% BSA Concentration 0.5 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed www.arigobio.com 1/3 before use. Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol ITGA2B Gene Full Name integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) Background ITGA2B encodes integrin alpha chain 2b.
    [Show full text]