GENEVIEVE FELIX REYNOLDS LOGIC 26 SEP. TO 14 OCT. 2018
NICHOLAS THOMPSON GALLERY Art Almanac September 2018 $6
Genevieve Felix Reynolds Ken Unsworth Amber Boardman
Art Almanac September 2018
We acknowledge and pay our respect to the many Subscribe Aboriginal nations across this land, traditional custodians, Elders past and present; in particular the Established in 1974, we are Australia’s longest running monthly art guide and the single print Guringai people of the Eora Nation where Art Almanac destination for artists, galleries and audiences. has been produced.
Art Almanac publishes 11 issues each year. We present ourselves to the world to assert Visit our website to sign-up for our free weekly eNewsletter. and understand our identity; artists take this feeling and give it form. In very different ways To subscribe go to artalmanac.com.au the paintings of Genevieve Felix Reynolds and or mymagazines.com.au Amber Boardman consider how something meaningful might come from the Internet. Kieran Butler’s photography and drag articulates their non-binary self, whereas Tony Albert’s work challenges the aesthetics of recollection and representation of Indigenous Deadline for October 2018 issue: peoples. Drawing on life, Julia deVille’s Friday 31 August, 2018. taxidermy and holograms augment overlooked creatures whilst Ken Unsworth stages tension from the inside out.
Contact
Editor – Chloe Mandryk [email protected] Deputy Editor – Kirsty Mulholland [email protected] Art Director – Paul Saint National Advertising – Laraine Deer [email protected] Cover Digital Editor – Melissa Pesa Genevieve Felix Reynolds, Everything will melt [email protected] like water, 2018, gouache and acrylic on panel, Editorial Assistant – Penny McCulloch 75 x 60cm [email protected] Courtesy the artist and Nicholas Thompson Editorial Intern – Saira Krishan Gallery, Melbourne Accounts – Penny McCulloch [email protected] T 02 9901 6398 F 02 9901 6116 Locked Bag 5555, St Leonards NSW 1590 art-almanac.com.au
5 Art in Australia News and Books – Art Almanac team 23
Amber Boardman, @jadefad: a social media feed in paint – Eleanor Zeichner 32 Tony Albert, Visible – Tristen Harwood 35 Julia deVille, Wholeness and the Implicit Order – Melissa Pesa 40 Kieran Butler, Queen Size – Chloe Mandryk 42 Genevieve Felix Reynolds, Logic – Elli Walsh 46 Ken Unsworth, Truly, Madly – Julian Day 48
Select exhibition previews – Art Almanac team 54
Art & Industry Artist Opportunities and Awards 63 Submissions and Proposals 66 Internships and Fellowships 66 Materials 68 Services 69 Consultants and Valuers 72 Member Organisations 72 Training 73 Publications 74
What’s On Gallery Index 77 Melbourne 82 Victoria 114 Sydney 122 New South Wales 148 Australian Capital Territory 156 Tasmania 160 South Australia 164 Western Australia 168 Northern Territory 173 Queensland 176 Artist Index 182
6
Koorie Heritage Trust Inc ‘Gnokan Danna Murra Kor-ki’
8 SEPTEMBER - 4 NOVEMBER 2018 THE 1818 PROJECT ABDUL-RAHMAN ABDULLAH BRINGS TOGETHER SHAN TURNER-CARROLL EIGHT CONTEMPORARY DALE COLLIER LOCAL AND NATIONAL KARLA DICKENS ARTISTS TO ADDRESS FERNANDO DO CAMPO PERSONAL CULTURAL LINDY LEE HISTORIES AND STORIES OF YHONNIE SCARCE AUSTRALIAN MIGRATION JACQUI STOCKDALE
NEWCASTLE ART GALLERY Newcastle Art Gallery is supported by: 1 Laman Street Newcastle Open Tuesday to Sunday 10am - 5pm & every day during school holidays nag.org.au | | Subscribe to enews: nag.org.au/enews
Image: The 1818 PROJECT featuring Joseph LYCETT Inner View of Newcastle c1818 oil on canvas 61.0 x 91.4cm Purchased 1961 with assistance from the National Art Collections Fund, London, UK Newcastle Art Gallery collection DEBORAH WALKER
99a Carlisle Street St. Kilda RICHARD STRINGER
19 September – 17 October 2018
Paradiso III oil on linen 184 x 184cm
DIANA WATSON PARADISO 5 – 23 SEPTEMBER
FRANCES KEEVIL GALLERY Bay Village 28 - 34 Cross Street Double Bay NSW 02 9327 2475 franceskeevilgallery.com.au
Kurt Brereton Report from the Littoral Zone
Mangroves at low tide, oil and embroidery on canvas, 122 x 168cm, 2018
paintings • sculpture • video • installation
Sept.8-Nov.25 Open Daily: 10am - 4pm Woollamia Rd, Huskisson (02) 4441 5675 www.kurtbrereton.com
Art in Australia
22 Siteworks | MICRO Camp overnight or wander the grounds of Bundanon Homestead for the tenth iteration of ‘Siteworks’ on 29 September. This special one-day event invites artists, scientists and the public to explore the environment with works, performances and talks that consider the miniature and microscopic. ‘Stories and Structures’ is an exhibition that draws parallels between the representations seen in many Indigenous works of art and the microscopic structures hidden in the natural world. Artist, Deborah Kelly’s deity-creatures will haunt the natural amphitheatre whereas Emily Hunt has created a microcosmic fantasy inspired by German Renaissance printmaking. Like the 16th century artists, Hunt uses grotesque and satirical images to critique contemporary notions of morality. Along the Shoalhaven River Anna Madeleine will transform inanimate rocks into an augmented reality artwork. All things ‘micro’ will be covered from another angle by a group of speakers including Zenobia Jacobs who will discuss dating geological and archaeological sites with a grain of sand. Andrew Holmes will open up about his freezer collection of poo and study of human gut microbiota, and Simon Mattsson, a farmer from north Queensland, shares how the awareness of soil microbiology and plant diversity can maintain soil health. A number of dance and performance works will criss-cross the landscape from Patrick Nolan with Dance North, to noir a site-responsive piece from ‘one step at a time like this’ (Suzanne Kersten, Clair Korobacz, Julian Rickert), who put you at the centre of an evolving experience through the night comprised of evocative audio-scapes crafted to place the audience in a dream- like, hyper-responsive state. bundanon.com.au
French & Mottershead (Rebecca French and Andrew Mottershead), Woodland, Bristol Photograph: Paul Blakemore Courtesy the artists and Bundanon Trust, New South Wales
23 Desert Mob The annual ‘Desert Mob’ gathering of Desart-member art centres and their artists from remote communities in the Northern Territory, South Australia and Western Australia celebrates new innovations in contemporary Aboriginal arts practice, traditional and experimental works. Featuring the ‘Desert Mob’ exhibition at Araluen Arts Centre opening on 6 September at 5.30pm, a one-day ‘Symposium’ hosting talks and presentations with artists and special guests discussing FXUUHQWSURMHFWVDQGWHOOLQJVWRULHVDVZHOODVSHUIRUPDQFHDQGíOPRQ)ULGD\6HSWHPEHU from 10am to 3.30pm. And on Saturday 8 September between 10am and 2pm visitors to the Top End can buy direct from the makers at ‘MarketPlace’ with over 30 art centres, artists and arts workers presenting a vibrant display of Aboriginal art and culture.
araluenartscentre. nt.gov.au
Desert Mob 2017 exhibition opening Photograph: Lisa Hatz Courtesy Araluen Arts Centre, Northern Territory John Fries Award A platform for some of the most engaging and experimental works from the next wave of contemporary antipodean artists, the annual $10,000 non-acquisitive John Fries Award received more than 550 submissions this year with 12 íQDOLVWVFKRVHQ&XUDWHGE\&RQVXHOR&DYDQLJOLD the exhibition held at Sydney’s UNSW Galleries from 29 September to 3 November, showcases new work in a cross-section of art practices engaging with sound, scent, sculpture, performance, painting and video. Themes include the impact of social and online media, the reconciliation of political realities on identity and the place of Indigenous voice in today’s world. The panel of guest judges – Consuelo Cavaniglia, Sophia Kouyoumdijian, Mikala Tai, Shannon Te Ao, and Kath Fries will announce the 2018 winner at the opening.
johnfriesaward.com
Jelena Telecki, Somewheres Nowheres, 2018, installation detail, oil on linen, 2 paintings: both 42 x 30cm, sculpture: various materials, various dimensions © the artist Courtesy the artist and Copyright Agency Limited, Sydney
24 Sydney Contemporary With over 80 Australian and international galleries participating, Sydney Contemporary presents a manifold of creative talent, current trends and emerging practices – as well as the cross-cultural dialogue they inspire. At Carriageworks from 13 to 16 September, this year’s events include engaging panel discussions, guided tours, educational workshops and an extensive VIP Program, LQFOXGLQJDQH[FOXVLYHSUHYLHZRQ6HSWHPEHU7KHRIíFLDORSHQLQJRQ6HSWHPEHULVWKH RXWVHWWRIRXUGD\VíOOHGZLWKSDLQWLQJVFXOSWXUHVRXQGDQGFHUDPLFVWKURXJKWRLQVWDOODWLRQ video and performances. Highlights include Jean Dubuffet’s four-metre-high sculpture L’Incivil (1973/2014) and Patricia Piccinini’s The Field DYDVWODQGVFDSHRIJHQHWLFDOO\PRGLíHG îRZHUVUHLPDJLQHGIRUWKHIDLU$UW$OPDQDFZLOOSDUWLFLSDWHLQDSULQWPHGLDVWDOOSOHDVHFRPH and say hello. sydneycontemporary.com.au
Michaela Davies, Duty, 2014, performance documentation, curated by Performance Space, MCA, 2014 © the artists Photograph: Heidrun Löhr Courtesy the artists and Sydney Contemporary, Sydney 25 Bush Women Fremantle Arts Centre
In 1994 the Fremantle Arts Centre staged a special exhibition of artworks by women from the fresh-water country of north-west Western Australia and the Ngaanyatjarra lands of the south-east. With distinct, original styles and personal narratives about living and growing up in the bush, artists such as Paji Honeychild Yankkarr, Daisy Andrews, Queenie McKenzie (Gara-Gara), Tjapartji Kanytjuri Bates, Tjingapa Davies and Pantjiti Mary McLean took their place in the spotlight of the art world. In 2018 the gallery reassembled the original paintings and produced this title, ‘Bush Women’. It is modest in size and has the VHQWLPHQWRIDm\HDUERRNnVKDULQJíUVWSHUVRQ accounts from the artists, curatorial insights via John Kean as well as reproductions of the works and photographs from the 1990s.
Robert Smithson: Time Crystals MUMA in association with Monash University Publishing
‘Then I looked closer.’ – Robert Smithson
m7LPH&U\VWDOVnLVWKHíUVWH[KLELWLRQLQ Australia to showcase the works of American artist Robert Smithson (1938-1973), known for his radical land art of the 1960s and early 1970s. Its literary companion, a catalogue comprised of sketches, preparatory drawings, correspondence, photographs and hand- written manuscripts including misspellings, grammatical errors and redacted text, provides personal insight, deepened understanding and a new interpretation of Smithson’s practice. The development of his ideas on non- biological time and entropy, crystallography, VFLHQFHíFWLRQJHRJUDSK\DQGJHRORJ\rDV ZHOODVUHGHíQLQJPRGHOVRIDEVWUDFWLRQDQG challenging art history in his exploration of medium, location and expression – are explored in essays by Amelia Barikin, Chris McAuliffe and Stephen Melville.
26 Fugitive History: The Art of Julie Gough Julie Gough UWA Publishing
3UROLíFDUWLVW-XOLH*RXJKSUHVHQWVXVZLWKD GHíQLWLYHJXLGHWRKHUGRXEOHGHFDGHRHXYUH ZLWKKHUíUVWSXEOLFDWLRQm)XJLWLYH+LVWRU\ The Art of Julie Gough’. Including essays from the artist herself along with Tasmanian contemporaries James Boyce, Brigita Ozolins and Khadija von Zinnenburg Carroll, ‘Fugitive History’ offers its readers a more in-depth understanding of the complex exploration of collective and personal Indigenous identity that Gough undertakes in her work. Spread across 300 pages, the book features an extensive gallery of the artist’s works since 1995, beautifully demonstrating the breadth of media and variety of subjects in her practice, accompanied by an index of works, Gough’s CV and a bibliography.
Absolute Humidity Tess Maunder Lobregat Balaguer
Brisbane-based curator and writer Tess Maunder asks, ‘What is the role of the curator? In its simplest terms, it is someone that listens to an artist.’ This end-note foregrounds ‘Absolute Humidity’, a publication and research project with a focus on action and LGHDV$UWLVWVIURPWKH$VLD3DFLíFHQJDJH in conversation about trans-national relationships, ecological threats, exploitation, anxiety, sovereignty, politics, identity, disputed territories and the shifting weather, in the wake of Anthropocene rhetoric. Contributors include Raqs Media Collective, Brenda L. Croft, Isabel and Alfredo Aquilizan, Chantal Fraser, Bonita Ely and Angela Tiatia who says ‘I believe that artists can use their work to affect change, and the most urgent ecological concern today is climate change.’
27 — BALLARAT 21 SEPT – 6 NOV
150 ARTISTS | 65 SOLO EXHIBITIONS | LAKESIDE SCULPTURE WALK | PERFORMANCE ART PROJECTS OUTDOOR INSTALLATIONS | MUSIC EVENTS
The inaugural Biennale of Australian Art (BOAA) will tell Australian stories, stories
ARTISTS AT THE ART GALLERY OF BALLARAT: KIM ANDERSON | ASHER BILU | FARIDAH CAMERON | GERWYN DAVIES | PHILLIP GEORGE | MARLENE GILSON | DAVID JENSZ LOUISEANN KING | NUMINA SISTERS | PIP & POP | JASON SIMS boaa.net.au
ART GALLERY OF BALLARAT FUNDING PARTNERS
image: Gerwyn Davies, Prawn (Subtrop- ics) 2016 (detial) © Gerwyn Davies The Landscapes of Reg Mombassa Reg Mombassa Hardie Grant Books
Reg Mombassa (Chris O’Doherty) is a poet, musician and artist with a lifetime love of the land. Mombassa is well-known for his hyper- coloured graphics, quirky creatures and surf label MAMBO, and unbeknown to some is also a painter of vibrant landscapes depicting life down under.
Mombassa leads the reader on a journey into the familiar, down the streets of suburbia lined with telegraph poles, atop the sails of the iconic Sydney Opera House and out to WKHUROOLQJKLOOVDQGVSUDZOLQJîDWVRQUXUDO lands. With a display of over 200 works dating from 1968 to the present, accompanied by the artist’s texts, this book presents Mombassa’s sentiments for, and interpretations of, the vast landscapes of Australia and New Zealand.
A Tear in the Glass Mary Ryllis Clark Anchor Books Australia
‘Learning to read objects is like learning to read oneself.’ – Nina Stanton
Nina Stanton (1948-2009), curator and director of museums and cultural heritage sought to íQGRXWLIWKHUHZHUHXQGHUO\LQJHPRWLRQDO causes for her cancer diagnosis by exploring WKHFRQQHFWLRQVKHIHOWZLWKíQHDUWDQG decorative objects. With the aim of searching for understanding Stanton examines and documents 100 pieces from The Johnston Collection. Unable to complete this work, she entrusted writer and friend Mary Ryllis Clark to continue her journey.
A series of personal writings paired with images and descriptions of each of the 100 items displayed throughout this memoir are deep UHîHFWLRQVRQ6WDQWRQnVOLIHDQGWKHWKLQJVWKDW connected her to her world. 29 Coinciding with the 22nd annual exhibition of Sculpture by the Sea, Bondi and presented in partnership with the Central Academy of Fine Arts (CAFA), Beijing, Sculpture by the Sea presents ‘Sculpture: a universal language’, an annual Sculpture Conference at the Sydney Opera House on Monday 5 November, 2018.
Speakers include: Conference · Professor Lv Pinchang Artist & Head of Sculpture, CAFA (Beijing, China) information · Professor Sui Jianguo Artist, former Head of Sculpture, CAFA (Beijing, China) · Hossein Valamanesh Artist (Adelaide, Australia) Date Monday 5 November 2018 · John McDonald Author, Art Critic & former Head of Australian Art at the National Time 9.30am – 5.30pm Gallery of Australia (Sydney, Australia) Location Sydney Opera House · Professor Paul S.C.Taçon FAHA FSA Professor of Anthropology & Archaelogy, School Tickets $175 of Humanities, Languages & Social Science, Griffith University (Gold Coast, Australia) Concessions and · Emeritus Professor Gavin Younge Artist, Author & Professor in Fine Art, University Sculpture by the Sea of Cape Town (Cape Town, South Africa) Artists - $120 · Britt Mikkelsen Artist (Perth, Australia) Ticket price includes morning · Lubomir Mikle Artist (Bratislava, Slovakia) tea, lunch and afternoon tea, · Nicole Monks Artist (Sydney, Australia) networking drink and · Petra Pattinson Education Manager, Sculpture by the Sea (Sydney, Australia) Delegate tote bag. · Dr Michael Hill Head of Art History & Theory, National Art School (Sydney, Australia)
For the full conference program, speaker biographies and ticket purchases, visit www.sculpturebythesea.com
Presented by Supported by
Image: Sui Jianguo (China), ‘Dreamstone’, Sculpture by the Sea, Bondi 2012. Photo Howard Jones.
Amber Boardman @jadefad: a social media feed in paint
Eleanor Zeichner
On relocating from her home in Brooklyn, New York, to Sydney’s Northern Beaches, Amber Boardman rediscovered her love of paint. She was drawn to its messy materiality, at odds with LWVíQHDUWWUDGLWLRQ,WVHHPHGDQDSWPHGLXPWKURXJKZKLFKWRH[SORUHDQRWKHUIDVFLQDWLRQ the aspirational culture of social media. Rapid image making catalysed by quickly changing fads offered a window into a world curated and monetised for mass consumption. Instagram and ‘@jadefad: a social media feed in paint’ explores the transformative qualities of paint in an interwoven narrative that plays out both in the gallery and on Instagram. The series is buoyed with DQDEVXUGLVWVHQVHRIKXPRXUPLUURUHGE\%RDUGPDQnVFRQíGHQWDQGJHVWXUDOEUXVKZRUN,WWHOOV WKHVWRU\RIDíFWLRQDOVRFLDOPHGLDLQîXHQFHUFDOOHG-DGHZKRVHSHUIRUPDWLYHVHOIFDUHLQFOXGHV yoga, spray-tanning and the KonMari method. In @jadefad; Experiencing some middle aged gravity on the yoga mat today :/ #thatprincesshairtho -DGHnVGLVWRUWHGíJXUHOHJVDQGEUHDVWV DNLPERLVWRSSHGZLWKDPDQHRIîRZLQJEORQGHKDLU YLVLEOHURRWVQRWZLWKVWDQGLQJ @jadefad: Oh just casually relaxing on my busted vinyl lawn chair. #blondonlawnchair (2016) satirises the faux-casual posturing that belies the carefully art directed Instagram shot. When Jade has the revelation that she is a character made of paint (after a big night on the turpentine cocktails), it opens up the possibility of an even greater performance of self-transformation and the H[SDQVLRQRIKHULQîXHQFH There’s a Looney Tunes-esque cartoon logic pervading these works, with the character wrestling the creator for control over her image. As a child Boardman woke up early to cram in cartoons before school, eventually ending up as a commercial animator for Cartoon Network and Comedy Central, skills honed with an MFA from the School of Visual Arts in New York City. The work @jadefad: #renovatedpainting Sooooo @amberboardman tried to paint a portrait of me. Then I 32 decided to make some changes ; ) (2018) shows Jade’s ‘renovations’ to be some blonde highlights emphatically painted over ashy hair, cheekbones and lips boosted with makeup. :LWKKHUQHZIRXQGDXWRQRP\-DGHFUHDWHVWKHFKDUDFWHU%OREDîHVK\HJJVKDSHGFUHDWXUH whose introduction extends the scope of the narrative and enhances its surrealism. Blob is GHSLFWHGIURPFKLOGKRRGWKURXJKDGROHVFHQFHDGXOWKRRGDQGHYHQWXDOGHPLVHKLVíQDOIDWH depicted in #MDGHIDG 3DLQW5DJVLQD/DQGíOO 5,3P\GHDU%ORE\RXZLOOEHPLVVHG (2017). In true LQîXHQFHUIDVKLRQ-DGHPRQHWLVHV%OREnVQHZIDPHZLWKPHUFKDQGLVHDOLQHRIKDQGSDLQWHG sweaters with meme-worthy titles (the ‘Goals AF Sweater’ or the ‘Adulting Sweater’). %RDUGPDQKDVDQLPDWHGHDFKYHUVLRQRIWKHSDLQWLQJVSRVWHGWR-DGHnVíFWLRQDO,QVWDJUDP account, with tongue-in-cheek comments from Boardman’s own account (“My how you sparkle Jade”), and has even created @paintjobbod, a fake beauty salon ‘specialising in linseed oil and turpentine treatments’ which interacts with both. While Instagram has become an essential tool for self-promotion for many artists as well as a medium in itself, Boardman is also pragmatic about its reach. As she explains, ‘Many more people will see the Instagram version of this exhibition than the actual exhibition, which is wonderful in a way, and in another way, a three- metre painting is completely different in real life than viewed on a phone.’ The narrative direction of the exhibition was three years in the making, during which time Boardman says ‘I realised I had been creating the same characters over and over.’ The tonal consistency and narrative cohesion of the series is aided by Boardman’s materially driven process, EHJLQQLQJZLWKîHVKWRQHGVKDSHVDQGZRUNLQJWRZDUGVKHUIHHOLQJIRUDFKDUDFWHU%DFNJURXQGV are often highly worked patterns and swirls, lending the works a psychedelic air. As Boardman 33 explains, ‘When I have leftover paint remaining at the end of a session I use it to create the background of a new painting... I’m drawn to the idea that the leftover paint from one painting is the beginning of the next painting, creating a continuous connection between the works.’ Boardman’s skewering of the ubiquity of self care culture is writ large in her work Self Care Exhaustion (2018) currently exhibited in this year’s Archibald Prize. Her work will be seen next at Sydney Contemporary with Chalk Horse, and also in group exhibitions in Brisbane and Rome in November. Eleanor Zeichner is a writer from Sydney and current Assistant Curator at UTS Gallery. Kudos Gallery 11 to 29 September, 2018 Sydney #MDGHIDG 3DLQW5DJVLQD/DQGíOO 5,3P\GHDU%ORE\RXZLOOEHPLVVHG, 2017, oil on canvas, 153 x 122cm @jadefad: Oh just casually relaxing on my busted vinyl lawn chair. #blondonlawnchair, 2016, oil on canvas, 91 x 122cm @jadefad: Experiencing some middle aged gravity out on the yoga mat today : / #thatprincesshairtho, 2017, oil on canvas, 41 x 51cm Courtesy the artist and Kudos Gallery, Sydney 34 Tony Albert Visible Tristen Harwood Tony Albert, a Girramay, Yidinji and Kuku Yalanji descendent, is the youngest artist to have a major solo exhibition at the Queensland Art Gallery. ‘Visible’ includes a range of work that illustrates the breadth and rigour of his practice, from object-based assemblages to photography, painting, installation and video. Across Albert’s work there is an assertive engagement with the aesthetics of recollection, representation, and imaginative future rendering. The depth of his practice extends beyond WKHFRQíQHVRILQGLYLGXDOH[SHULHQFH FDUHHURUSHUVRQDO ,WLVQnWPHUHO\DERXWFRUUHFWLQJ misrepresentations or returning the gaze; it comprehends the falsity of the entire representational structure operationalised in service of settler-colonialism and poses questions to the settler-grammar that restricts how Aboriginal art is read and written about. )RUPDQ\KLVPRVWUHDGLO\LGHQWLíDEOHZRUNVDUHWKRVHWKDWHQFRPSDVVFRPSRVLWLRQVRI Aboriginal kitsch objects like ashtrays, decorative boomerangs, tea towels, cutlery and other banal objects decorated with caricatures – often racist invocations of ‘noble savages’, ‘pickaninnies’ and so on. 35 Many of the kitsch objects used by Albert are from the 1940s-1970s, the decades of peak production for this form of Aboriginal kitsch. Albert has been collecting these objects since childhood, developing the term Aboriginalia to describe them, which bears similarity to ‘Australiania’. This use of parody is a current through much of Albert’s work. Here the naming of objects indicates the purpose of their existence – they are not misrepresentations of Aboriginal peoples, rather they are erasures – these objects are phantasms of the settler subject. The Other represented in Aboriginal kitsch objects is merely the settler parading as an Other in order to control the grammar of representation and cast Aborginal peoples as absence – outside of representation. Invisibility and visibility are central to ‘Visible’. Albert’s use of kitsch objects in works such as Pay Attention (2009-2010) and another large text-based wall work titled Sorry (2018), announce that hyper-visibility in the form of Aboriginal kitsch is more about making Indigenous peoples invisible. Originally conceived in 2008, the year of the national apology to the Stolen Generations, Sorry is composed of stereotypical representations of Aboriginal faces and bodies adorning crockery, trays and JDULVKFDUYLQJVrí[HGRQEODFNEORFNOHWWHUVWKDWUHDGm<5526n Pay Attention reveals Albert’s multimodal aesthetic approach. 7KHODUJHEORFNOHWWHULQJLVFRPSRVHGRIDQ$ERULJLQDOîDJ painted ‘A’, while other letters are variously composed of collected Aboriginalia, comic-like paintings of Cook, collage and text. The text references Bruce Nauman’s Pay attention motherfuckers (1973), demonstrating that the scope of Albert’s work involves an engagement with art history. While showing that his own work is always about more than just ‘politics’, via the reference to Nauman, Albert enunciates the farcical idea that art produced by the supposedly neutral white male artist is a-political. Also included in ‘Visible’ is Albert’s ballad-like collaborative photographic series made with Aboriginal children artists from Warakurna, titled Warakurna Superheroes 7KHíOPLF photographs allude to Tracey Moffat’s seminal Up in the Sky (1997). The photographs are all set against a background of an expansive azure sky, sparsely etched with cloud wisps, rusted-out car bodies and the greens, browns and reds of the grass, trees and earth. Boldly occupying the fore- and mid-grounds of the photographs are children dressed in different action hero and Star Wars costumes and in the deliberate poses of subjects who are in command of the space they inhabit. Part of the series is Warakurna – The Force is with us #5 (2017), made in collaboration with Kieran 6P\WKH-DFNVRQ,QWKLVLPDJHDQH[SUHVVLYHORZFDPHUDDQJOHíJXUHV6P\WKH-DFNVRQDVD stormtrooper in mid-action, his face obscured by a store bought Star Wars stormtrooper mask, ZKLOHKLVERG\LVDGRUQHGLQDZKLPVLFDOZKLWHRXWíWIDVKLRQHGIURPZKDWORRNVOLNHDîRXURU ULFHEDJDQGFLQFKHGDWWKHZDLVWZLWKDEODFNUXEEHUEHOW+LVRXWíWGUDZVDWWHQWLRQWRSUDFWLFHV of body adornment as sources of meaning that draw on and transcend individuals’ immediate environments. With ‘Visible’, Albert offers a body of work that is attentive to aesthetics, politics, history and possibility. Never merely corrective representations or assertions of visibility, the decentering 36 of the settler grammars in his work is a provisional disruption of the binary categories that constitute different subjects and viewing positions. The work offers itself to multiple readings DQGWRDYLHZHUZKRPXVWFRPSUHKHQGWKHZRUNVHOIUHîH[LYHO\:KHQSROLWLFDOKLVZRUNSRVHV VSHFLíFDQGEURDGTXHVWLRQVDGGUHVVLQJSUHFLVHPRPHQWVLQKLVWRU\DQGWKHFLUFXLWVWKURXJK which these politics are reproduced, in discourse, in language, in art. Tristen Harwood is a freelance writer and cultural producer. Queensland Art Gallery | Gallery of Modern Art (QAGOMA) Until 7 October, 2018 Queensland Tony Albert, David C Collins and Brittany Malbunka Reid, Warakurna – Superheroes #6, 2017, archival pigment print on paper, 100 x 150cm Commissioned by Fremantle Arts Centre for ‘In Cahoots: artists collaborate across Country’, 2017 Collection: The artist Courtesy the artist, Sullivan+Strumpf, Sydney, and Queensland Art Gallery | Gallery of Modern Art (QAGOMA), Brisbane Headhunter, 2007, synthetic polymer paint and vintage Aboriginal ephemera, 110 x 370cm Purchased with funds provided by the Aboriginal Collection Benefactors’ Group 2007. Collection: Art Gallery of New South Wales, Sydney Courtesy the artist and Queensland Art Gallery | Gallery of Modern Art (QAGOMA), Brisbane 37 “…WITH WORKS BY MORE THAN 500 ARTISTS IT WAS ALSO THE MOST DYNAMIC AND VARIED EXHIBITION TO BE SEEN IN AUSTRALIA THIS YEAR” — JOHN MCDONALD, SYDNEY MORNING HERALD SYDNEYCONTEMPORARY.COM.AU Julia deVille Wholeness and the Implicit Order Melissa Pesa The art of taxidermy is inextricably linked with sentiment and longing. It supersedes death and destruction and exposes the desires and fantasies surrounding human relationships with and within the natural world. By interfering with the inevitable path towards dissolution it preserves and immortalises the beauty of life and death. This notion is central to the work of Melbourne-based artist Julia deVille whose practice is informed by the Renaissance, Baroque and Victorian art and ideas of ‘memento mori’. deVille provides a contemporary take on the taxidermy art form as her jewel-encrusted, ethically sourced, stuffed animals debunk the JORULíFDWLRQRIWKHWURSK\KXQWLQJFXOWXUHDQGLWVZDOOPRXQWLQJ rituals and dismiss the archived strange and curious specimens stored in repositories or cabinets of curiosities. Her sculptural assemblages create interplay between process and materials challenging our disregard for, and consumption of, both wild and domesticated fauna. These creatures – rats, baby alpacas, stillborn deer, lion cubs, calves and bunny rabbits, to name a few – are SHUVRQLíHGWKURXJKWKHDGRUQPHQWRIGLDPRQGVSHDUOVUXELHV feathers and various costume. They are given new life in staged scenarios: a piglet weighed on antique scales, birds and mice nestled in antique jewellery boxes or spoons, puppies curled up in antique silver goblets, or kittens named Caesar riding antique silver and ivory chariots; some mockingly served on ceramic and silver platters. In ‘Wholeness and the Implicit Order’, deVille creates an immersive sensory environment using sound, smell, tactility and optical illusion to explore consciousness and reality. The exhibition showcases her beaded dead animals – a zebra and infant giraffe adorned with headpieces, accessories and studded hooves, the latter with a bedazzled bottom or #pearlbum as deVille playfully tagged it on Instagram – alongside holographic replicas within virtual surroundings, contrasting the artist’s signature handcrafted aesthetic with three-dimensional technologies. deVille’s themes of consciousness, death and our relationship with the natural world are underlined with the theories of quantum physicist David Bohm whose publication, ‘Wholeness and the Implicate Order’ (1980), attempts to understand the nature of reality and consciousness as a coherent whole – an ultra-holistic cosmic view he supports with holographic analogies concluding that ‘everything is enfolded into everything’. The implicate (or ‘implicit’) order implies mutual participation of everything with everything – the subtext to deVille’s latest series of work. According to the gallery, her new works ‘act as tangible metaphors for implicit interconnectedness of all things and the importance of treating all life with respect; beliefs that form the core of [her] practice.’ Linden New Art’s Victorian architecture is the perfect canvas for deVille’s computer-simulated 40 creation in which she reimagines its original 19th-century rooms with modern interior design and stylised props. A recently renovated space, deVille performs her own makeover with the assistance of artist Leslie Rice in producing paintings on black velvet to hang alongside deVille’s regenerated Ark inhabitants. Their footings are lodged in place by resin cases made by sculptor Kate Rhold, and their virtual pairings are accentuated by beautifully designed framework. Further contributions include Josh Weatherlake’s (Adipocere) hand embroideries, Adam Wallacavage’s surreal octopus chandeliers and candelabras with Art Nouveau-esque motifs and New Zealand stoner carver, Jo Sheehan, who sculpted marble knickers for the exhibition while New York-based artist and holographic specialist, Dr Mrongovius worked in collaboration with deVille to develop her intermediate photographs. Together they create an elaborate, augmented world, an afterlife, in which deVille’s creatures and the viewer can go on living. Linden New Art Until 4 November, 2018 Melbourne Snow, 2015, rabbit, sterling silver, black rhodium, seed pearls, black garnet, black diamonds 0.72ct, egret feathers, wood, fabric, glass case, 50 x 60 x 160cm (inc case) Photograph: Terence Bogue Courtesy the artist, Sophie Gannon Gallery, Melbourne, and Linden New Art, Melbourne 41 Kieran Butler Queen Size Chloe Mandryk Kieran Butler celebrates their non-binary identity using the illusion, transformation and magic of drag and photography. They shared, ‘the foundation for my practice comes from Photography and understanding what its materiality is. From the materiality of photography I moved towards my materiality – who am I, what makes me this person, and what will inform the person I am going to EHFRPHn7KHDUWLVWnVQHZERG\RIZRUNFRPSULVHVDFROOHFWLRQRIíWWHGEHGVKHHWVDQGTXLOWFRYHUV which have been digitally printed with photographic works as well as one on one silent disco drag SHUIRUPDQFHVDQGWH[WZRUNVWKDWUHîHFWFRQYHUVDWLRQV%XWOHUKDVKDGZLWKIULHQGVDQGFROOHDJXHV in the LGBTQI+ community. :KDWLVLWDERXWSKRWRJUDSK\DVDPHGLXPWKDWPDNHVLWWKHSHUIHFWíWIRU\RXUPHVVDJH" Photography is the perfect medium because it is never exclusively one thing. For example, I mean that photography is always an image and an object at the same time – one is never really removed or differentiated from the other. Whether an image is displayed on a screen or displayed as a print there’s always an element of ‘objectness’ to the image. Photography is a medium that truly íWVLQWRDQRQELQDU\IUDPHZRUNDQGVRLVWKHSHUIHFWPHGLXPWRH[SORUH/*%74,LGHQWLWLHVDQG OLYHGH[SHULHQFHVEHFDXVHWKH\íWLQWRWKHVDPHNLQGRILGHDWKDWQRWKLQJLVHYHUH[FOXVLYHO\RQH thing or static. ,QDIHZRI\RXULPDJHVWKHSURWDJRQLVWLVKROGLQJDVPDUWSKRQH'R\RXULIIRQQRWLRQVRIWKHnVHOíHo" ,ULIIRQQRWLRQVRIWKHVHOíH7KHVHOíHLVDPDUNHURIWKH0LOOHQQLDOJHQHUDWLRQEXWDOVR KDVDORWRIDVVRFLDWLRQVZLWKLGHQWLW\RQOLQHDQG,5/DQGERWKEHLQJîXLGrDJDLQSOD\LQJLQWR philosophies of the non-binary. It’s also featured for pragmatic reasons – my phone is my wireless shutter release. It allows me to control my camera from a distance because I typically work solo during a shoot. 7KHPDNHXS\RXDSSO\KLJKOLJKWVWKHIDFHZRXOG\RXVD\LWLVDOVRDPDVN" ,WnVGHíQLWHO\DPDVNEXWQRWRQHIRUFRQFHDOLQJRQHIRUUHYHDOLQJ$WWKHPRPHQWP\HQVHPEOHV are about myself – they’re basically my everyday wardrobe elevated to a level of hyper-real-Kieran – my drag. +RZZHUH\RXLQWURGXFHGWRGUDJDQGKRZKDVLWHQDEOHG\RXUDUWSUDFWLFH" My earliest memory of drag is from when I was a very young child, maybe three or four. I was at the shops with mum and there was a person who looked like a man wearing ‘women’s’ clothes. They were explained to me as being a transvestite or a person who lives like a drag queen without the hyped-glamour. As a child I was so fascinated by this person and how they presented themselves – it’s a memory I’ve never let go of. As I’ve grown I’ve learned how nuanced gender identity is and that drag means something different for everyone and can be applied to many different contexts. Moving through art school I steered clear of content that was political or personal in nature. Many of my peers would comment on how “queer” my work was even in a still life format. These comments combined with that memory and modes of drag have enabled my practice to move forward from the single subject of photography. Figuring out what my drag is has been a real learning experience allowing myself and my practice to become more authentic – maybe more hyper real too. It gives my work more entry points to communicate with a more diverse audience. 42 :K\GLGWKH*UHHNVWRU\RI&DVWRUDQG3ROOX[DSSHDOWR\RXDVDQDUUDWLYHWRUHFDVW" 7KHVWRU\RI&DVWRUDQG3ROOX[IRUPHKDVDWZRIROGPHDQLQJ2QDVXSHUíFLDOOHYHOP\]RGLDF sign is Gemini and I have a twin brother – mythology and systems of magical thinking have DOZD\VIDVFLQDWHGPH2QDGHHSHUOHYHOWKHP\WKRORJ\VXUURXQGLQJWKHíJXUHVRI&DVWRUDQG Pollux – who make up the constellation Gemini – deals with themes such as composite families, machismo, community, support, re-birth, and the associated trauma of these transformative experiences. These are some themes that resonate, in my experience at least, with the LGBTQI+ community (if not all people) and experiences of identity formation. ANCA Gallery 19 September to 7 October, 2018 Australian Capital Territory We are not related by blood, but by blood GHWDLO GLJLWDOSULQWRQFRWWRQSLPDTXLOWHG.LQJVLQJOHíWWHGEHGVKHHW[[FP Courtesy the artist and ANCA Gallery, Australian Capital Territory 44 Genevieve Felix Reynolds Logic Elli Walsh The tightly-choreographed paintings of Sydney-based artist Genevieve Felix Reynolds hatch multi-layered dialogues between classicism and contemporaneity; materiality and digitisation. Representational fragments of ancient artefacts are set within non-objective, geometric frameworks, conjuring complex new conceptualisations of space. :KDWDUH\RXH[SORULQJLQWKLVODWHVWVHULHV" Painting has always been about space; and its lack. Today we have new languages and technologies through which to tackle this concept. I’m interested in the effect of the digital era on RXUSHUFHSWLRQVRIVSDFH$FROODJHOLNHDSSURDFKWRJHRPHWU\DQGWKHíJXUDWLYHDOORZVPHWRSOD\ ZLWKîDWQHVVDQGíQGVSDFHEHKLQGLW References to fragments of classical sculpture link the three-dimensional to the two-dimensional, and the old to the new, but I’m also being wry. These fragments aren’t really paintings of ancient artefacts at all; they’re paintings of jpegs, which were photographs, which were sculptures in museums, which were in old cities, which were new. My experience of most of these objects is as SLFWXUHVRQDVFUHHQrîRDWLQJFRQWH[WOHVVLQWKHJUHDWEHOFKLQJVZDPSRIWKH,QWHUQHW +RZDUH\RXHQJDJLQJZLWKKLVWRU\DQGDUFKLWHFWXUH" These are life-long interests of mine, but as metaphors they’re easily politicised. The words ‘Rome’ and ‘crumbling’ come to mind. These references in my work might be nostalgia for a mythical ideal civilisation, or criticisms directed at the world today, but they aren’t intended to have an explicit message. I prefer a muddier, amorphous approach to conceptualisation. Like painting and photographed sculpture, architecture straddles the 2D /3D divide. The Cartesian plane makes building a breeze by simplifying space into formulae. In art school I was obsessed with a quote from Cézanne – ‘treat nature by means of the cylinder, the sphere, and the cone’. It is a slippery slope between lines and curves and buildings and bodies. If this is a sliding VFDOHWKHSKRWRJUDSKLFDOO\UHDODQGWKHJHRPHWULFDOO\îDWDUHFRXVLQV$QGZKDWnVWKHGLIIHUHQFH EHWZHHQíJXUDWLYHDQGJHRPHWULFLPDJHU\WRDPDFKLQH",nPSULQWLQJP\VFUHHQVORZO\ mechanically, by hand. &DQ\RXZDONPHWKURXJK\RXUDUWPDNLQJSURFHVV" Before painting I make digital sketches – lots – often using earlier works as starting points. One composition can generate thirty more fairly quickly – this is why elements often reoccur. Like geometric perfection, the multiple is made mundane by the computer. Turning jpegs into paint is the antithesis of this proliferation. 46 Painting is my last step and involves slowing down dramatically. Only one percent of the sketches become paintings. I’m staying away from mechanising the painting process with tools like tape and spray paint – for the works to be conceptually distinct from the digital they must be truthful renditions of the hand. Lately I’ve UHDOO\HQMR\HGLQFRUSRUDWLQJíJXUDWLYH elements into my work as it’s a welcome relief from straight lines. I listen to audio books while I paint – one painting takes about one book. There’s a kind of remote sensuality in WKHVHSDLQWLQJV WKHFROGPDUEOHîHVK of anatomical fragments like visual V\QHFGRFKHVUHDIíUPLQJWKHERGLO\DQG the tangible in an increasingly immaterial HUD,VWKLVLQWHQGHG" 1DLOHGLW3UHWHQGîHVKLVZHLUGr sensual and frigid; another dichotomy. I’m interested in what guides your choice of colour. /DWH%DURTXHSDLQWLQJLVDQLQîXHQFH because Fragonard basically solved colour, but it’s a pretty intuitive process that I’ve been experimenting with for a long time. I’m probably searching IRUDSHUVRQDOIHHOLQJ,WU\WRíQG new colour combinations that feel contemporary and fresh, but meditative and potentially timeless. Heavy blue is psychologically intense. Grey pink is calm and alert. Golden brown is warm but authoritarian. Like visiting a tiny Catholic church. The chartreuse is the guilt. Elli Walsh is a Sydney-based arts writer. Nicholas Thompson Gallery 26 September to 14 October, 2018 Melbourne Adobe, gouache and acrylic on aluminium composite, 90 x 67cm *RGîHVK, gouache and acrylic on aluminium composite, 90 x 67cm Courtesy the artist and Nicholas Thompson Gallery, Melbourne 47 Ken Unsworth Truly, Madly Julian Day As I sit down with Ken Unsworth and sip coffee on his sun-speckled deck I feel I’ve hit the artworld jackpot. Unsworth’s home nestles Sydney Harbour, yet the white-haired former welder from 0HOERXUQHWUDQVPLWVDIUXJDOQRQFKDODQFH+LVZDWHUIURQWJDUGHQGHíDQWO\REVFXUHVWKHYLHZ with carefully planted native shrubs and he punctuates our chat with homemade veggie stew. 8QVZRUWKLVRQHRI$XVWUDOLDnVPRVWSUROLíFDQGXQFDWHJRULVDEOHDUWLVWV$FURVVVL[GHFDGHVKHKDV generated a vast body of work incorporating such recurring themes as levitating rocks, automated pianos and cycling skeletons. It echoes minimalism, body art, arte povera and vaudeville in equal measure, yet remains deeply idiosyncratic. Somehow this complex catalogue has been ordered into key themes for a retrospective at the 1DWLRQDO*DOOHU\RI9LFWRULD 1*9 6XUSULVLQJO\LWnV8QVZRUWKnVíUVWVXFKVKRZLQKLVELUWKWRZQ ‘The title is Truly, Madly’ he reveals ‘and it’s been a mad experience.’ The exhibition sprawls across all three levels of the NGV at Federation Square. It mixes older and newer works, including three new commissions, and continues Unsworth’s obsession with ‘the human body, the surrogate body, and the skeletons.’ 2QHZRUNXQLWHVDWDWWRRHGDQJHODSLDQRDQGDíJXUHVODSSLQJWKHîRRUZLWKDFDQH$QRWKHU centres on a 17-foot skeleton with an elongated penis made of blown Plexiglas, surrounded of course by stones. Elsewhere a blackbird persistently pecks at a cast of Unsworth’s body refashioned as St Francis of Assisi. Despite the mystery and symbolism in his work, Unsworth is frank and down to earth in person. He aims to make art every day although at 87 years old admits to ‘slowing down a bit’. Whilst he mostly works out of an old factory building in a nearby suburb, he maintains a small studio at home for ‘sitting and scratching my bottom’ and undertaking ‘my other sin of painting, which I keep very secret.’ The extent of this discreet yet long-standing practice is evident in a new monograph by Anthony Bond in collaboration with ARTAND Foundation that dedicates two of its 12 chapters to drawing DQGSDLQWLQJ8QVZRUWKnVEDVHPHQWVWXGLRUHYHDOVKLVODWHVWVXFKZRUNDQDOOHJRULFDOíJXUDWLYH painting recalling early Arthur Boyd. This side of Unsworth might seem surprising compared to his more epic sculptures, installation and performance art. ‘Drawing is a way of thinking,’ he explains, ‘and of expressing those thoughts and putting them into some sort of form. Drawing’s always been essential to my working life. It becomes like an HQF\FORSHGLD,QIDFW,FDQUHPHPEHUHYHU\GUDZLQJ,nYHHYHUPDGH,WnVDYHU\îXLGîH[LEOHYLWDO sort of activity. Drawing is contiguous with the body, which is ultimately the key to unlocking Unsworth’s practice. His focus on the body emerged circuitously on a 1971 trip to New York City where he stumbled upon a book about arte povera. ‘I came back to Hobart and started using natural 48 materials like little river stones and thorns. Then I had this brainwave that the human body was a natural material.’ He quickly delineates his work from peers like Mike Parr who deliberately stress the body, instead ‘using the body as a sculptural element being driven by some other force.’ In Unsworth’s work the body is always in tension, attempting to transcend its limitations. Its WUDFHLVDOVRSUHVHQWLQWKHVFXOSWXUHV6WRQHVDIWHUDOOGRQnWîRDWE\WKHLURZQDFFRUG6LPLODUO\ a silenced piano requires the human body to coax forth its voice. Or some automated canes thrashing the piano into submission. ‘Fluxus is instinctively where my thinking is: humour, accidents and violence.’ The disjuncture between theatre and life has been central to Unsworth’s thinking since his ‘feral’ adopted childhood in Melbourne where he was captivated by magic, theatre and musical FRPHGLHV/DWHUGDUNQHVVDURVHIURPSHULRGVVSHQWLQSUHXQLíHG%HUOLQDQGE\VXFKH[SHULHQFHV as the deaths of his beloved wife Elisabeth and his stepson. One way to process and communicate this has been through humour, a lesson absorbed from Shakespeare. ‘If you weigh an idea down on somebody there’s an impossibility to accept it. Humour enables the message to penetrate far more effectively. That’s come naturally in my work – that sense of humour, that lightness of touch.’ 49 Julian Day is an artist, composer, writer and broadcaster. National Gallery of Victoria: Ian Potter Centre 14 September to 17 February, 2019 Melbourne )LYHVHFXODUVHWWLQJVIRUVFXOSWXUHDVULWXDO íIWKVHWWLQJ , 1975, animated installation, mixed media, light and sound, dimensions variable Tattooed pianoSLDQRíEUHJODVVUHVLQSRO\XUHWKDQHIRDPJROGOHDIOHDWKHULQNHOHFWULFDOFRPSRQHQWV[[GLPHQVLRQV variable Collection of the artist © Ken Unsworth Courtesy the artist and National Gallery of Victoria, Melbourne 50 S ’S 18 20 ERIE LAN S 2 NOV –1 SIDNEY NO UG NED KELLY 11 A BIOMESS – THE TISSUE PROJECT & ART CULTURE ZURR) / IONAT CATTS (ORON 8 SEP – 3 DEC 2018 . rr . u ency nat Z g paint on Io l s& att Oron C 1946 – 1947. Ename s Brewing Co. s Brewing d National Collecting Institutions Program & Outreach Touring of Australia. y lly series Ke d ect. Museum. Australian Collection, Western j Ne ect (Oron Catts/Ionat Zurr) j y, Juniper Estate, Gage Juniper Estate, y, Roa d Reed 1977. National Galler y , Kenne l 1946 (detail) from the y Kelly ex Hote ram. The National Gallery of Australiaram. is an Australian Government A l ed g 2017 (detail). Courtesy of the artist. Courtesy (detail). 2017 N ect between SymbioticA @ UWA, Western Australian Museum and the Art Gallery Australian Western SymbioticA @ UWA, ect between of WA t j ines, A l e river Nolan h al Partner y series p y ll r yt 2018 (detail). The Tissue Culture & Art Pro b Ke rinci ess P : Sidne – and Outreach Pro trees s p om g h SPACED 3: NORTH 3: NORTH SPACED SOUTHEAST BY 2019 – 7 JAN 18 AUG –Bi ition Sponso Birc et hib m be ery.wa.gov.au a Ex Sponsor l Co l ll llenLowe, Singapore Air cC ar osition board, 90.8 x 121.5 cm. Gift of Sunda p st a dney Nolan’s Ned Se Si This exhibition is a collaborativeThis exhibition pro Annua Principa WA Now – Biomess – The Tissue Culture & Art Pro spaced 3: north by southeas spaced 3: north by artga 303 Mu Clockwise from to com Dan M AUGUST – DECEMBER | FREE This project has been assisted byInstitutions the Tourin Australian Government’s Visions of Australia program and by the National Collecting A Body of Work Systematic Photography of Plimsoll Gallery Adrian Boddy 8 September to 14 October, 2018 Tasmania Justin Arts House Museum Until 2 December, 2018 Melbourne Three-hundred images are thematically Curated by Eliza Burke, ‘Systematic’ grouped and displayed across ten TV screens showcases a group of Australian artists who in a visually rich, immersive exhibition of engage with the creative potential of systems photography by Adrian Boddy. These works, to critique, re-imagine or re-invent their gathered over the course of the artist’s workings. Across sculpture, installation, career, depict portraiture, architecture, fauna photography, generative animation, and landscapes such as Hokkaido winters painting and assemblage, these methodical and Antarctic summers, as well as the arid SLHFHVUHîHFWRQKXPDQDQGQRQKXPDQ Australian outback and cool coastlines. relationships through the material dynamics In their entirety, these captured moments of engineered connections and intricate provide a pictorial account of Boddy’s life componentry. Concepts of organisation, inter- journey as well as a look into the history of relatedness and connectivity are explored the medium. through technology and iterative processes, manipulation of materials and forms of perception, and ecological and political histories of ‘the system’. Rams Head Range, Thredbo, 2006, digital, 300 x 200cm Ian Burns, Circle, 2016, fans, latex gloves, table, air, timing system, Courtesy the artist and Justin Arts House Museum, Melbourne 165 x 160 x 160cm Courtesy the artist, Anna Schwartz Gallery, Melbourne, and Plimsoll Gallery, Tasmania 54 Beth Inkamala and Julian Meagher Carlene Thompson Tidelines Alcaston Gallery Edwina Corlette Gallery 5 September to 6 October, 2018 18 September to 20 October, 2018 Melbourne Queensland Earlier this year Beth Inkamala and a group of After more than a decade away from the fellow Hermannsburg potters travelled from subject of landscape, artist Julian Meagher the Northern Territory to Pukatja in South has returned with renewed vitality, inspired Australia to join Carlene Thompson and by becoming a parent and cognisance of the other local artists to participate in a series of relationship between First Nations peoples ceramic workshops. They shared stories of and the land he was appreciating on a recent country and culture and worked on learning residency. Meagher’s feelings for the Bithry new techniques in pottery. Inkamala and Inlet were enriched by a moment he shared Thompson now come together to present this with a visually impaired student who painted exhibition of new works depicting their own the place from memory, prompting the LQWHUSUHWDWLRQVRIWKHODQGVFDSHUHîHFWLQJRQ artist to approach his own practice with connection to country and community. greater intuition. Beth Inkamala (Mbitjana), Untitled, 2018, terracotta and Tideline #1, 2018, oil on linen, 152 x 122cm underglazes, 48 x 28cm Courtesy the artist and Edwina Corlette Gallery, Queensland Courtesy the artist and Alcaston Gallery, Melbourne 55 Mimi Tong The way we see ourselves In Time West End Art Space 1 to 29 September, 2018 Galerie pompom Melbourne 19 September to 14 October, 2018 Sydney Over 20 days artist Mimi Tong will occupy Ten artists reframe the subject of ‘women’ in the front gallery creating drawings inspired DUWE\UHîHFWLQJRQWKHLURZQPHPRU\GUHDPV by objects and books that refer to the labour and experiences of being and reclaiming of making and marking time. Inevitably representation for themselves. Subverting her actions will conjure ideas of duration ideas of femininity, while embracing the and process. The public-facing experiment nuance of each story, the artists communicate should generate informal interactions with personal narratives via painting, sculpture, passers by, and her audience, opening up drawing and photography from Jen Ahmad, WKHSRVVLELOLW\RIRXWVLGHLQîXHQFHRQWKH Gemma Avery, Michelle Cawthorn, Louisa solo-project. See how the experiment has been Chircop, Julia Flanagan, Nicole Kelly, Caterina resolved at a closing reception and artist talk Leone, Kiata Mason, Clare Thackway and on 14 October. Isabelle Wood. In Variation, 2016-17, Arches paper, graphite, ink, 5 Parts, Kiata Mason, Bedroom, mixed media on paper, 160 x 180cm 20 x 25 x 20cm Courtesy the artist and West End Art Space, Melbourne Photograph: Mimi Tong Courtesy the artist and Galerie pompom, Sydney 56 We are all connected Ray Harris to Campbelltown Ghosts in the Machine (one way or another) FELTspace Campbelltown Arts Centre 5 to 22 September, 2018 Until 14 October, 2018 South Australia Sydney Celebrating Campbelltown Arts Centre’s Performative video and installation by Ray 30-year anniversary, this exhibition Harris delves into the memories and emotions showcases the establishment’s diversity of that remain in our psyche and bodies as felt culture and unique geographical landscape. connections, lived experiences and unknown Campbelltown’s history, place and people forces. ‘Memory and nostalgia have enduring are considered through new commissions effects on us through both what we remember, and existing works by artists who have a what we forget, what remains and fades. I connection to the area. Highlights include have been thinking a lot about our personal Shireen Taweel’s recognition of Islamic ghosts both recalled and disremembered and culture in Australia in a suspended, semi- the affects of the past lingering within us, circular environment inviting visitors into haunting our selves and lives in immeasurable the intimacy and physicality of prayer, and intangible ways,’ says Harris. Danie Mellor’s four-panel photographic series responding to the population and ecology of space in the Macarthur region. Shireen Taweel in her studio at Parramatta Artist Studios, 2018 Ghosts in the machine (detail), 2018, mixed media, dimensions Photograph: Jacquie Manning variable Courtesy the artist and Campbelltown Arts Centre, Sydney Courtesy the artist and FELTspace, South Australia 57 Rosie Deacon Jamie North South/East Interference Volume I Swamp Anatomy Bega Valley Regional Gallery Neon Parc 15 September to 20 October, 2018 7 September to 20 October, 2018 New South Wales Melbourne ‘South/East Interference Volume I’ is an As is a common condition of city living, exhibition of sculpture and installation one day, artist Jamie North looked out his by Rosie Deacon exploring humanity and window and observed a luxury apartment feelings of belonging. Inspired by her love for development coming together. However, as ‘Australiana’ objects, a passion she developed the project progressed he noticed the swamp from the souvenirs which decorate her family EHORZLWVVLWHZRXOGUHDVVHUWLWVHOIíOOLQJWKH home including her mother’s prize-winning earthworks with water, delaying construction hand-stitched tapestries and her father’s and attracting bird life. This new body of work Aussie pub paraphernalia. meditates on this experience with the artist merging built forms, of concrete and bronze, ‘I have a personal obsession with animal- with organic material. imagery, yet made horrifyingly unfamiliar, by transforming its natural inhabitants into a spectacularly camp pastiche of faux fur and perennial pride,’ says Deacon. Rosie Deacon in her studio, 2018 Ring Form No.01, 2018 (right) and Ring Form No.02, 2018 (left), Photograph: Jacquie Manning work in progress Courtesy the artist and Bega Valley Regional Gallery, New South Photograph: Jack Lanagan Dunbar Wales Courtesy the artist and Neon Parc, Melbourne 58 THE 1818 PROJECT No Second Thoughts: Newcastle Art Gallery ϐ 8 September to 4 November, 2018 Women’s Art Forum New South Wales Lawrence Wilson Art Gallery 1 September to 8 December, 2018 Western Australia ‘THE 1818 PROJECT’ deconstructs colonial Presented by the Cruther’s Collection of painting through a contemporary lens. As a Women’s Art, this exhibition of newly springboard to examine cultural histories, commissioned works delivers four artists identity, and personal stories of migration, responses to the Artemis archive which loss and diaspora, eight Australian artists holds correspondence, meeting minutes, create their own narratives in response to H[KLELWLRQHSKHPHUDDUWLVWíOHVDQGRWKHU original landscape paintings depicting scenes documentation by the Artemis Women’s Art of Newcastle’s Coal River region c.1818, by Forum Inc. (1985-1990), a group who worked English convict artist Joseph Lycett (1774- towards raising the status of women in the 1825). Abdul-Rahman Abdullah, Shan Turner- arts. Former Artemis committee members Carroll, Dale Collier, Karla Dickens, Fernando Penny Bovell and Jo Darbyshire, with early do Campo, Lindy Lee, Yhonnie Scarce and career artists Teelah George and Taylor Jacqui Stockdale present glass, sculpture, Reudavey examine the history of Western photography, performance, painting, drawing Australian feminist art. and installation. Florey and Fanny, 2011, blown glass, 15 pieces, cotton aprons, Jo Darbyshire, The Glorious Decline, 2018, oil on canvas, from the ‘Target practice’ series exhibited 2011, dimensions 200 x 200cm variable © the artist City of Yarra Council Collection Courtesy the artist and Lawrence Wilson Art Gallery, Western Courtesy the artist, THIS IS NO FANTASY dianne tanzer + nicola Australia stein, Melbourne, and Newcastle Art Gallery, New South Wales 59 Graeme Drendel Joshua Smith On uneven ground Urban Decay Beaver Galleries Australian Design Centre 6 to 23 September, 2018 Until 26 September, 2018 Canberra Sydney Graeme Drendel’s paintings and works on South Australian artist Joshua Smith paper possess an exacting whimsy. He skilfully highlights the beauty, grime and decay of renders a dream-like stage for symbols and his neglected buildings on city streetscapes actors to gather, sometimes as companions with his intricately-crafted miniature though often alone, similar to a Renaissance reproductions of these once immaculate composition but without a didactic message. VWUXFWXUHVm8UEDQ'HFD\nIHDWXUHVíYHVPDOO The lack of moralising is part of the pleasure scale models, rendered from various materials of his mysterious images. This exhibition including MDF, cardboard and plastic, of FRQFHQWUDWHVRQWKHLVRODWHGíJXUHLQD Sydney’s Olympia Milk Bar, Stanmore, the ‘seemingly unlimited space devoid of any Karim building in Surry Hills and the Chinese concrete point of reference,’ said the artist. Ginseng and Herbs Shop, Haymarket, a Milk Bar from his home town Port Adelaide and a Bodega in Brooklyn, New York. Enclosure, 2018, oil on paper, 31 x 26cm Olympic milk bar, Stanmore, Sydney, 2018, mixed media – MDF, Courtesy the artist and Beaver Galleries, Australian Capital cardboard, paper, plastic, weathering pigments, styrene and wood Territory Photograph: Ben Neal Courtesy the artist and Australian Design Centre, Sydney 60 Between Suns Janet Luxton The Questioning Eye Cement Fondu Until 16 September, 2018 Sydney Australian Galleries 4 to 23 September, 2018 Sydney Artworks by the Refugee Art Project and a Janet Luxton’s paintings highlight the QHZO\FRPPLVVLRQHGVKRUWíOPIURP(J\SWLDQ intricate beauty and unique characters of the íOPPDNHU0RQD,EUDKLPFRPSULVHWKHíUVW natural world. They demonstrate Luxton’s socially-engaged and project-driven exhibition advocacy of animal rights and her belief in Cement Fondu has presented. Complex showing these creatures greater respect. topics from personal and cultural identity ‘My paintings are an attempt to portray and navigating (physically and emotionally) the beautiful diversity and individuality of different social realms underpin the show, but the animals and birds caught up in these a consistent thread the participants impart turbulent times… I hope my efforts might is ‘connectedness’ expressed against the encourage others to think likewise,’ says the background of everyday Australian life. artist. Luxton paints during the exhibition, providing viewers with an opportunity to witness her process as it unfolds. Mona Ibrahim, Let the leaves cover me, 2018, 8min 24sec video Chinese Goose, 2018, oil on linen, 120 x 160cm Courtesy the artist and Cement Fondu, Sydney Courtesy the artist and Australian Galleries, Melbourne and Sydney 61 Art & Industry As we near celebrating 45 years of publishing Art Almanac continues to serve and be shaped by people who engage with art everyday. Our practice supports the sustainability of our arts community in all its forms. We have experience as artists, in critical writing, working in galleries and festivals, design, teaching, digital media and the curatorial ield. Art Almanac is more than a magazine. 62 space. Control and surveillance of nature was a prominent feature of French formal gardens, and Artist that is what I intend to explore and respond to in my Opportunities new work.’ ‘To date, the majority of my work has explored these ideas within the Australian context, so the opportunity to stay in Paris and expand the scope of my research We have selected a few galleries will be hugely beneficial and rewarding,’ she continues. and funding bodies calling for The AGNSW also awarded Studio Scholarships at submissions for Art Awards, the Cité Internationale des Arts in Paris, to artists Artist Engagements, Grants, Tracey Clement, Sarah Contos, Gregory Hodge, Valerie Public Art, Residency Programs, Kirk, Giselle Stanborough, Alexandra Standen, and Exhibition Proposals and more. Esther Stewart. Enjoy and good luck! BAM Art Prize Entries close 13 October 2018 Alice Couttoupes awarded the The inaugural BAM Art Prize is a $5,000 non- 2018 Eva Breuer Travelling Art acquisitive award, and includes three highly Scholarship commended awards. Presented by Byron Arts Magazine (BAM) with the aim of promoting the arts The ‘Eva Breuer Travelling Art Scholarship’ is an within the Northern Rivers region. The winners will annual award to support a young Australian female be featured in the BAM summer edition, and the to study and further their arts practice in Paris. prize is open to all artists nationwide for works in any Developed by The Breuer Foundation, in association medium. The finalist exhibition will be held in Byron with the Art Gallery of New South Wales (AGNSW) in Bay from 9 to 30 November. memory of Eva Breuer and the contribution she made byronartsmagazine.com.au to Australian Art. The AGNSW have announced Alice Couttoupes as the Megalo International Print Prize 2018 recipient. The Sydney artist has been awarded Entries close 23 September 2018 a three-month residency and $25,000 towards living Megalo Print Studio + Gallery announce the first and travel expenses associated with the overseas Megalo International Print Prize with $18,500 on placement. offer. First Prize $10,000, Second Prize $5,000, People’s Choice $1,000 and the Lerida Estate Acquisitive Prize $2,500. The finalist exhibition will be held 16 February to 6 April, 2019. megalo.org National Indigenous Arts Awards 2019 Expressions of Interest and nominations close 2 October 2018 The National Indigenous Arts Awards celebrate the significant contribution of First Nations artists to the vibrancy of Australian arts, and celebrate the work and achievements of both established and emerging Alice Couttoupes at work, 2018 recipeint of the Eva Breuer Travelling artists. The Australia Council invites nominations from Art Scholarship arts and community organisations and individuals Photograph: Tim Darin Courtesy the artist and Art Gallery of New South Wales, Sydney for The Red Ochre Award, which recognises two outstanding senior artists – one female and one male. Couttoupes predominantly works with clay in its While Expressions of Interest are invited for The vitrified and raw state, with a focus on exploring Dreaming Award, which recognises an inspirational sociocultural and political ideas that inform our young artist aged 18-26 years. This award supports interaction with nature. She explains, ‘In Paris I plan the recipient with the opportunity to create a major to examine the trope of ‘mastery over nature’ by body of work through mentoring and partnerships, looking at French formal garden design – such as either nationally or internationally. Versailles – as a socially and culturally symbolic australiacouncil.gov.au Art & Industry 63 MCA and Create NSW Fellowship Hill End Artists in Residence Submissions close 12 September 2018 Program The NSW Visual Arts Mid-Career/Established Applications close 5pm, 31 October 2018 Fellowship applications are now open. One Visual artists, writers/curators, musicians, new media/ Fellowship will be awarded to a mid-career or film/video artists are invited to apply for the 2019 established visual artist to undertake a self-directed season of residencies at the Haefligers Cottage and professional development program, or other significant Murrays Cottage at Hill End located in the Bathurst opportunity to support their personal creative and region in New South Wales between March 2019 and career advancement. In addition to this fellowship March 2020. Hill End’s distinctive blend of landscape, the selected artist will also work with the Museum of gold-mining history and vernacular architecture Contemporary Art Australia to develop a new project continue to attract generations of Australian artists. that is appropriate to their practice. hillendart.com.au create.nsw.gov.au Van Eyck Residency 2019 Copyright Agency Fellowship Applications close 11.59pm, 1 October 2018 for a Visual Artist Artists, designers, curators, photographers, Applications close 24 September 2018 (landscape) architects, writers, and critics are invited The Copyright Agency’s fellowship program awards to apply for a six to 12-month residency in 2019 at one $80,000 Fellowship each year to an established the Jan van Eyck Academie in The Netherlands – an Australian visual artist to develop and create new international, multidisciplinary institute for talent work in any medium. To be eligible to apply, the development in a multiform working environment. applicant must have a contract to exhibit their work The residency includes a studio and access to well- with a commercial or public gallery, or a letter of equipped labs for print, photography/new media, intention to exhibit from a commercial gallery. wood and metal, and a library/lab for nature research. copyright.com.au It offers the opportunity to engage in collaborative projects with civic partners and partners from science Princeton Arts Fellowship and the arts; a public programme of events, talks, workshops, symposia and exhibitions. 2019-21 janvaneyck.nl Applications close 11.59pm, 18 September 2018 The Princeton Arts Fellowships are awarded to artists whose achievements have been recognised Gasworks Arts Park: as demonstrating extraordinary promise in any area From Nature Organic of artistic practice and teaching. Applications are Sculpture Exhibition open to but not limited to; early career composers, Applications close 23 September 2018 conductors, musicians, choreographers, visual artists, Gasworks Arts Park invites entries for the ‘From filmmakers, poets, novelists, playwrights, designers, Nature Organic Sculpture Exhibition’ which will directors and performance artists who would find it feature up to 40 outdoor sculptures installed beneficial to spend two years teaching and working in throughout the park grounds from 3 to 11 November. an artistically vibrant community at Lewis Center for Artists, students, creative individuals and groups the Arts, Princeton University, New Jersey, USA. working in the fields of sculpture, ceramics, landscape arts.princeton.edu architecture, floral design, and transitory installation art are encouraged to apply. The exhibition includes Abbotsford Convent a $4,000 People’s Choice Award, and a new $4,000 Studio Residency Program Curator’s Choice Award. A Materials Stipend of $350, subject to funding, is available to applicants who Submissions close 11.59pm, 16 September 2018 successfully apply for consideration by 16 September. Applications are open for the 2019 Studio Residency gasworks.org.au Program at Abbotsford Convent. The program offers a unique opportunity for artists to have the time, space and support to undertake site-specific or responsive Small! – Call for submissions research and investigation, build on professional Submissions close 26 October 2018 networks and share their work with diverse audiences. fortyfivedownstairs invites submissions from everyone The residency includes 24/7 studio access for six for their first ever community-sourced, small works months, a $2,500 honorarium to be invested in exhibition, which will feature works in both the small project outcome, support and mentoring from Convent and large space within the gallery. Entries must be no staff, and a marketing and communications package. larger than 20 x 20cm including framing, and able to be Residency 1: 7 January to 5 July 2019. Residency 2: attached to the wall. This invitation is open to emerging 8 July to 20 December 2019. and established artists and those who just want to give abbotsfordconvent.com.au it a go. The exhibition will be on from 8 to 17 November. fortyfivedownstairs.com 64 Art & Industry Contemporary Art Awards 2019 Awards W www.contemporaryartawards.com Winner’s prize, $5,510 worth of cash and prizes, plus additional prizes for finalists. Apply online, or through the A.M.E. Bale Travelling supplied hardcopy application form. Visit the website Scholarship and Art Prize for details. Entries close Wed Nov 28. W www.gleneira.vic.gov.au/Bale Applications are open to emerging Australian artists who have demonstrated EMSLA talent and achievement in traditional styles for this Eutick Memorial Still Life Award major $50,000 award. Exhibition Nov 24 to Dec 9 at W www.emsla.com.au Painters over the age of 18 are Glen Eira City Council Gallery. Visit website for details invited to submit entries for the 12th Eutick Memorial and entry. Entries close Wed Oct 3. Still Life Award. First prize $20,000 non-acquisitive. See ad page 171. Visit website for details and entry. Entries close Fri Sept 28. See ad page 45. Adelaide Perry Prize for Drawing 2019 Evelyn Chapman Art Award T (02) 9704-5693. W www.shervingallery.com.au S.H Ervin Gallery is E [email protected] calling for entries for a new $50,000 scholarship to W www.plc.nsw.edu.au/microsites A $25,000 be presented to an Australian painter, male or female acquisitive award for Drawing. Exhibition March 3 to under 45. Offered to support a young Australian 29, 2018. Visit website for details and entry form. painter by furthering their art education both in Entries close Wed Jan 9, 2019. knowledge and artistic practice internationally, or in Australia. Entries close 5pm, Sat Sept 15. Birregurra Festival Weekend Art Show and Prize John Copes Portrait Prize W www.birregurrafestival.com/art-show T (02) 4861-4093. Artists are invited to enter the Birregurra Art W www.bdasgallery.com/artists-opportunities Show Prize. Categories include Drawing, Pastels, Entries open. First prize $5,000. Exhibition Sept 21 Watercolour, Acrylics, Oils, Photomedia, Printmaking to Oct 1 at Bowral Art Gallery. Visit website for details and 3D works. Exhibition Oct 13 to 15. Visit website and entry form. Entries close Wed Sept 5. for details and entry. Entries close Fri Sept 14. See ad page 120. ϐ Auxiliary – 42nd Annual Art Burnie Print Prize Exhibition and Sale T (03) 6430-5875. E [email protected] Entries are open for the 42nd Annual Mansfield W www.burniearts.net Burnie Regional Art Gallery District Hospital Auxiliary Art Exhibition Nov 2 to is calling artists to enter the 2019 Burnie Print Prize 5. Rotary Prize $2,000 with 5 highly commended and is offering a major acquisitive award of $15,000. ($100 each), People’s Choice Award of $500 and Exhibition March 22 to May 5, 2019. Entry forms are The Harry & Clare Friday Foundation Award for local available online. Entries close Fri Oct 5. (Mansfield Shire) artists of $1,500. Judge: Geoff Paynter, landscape artist. Entry forms are available Ceramic Break Sculpture Park from the Art Show Secretary: Susan Swan, 130 Sculpture Prize Killarney lane, Boorolite, Victoria 3723. (03) 5777- ‘Bondi’, Warialda 2402. T (02) 6729-4147. 5605, 0411-316-150. [email protected] W form.jotform.co/81779289306875 Entries close Fri Oct 19. Entries are open for this $12,000 acquisitive prize for sculpture. Exhibition 7 Sept, 2019 to 3 Jan, 2020. Montalto Sculpture Prize 2019 Submissions close Mon 1 July, 2019. T (03) 5989-8412. W www.montalto.com.au/ See ad page 153. sculpture-prize A $40,000 acquisitive prize for sculpture. Exhibition Feb 24 to Aug 25, 2019. Collins Place Gallery Download entry form and details from website. Summer Salon Entries close Wed Oct 31. See ad page 52. W www.collinsplace.com.au Call for entries. A new opportunity is open for artists with a $10,000 prize Mosman Art Prize pool on offer. Exhibition Dec 1, 2018 to Jan 31, W www.mosmanartgallery.org.au The annual 2019. Entries close Fri Sept 21. See ad page 91. acquisitive Mosman Art Prize is calling for submissions. First prize $50,000. Exhibition Sept 26 to Nov 18. Visit website for details and entry form. Entries close Mon Sept 10. Art & Industry 65 9x5 Landscape Prize Maggie Wren’s Art Space T (02) 9387 2461. E [email protected] Call Out for exhibitions W www.wwas.org.au/9 x 5 landscape prize E [email protected] Waverley Woollahra Art School invites all artists W www.maggiesartspace.com.au Maggie’s art space to submit 9x5 works on plywood board. Entry fee caters for contemporary and new media art. Low cost Fri, $30 per entry (includes plywood board). First prize Sat and Sun shows. Starting at $450 for the complete $1,000, second prize $500. Visit website for details space at 178 Johnston Street, Collingwood, 3066. and entry. Entries close Mon Oct 1. Project Gallery 90 The North Sydney Art Prize 90 Oxford Street, Paddington, Sydney 2021. W northsydney.nsw.gov.au/artprize Call for artists T 0402 144 350. E [email protected] to exhibit interior and exterior works across the W www.projectgallery90.com Calling artists, renowned Coal Loader site at 2 Balls Head Drive curators anddesigners to apply to exhibit inthis new Waverton. Exhibition March 2 to 17, 2019. concept space. Visit website for details and entry. Entries close Mon Oct 31. See ad page 12. TacitGalleries ROIArt Prize 2019-20 Proposals T W W www.roiapartments.com.au/roi art prize.html 0432 323 188. www.tacitart.com.au The annual ROI Art Prize is calling for entries Exhibition proposals are open to exhibit in 2019/20. from emerging and established artists to submit See ads pages 96 and 97. original artworks including painting, limited edition printmaking, photography and drawing. First prize is $10,000 and People’s Choice $1,000. The winning work is acquired for display in the ROI Apartments Internshipsp & complex located in North Fitzroy, Melbourne. Entries close Thurs Nov 1. Fellowships Shirley Hannan NationalPortrait Award Art Gallery of Western Australia W www.gallery.begavalley.nsw.gov.au Entries are W www.artgallery.wa.gov.au AGWA accepts now open for the $50,000 non acquisitive award volunteers on an ongoing basis, as well as offering for realistic portraiture. Visit website for entry details. formally structured internships. Entries close midnight, Fri Sept 14. Art India Magazine W www.artindiamag.com Learn the process of publishing the magazine from finish to end. Three Submissions four month internships are offered each year. & Proposals ϐ ǡ W www.artasiapacific.com Editorial and design internships for students and recent graduates excited Brunswick Street Gallery about contemporary art, magazines andlearning. Level 1, 322 Brunswick Street, Fitzroy 3065. T (03) 8596 0173. ǡ E [email protected] W www.artsy.net A fast paced digital company W www.brunswickstreetgallery.com.au/exhibit regularly advertises for Editorial, Accounts and Art Applications are open to exhibit at the gallery in Marketing positions. 2019. Proposals are invited from artists and curators. For more info visit the website or contact the gallery. Chippendale Creative Precinct W chippendalecreative.com The CCP Internship Editions 2019 – Call forEntries Program offers a platform for students looking to T 0432 323 188. W www.tacitart.com.au further their course work through practical insight into Tacit Galleries invites entries from Victorian based the operation of a not-for-profit Arts Organisation. printmakers for the Editions 2019 exhibition to run Feb 13 to 24. Entries close Sat Dec 1. 66 Art & Industry 35% OFF DURING SEPTEMBER Artists’ Watercolour is a professional quality watercolour that has been used by such renowned artists as Turner and Constable. Based on the finest modern and traditional pigments, it is precisely formulated to offer unparalleled performance and permanence. Only the very best pigments, regardless of cost are used in the manufacture of Daler- Rowney Artists’ Watercolour. Suspended in an aqueous solution of the finest Gum Arabic the colours and pigments in these watercolours offer an extended range of brilliant colours, designed to create perfect washes of pure transparent colour. Available in 5ml tubes and 15ml tubes. Bendigo Essendon Richmond Sunbury Nowra Thornleigh 159 McCrae St, 114 BuckleySt, 236 Swan St, 2B Old Bakery Walk, 6/68 North Street 9a/10 PioneerAve Bendigo VIC 3550 EssendonVIC3040 Richmond VIC3121 Sunbury VIC 3429 Nowra NSW2541 Thornleigh NSW 2120 Ph: (03) 5443 9700 Ph: (03) 9337 3594 Ph: (03) 9428 1511 Ph: (03) 9740 7487 Ph: (02) 4421 6821 Ph: (02) 9483 2418 www.arthousedirect.com.au ǡ Queen Victoria Museum Thailand and Art Gallery W www.doc-arts.asia This non-profit organisation W www.qvmag.tas.gov.au Volunteering with QVMAG aims to advance visual literacy and supports enables individuals to develop new skills and documentary artists in Asia. Internships in knowledge in related fields, offers the opportunity documentary photo, film, editing, curating, teaching to make professional connections, contribute to the and administration. visitor experience, be part of a supportive team and get involved with research and collections behind Ϊǡ the scenes. W www.westkowloon.hk In the Performing Arts Internship Programme you will work with professional Singapore Art Museum staff, full-time for a period of around six months and W www.singaporeartmuseum.sg Singapore Art gain practical and theoretical training in programming, Museum has internship opportunities throughout the venue operations as well as technical and year within different departments of the museum. productions. Paid and operating on a recurring basis, with openings every year. Sydney Living Museums W www.sydneylivingmuseums.com.au SLM Monash Gallery of Art internships are project-based allowing students to W www.mga.org.au Volunteers at MGA assist with gain insight into the elements of one or more projects. greeting visitors, events and programs, and undertake Interns may work in core museum areas; exhibition a range of specialised duties, including assisting with content development and interpretation, collection the gallery’s archive and research library. cataloguing, heritage and research, marketing, or event coordination. ǡ W www.nas.edu.au The NAS Gallery provides an Tate London internship program each year for a tertiary student or W www.tate.org.uk Gain a valuable insight into the recent graduate. NAS also seeks volunteers to work at arts, and opportunities to work on interesting projects least one or two half days each fortnight and commit and learn new, practical skills. to the program for 12 months. ǡ Canberra Materials W www.nga.gov.au We offer placements in a wide range of functions in a number of areas to provide as Art Spectrum broad an experience as possible. E [email protected] W www.artspectrum.com.au We are the makers of colour, dedicated to creating the finest possible artists’ Art Singapore colours. Visit website for more information on these W www.ntu.ccasingapore.org A three-month program quality products. See ad page 71. with stipend offers insights and an immersive work experience across several departments including; Art Stretchers Exhibitions, Residencies, Research and Education and Art supplies and Communications and Development. canvas stretching 309-311 High Street, Northcote VIC 3070. ǡ T (03) 9486-4446. E [email protected] W www.guggenheim-venice.it Internship program in W www.artstretchers.com.au H Mon-Fri 9.00 to Venice and The Hilla Rebay International Fellowship 5.30, Sat 10.00 to 3.00. Also at 161 Morphett advertised throughout the year. Street, Adelaide SA 5000. T (08) 8212-2711. E [email protected] See ad page 109. Arthouse Direct W www.arthousedirect.com.au An extensive range of art, graphic and craft supplies for students and professionals. During Sept 35% off Daler Rowney Artists’ Watercolour. See ad page 67. 68 Art & Industry Deans Art Port Art Supplies E [email protected] W www.deansart.com.au 83 Commercial Road, Port Adelaide SA 5015. Complete range of artists’ materials available. T (08) 8241-0059, F 8241-0058. E [email protected] Eckersley’s Art & Craft W www.portartsupplies.com.au H Mon-Fri 8.30 to 5.00, Sat 9.00 to 2.00. Stockists of quality fine art W www.eckersleys.com.au Shop online and in-store. materials. See ad page 165. Gift cards available. Fitzroy Stretches Ƭ T 1300-731-529. W www.creativityunlimited.com.au 63 Weston Street, Brunswick VIC 3056. Wholesalers of fine art supplies. Stocking a range T (03) 9380-9553. E [email protected] of art and craft materials with over 22,000 items in W www.fitzroystretches.com the range. Jasco Shades of Art W www.jasco.com.au Your guide to the best value art 74C Ovens Street, Wangaratta, VIC 3677. and craft supplies around! T (03) 5722-2296. W www.shadesofart.com.au Fine Art and Craft Supplies. Art + Design Supplies The Sydney Canvas Company W www.kadmium.com.au 80b Bay Street, Broadway 9/79 Station Road, Seven Hills NSW 2147. NSW 2007. T (02) 9212-2669. T (02) 8854-5070. W www.tsccaus.com.au Superior quality artists’ cotton and linen canvas rolls. Stretcher bars, stretching tools, gesso, easels. Order your Ceramic Art Supplies swatch book online or call us. See ad page 100. 49 King Street, Newtown NSW 2042. T (02) 9550-4433. W www.kerrielowe.com Wholesale Canvas Australia H Mon-Sat 10.00 to 5.30 (Thurs 10.00 to 7.00). 29 Smith Street, Marrickville NSW 2204. The only location in the inner city selling clay, T (02) 9517-3025. underglazes, glazes, tools and museum gel. W www.wholesalecanvasaustralia.com.au Wholesalers of fine primed and unprimed canvas and Neil Wallace linen rolls. A range of stretcher bars available. Printmaking Supplies Now stocking Sennelier Rive Gauche paints Services 409 Gore Street, Fitzroy VIC 3065. T (03) 9419-5949. E [email protected] W www.e-artstore.net H Mon-Fri 9.30 to 5.30, A Brush with Jordan Sat 10.00 to 5.00. Huge range of materials for W www.abrushwithjordan.com Unique tours for art printmakers and artists, also stocking a range of lovers. Experience the ancient country of Jordan from bookbinding accessories. See ad page 111. the artists’ perspective. Visit website for details. Newtown Art Supplies Accent Framing T (02) 9516-2339. W www.newtownartsupplies.com.au Fine Art Printing Online Australia-wide. 421 Sturt Street, Ballarat VIC 3350. T (03) 5331- 7011. W www.accentframing.com.au Wide-format Parkers Sydney Giclée printing. Short or multiple runs on archival cotton rag, artist’s canvas and specialist papers. Fine Art Supplies Bespoke framing and canvas stretching. W www.parkersartsupplies.com Darlinghurst: Building 22, National Art School, Cnr Forbes and Burton streets, Darlinghurst NSW 2010. Art Hunter T (02) 9339-8706. E [email protected] T 0404-434-008. E [email protected] The Rocks: 3 Cambridge Street, The Rocks NSW W www.arthunter.com.au Art Hunter moves art, 2000. T (02) 9252-3706. quickly and safely offering affordable rates, regional E [email protected] and interstate delivery, seven days, and at short notice. Art installation. See ad page 112. Art & Industry 69 Art on the Move Fine Art Restoration T 0410-337-223. Affordable art couriers for Western T 0415-482-686. E [email protected] Victoria, Melbourne, Sydney and Adelaide. Up to: W www.laetitiawojtas.com Laetitia Wojtas professional 35cm $30, 60cm $35, 1 metre $45, 2 metres $60. painting restoration in Sydney. Specialising in modern and contemporary art. Contact for a free quote. Art Production Services See ad page 73. T 0404-280-768. E [email protected] Fitzroy Stretches W www.artproductionservices.com 63 Weston Street, Brunswick VIC 3056. On-Site art documentation for print, publication and T (03) 9380-9553. E [email protected] archive. Sydney, NSW and ACT. W www.fitzroystretches.com Framing, stretching and printing. Fine art printing on rag paper and canvas. Art. Van. Go. Sydney All our prints are exhibition-quality and archival to museum standards. T 0404-027-445. W www.artvango.com.au Affordable, professional fine art transport for galleries, artists, framers and you in Sydney and NSW. Gianna Rosica Accounting for the Arts Artist Moving Artists T (03) 9428-3855. E [email protected] Melbourne W www.giannarosica.com.au Chartered accountants specialising in the taxation and accounting needs of T 0437-214-402. E [email protected] the arts community. See ad page 109. W www.artistmovingartists.com.au Art courier Melbourne and regional Victoria. Affordable prices. See ad page 109. IAS – International Art Services W www.iasdas.com.au Sydney: (02) 9667-1077, Arts Accountant & Valuer Melbourne: (03) 9329-6262, Brisbane: (07) 3890-7422, Michael Fox Canberra: (02) 6232-9773, Perth: (08) 9249-5376. 79 Langridge Street, Collingwood 3066. Fine Art Logistics. T (03) 8560-3583. E [email protected] W www.foxmichael.com.au H Tues-Sat 10.00 to 6.00. Michael Fox offers specialist tax advice to ǯ creative professionals. Registered with the Australian ǡ Tax Practitioners Board. 488 Mount Alexander Road, Ascot Vale VIC 3020. T (03) 9370-5744. W www.kosnar.com.au Artward Bound We offer a large range of frame styles for the artist and collector. Expert advice in framing design for all types T 0418-545-834. E [email protected] of artwork. W www.artwardbound.com.au Art hanging systems/ art installation. Police and working with children check provided. Lupo Bianco Photography and Design Belgrave Creative Space T 0439-675-240. E [email protected] 1658a Burwood Highway, Belgrave 3160. W www.lupobianco.com.au Documentation of all T 0425-831-425. W www.belgravecreativespace. kinds of artworks. See ad page 83. com Space for hire: workshops, forums, exhibitions, classes, private tuition, performances, rehearsals and Mal Wood Foundry art projects. 6 Kurnai Avenue, Reservoir VIC 3073. T (03) 9462-3793. E [email protected] Chapman & Bailey W www.malwood.com.au 420 Johnston Street, Abbotsford VIC 3067. T (03) 9417-0500. E [email protected] Omnus Framing W www.chapmanbailey.com.au Custom 409 Gore Street, Fitzroy VIC 3065. framing,stretchers/stretching. Australia’s most T (03) 9419-2226. E [email protected] comprehensive professional art service. Best-quality W www.omnusframing.com.au H Mon-Fri 9.30 artists materials, linens and stretchers. to 5.30, Sat 10.00 to 5.00. Archival framing – specialising in works on paper and beautifully hand- crafted, sustainably-grown timber frames. See ad page 111. 70 Art & Industry Parkers Framing Works Stella Downer 69 Renwick Street, Redfern NSW 2016. ǡǡ T (02) 9698-8591. E [email protected] T 0402-018-283. E [email protected] W www.parkersartsupplies.com W www.stelladownerfineart.com.au H Tues-Fri 10.00 to 5.00, Sat 11.00 to 5.00, or by appt at Picture Hanging Systems Stella Downer Fine Art 1/24 Wellington Street, T 1300-883-645. Waterloo, 2017. Approved valuer for the Australian E [email protected] Government Cultural Gifts Program. Insurance/market W www.picturehangingsystems.com.au value, authentication, consulting and collection Manufacture, supply and installation of modern management. discreet picture hanging systems. Effortless art installation. Australia-wide. Print 2 Metal Member T (03) 9571-2600. E [email protected] W www.print2metal.com Award-winning Print 2 Organisations Metal specialises in the printing of photos, artwork and graphics onto metal. Five surfaces available. Art Gallery of New South Wales The Sydney Canvas Company (AGNSW) 9/79 Station Road, Seven Hills NSW 2147. T (02) 9225-1664. W www.artgallery.nsw.gov.au/ T (02) 8854-5070. W www.tsccaus.com.au members Call or visit the website for information Handmade custom stretched canvases. about gallery membership; discounts, free exhibition We stretch existing artwork of any size. viewings, magazine and over than 400 lectures, workshops and other events each year. artsHub Australia Consultants W www.artshub.com.au ArtsHub is a critical resource for Australia’s arts sector of daily news bulletins, & Valuers reviews and interviews for creative professionals and art enthusiasts. Louise Smith Fine Art Copyright Agency | Viscopy Melbourne T 1800-066-844 (toll free). W www.copyright.com.au T 0418-519-747. E [email protected] Copyright Agency | Viscopy are not-for-profit rights W louisesmithfineart.com.au Approved valuer management organisations and collection societies. Australian Government Cultural Gifts Program and We enable the use of text and images in return for fair member Art Consultants Association Australia. With payment to visual artists, writers and publishers. over 30 years’ experience. National Association Noël Stott of Adam Galleries for the Visual Arts (NAVA) Fine Art Valuer of Australian T (02) 9368-1900. E [email protected] and European Art W www.visualarts.net.au NAVA is the peak body T 0407-338-538. E [email protected] representing and advancing the professional interests W www.adamgalleries.com Paintings, drawings, of the Australian visual arts, craft and design sector. graphics, sculpture and photography. Fine art consultant and approved valuer for the Australian The Print Council of Australia Cultural Gifts Program. Member of Art Consultants (PCA) Association of Australia. Over 30 years experience. W www.printcouncil.org.au A national not-for-profit member organisation that promotes contemporary Private View Art Collections Australian fine art printmaking and print media, T 0409-505-628. E [email protected] including artist books, zines and works on paper, and W www.privateviewart.com Private and corporate provides support and advocacy for artists. Through collection development and advice. Offering publications, commissioned editions, exhibitions and assistance with sourcing, framing, conserving, other events we work to foster a greater appreciation and investing in art, with an extensive range of of original prints and a knowledge of the history specialist networks. of Australian printmaking amongst our members, collectors and the wider community. 72 Art & Industry Resale Royalty Bayside Sculpture & Gallery T 1800-066-844 (toll free). 16B Advantage Road, Highett 3190. T (03) 9553- W www.resaleroyalty.org.au Copyright Agency has 0661. W www.baysidesculpture.com.au H Daily been appointed by the Australian Government to 11.00 to 5.00. Term 4: eight-week sculpture classes manage the resale royalty scheme, which pays a beginning Oct 15, 16 and 17. share from eligible resales of artworks to artists. Hands On Studio Art Classes Royal Queensland Art Society W www.catholiccarechoices.org.au Hands On Studio Unit 3, 162 Petrie Terrace, Brisbane QLD 4000. is a creative and inclusive art space that provides T (07) 3367-1977. E [email protected] people with disabilities access to art education and W www.rqas.com.au/rqas-membership The Royal facilities at the M16 studio and gallery complex Queensland Art Society Brisbane Branch welcomes in Griffith. Classes include painting, drawing, all artists covering a diverse range of media. Social, printmaking, mixed media and clay. Contact Catholic Country, and Family memberships welcomed. Care Choices (02) 6295-4300, or visit website. Networking and social events, exhibition opportunities at Petrie Terrace Gallery and workshops. ǦǦ T (02) 9424-0310. W www.kmc.nsw.gov.au/artcentre Visual art, guitar, creative writing classes. Exhibitions/ events. Day, night and weekend classes available. Training Adult, children, teens. Beginner to advanced welcome. Facebook @kuringgaiartcentre Abstract Workshop MAS Gallery & Studio T 0491-119-405. W www.laurentgallery.com Laurent Gallery: Sept Sat 15, 9am-12pm and Sun 16, 1-5pm Art Classes 4 Steps to Conceptual Abstract with Titane Laurent. 1297-1299 High Street, Malvern VIC 3144. Fee $200. All inclusive. T (03) 9822-7813. E [email protected] W www.malvernartists.org.au Art classes including: Art Intensive: Workshops life drawing, oils, acrylics, drawing, watercolour, mixed media and open studio. Beginners and all Qdos Arts Lorne levels invited. T (03) 5289-1989. W www.qdosarts.com Sept 25, 26 and 27, Graeme Altmann – Oil Painting on Paper. Melbourne Sculpture School Oct 9, 10 and 11, Phil Doggett-Williams – QDOS T Drawing Intensive: Technique, Process and Invention. 0407-509-758. W Oct 13, David Long – Dry Stone walling as sculpture www.melbournesculptureschool.com or plinth. Oct 20 and 21, Jock Clutterbuck – Drawing Sat mornings – Life Modelling, Mould Making and with the Mind’s Eye. Oct 27 and 28, Dianne Longley Bronze Casting. Thurs evenings – Design, Mould and – Encaustic Workshop. Oct 30 and 31, and Nov 1, Foundry. Sat afternoons – Introduction to Sculpture. Rimona Kedem – Conservations with Self. Beginners welcome. Nov 13, 14 and 15, Shona Wilson – Collaborations with Nature. For all Workshop details please call Qdos Arts or visit website. See ad page 121. The Art Room 125 Hyde Street, Footscray VIC 3011. T 0407-197-106. W www.the-art-room.com.au An art class, studio workshop and all round creative hub in the Inner West of Melbourne. ARTCLASSCO Art Classes in Fitzroy Melbourne W www.artclassco.com Visual artist Jacqui Stockdale offers Short Courses and Masterclasses for all levels. Painting, drawing, collage and mentoring. Art & Industry 73 Melbourne Studio of Art Broadsheet Journal 544 Glen Huntly Road, Elsternwick 3185. W www.cacsa.org.au Essays and reviews on T (03) 9528-3392. E [email protected] contemporary art practice supporting critical thinking. W studyart.com.au Sept 17 to 21 ‘Spring Figure Painting Intensive’. This intensive program will teach Discipline students how to paint classical figures in a realistic W www.discipline.net.au Discipline is a contemporary manner. See ad page 105. art journal publishing artist pages and interviews, research essays on contemporary Australian art, and Warringah Printmakers Studio histories and theories of contemporary art as a global Cnr Condamine and Lovett streets (entry on industry or phenomenon. Condamine Street), Manly Vale NSW 2093. W www.printstudio.org.au Sept 29 and 30 Dissect journal Relief in Layers (jigsaw linocuts) with Diane Fogwell. W www.dissectjournal.com An independent Workshops and weekly printmaking classes available. contemporary art publication with a focus on art Please see website for details. Bookings: susan@ and artists, and explores writing, editing, design and printstudio.org.au Sept 15 and 16, 10am-3.30pm publishing as artistic practice. POP UP SALE exhibition of prints from members of Warringah Printmakers Studio. eyeline T (07) 3138-5521. E [email protected] W www.eyelinepublishing.com Contemporary visual arts magazine. Get free access to the eyeline digital Art archive when you subscribe. See ad page 155. Publications Imprint W www.printcouncil.org.au The quarterly journal of Art + Australia the Print Council of Australia Inc. Subscribe now. See ad page 174. W www.artandaustralia.com Art + Australia is a publishing and research body that focuses on contemporary art and its relationship to broader Museum theoretical, social and geo-political contexts. W www.museum-magazine.com Museum is a magazine investigating contemporary art, fashion Art Almanac and photojournalism. W www.art-almanac.com.au Australia’s monthly guide to galleries, news and awards. See ad page 75. Oberon W www.oberonmagazine.com Oberon is a periodical Art Monthly on art in the world. W www.artmonthly.org.au/subscribe Visual arts essays, reviews and options – Australia, New Zealand Pollen and the Asia-Pacific region. W www.pollenmagazine.com In each issue POLLEN takes a theme from philosophy and explores it ϐ through a collision of photography, fiction, essay, poetry and more. W www.artasiapacific.com ArtAsiaPacific magazine is the leading English-language periodical covering contemporary art and culture from the Middle East Runway and Asia-Pacific. W www.runway.org.au Runway is an independent Australian experimental art journal run by a collective The Article of Sydney-based and internationally-based artists, writers and curators. W thearticle.com.au The Article is a new forum for Australian and International cultural debate, reviews and features by professional writers. un Magazine W www.unprojects.org.au Projects publishes essays, ϐ artists’ work and reviews with a focus on artists, writers, artist-run initiatives and independent projects. W www.artistprofile.com.au The artists behind the art. Artist interviews, essays, reviews, news. Vault Artlink W www.vaultart.com.au New Art & Culture Magazine. W www.artlink.com.au Contemporary art of Australia and the Asia-Pacific. Online reviews and archive. 74 Art & Industry Subscribe 11 issues for $59 Huge savings on the cover price Free delivery to your door Never miss an issue artalmanac.com.au mymagazines.com.au Call 1300 361 146 or +61 2 9901 6111 for international callers Gallery Index 77 A - C Aboriginal & Pacific Art 132 Ballarat – Gallery on Sturt 118 Academy Gallery 163 Bank Art Museum Moree 150 ACE Open 165 BAROMETER Gallery 142 Adelaide Central Gallery 165 Barossa Regional Gallery 167 AIRspace Projects 134 Bathurst Regional Art Gallery 154 Alcaston Gallery 94 Bayside Sculpture 107 Alternating Current Art Space 102 Beaver Galleries 158 ANCA Gallery 157 Bega Valley Regional Gallery 151 Andrew Baker Art Dealer 177 Belalie Art Gallery 167 Anna Schwartz Gallery 86 Belconnen Arts Centre 159 Annandale Galleries 134 Belgrave Creative Space 107 Anne & Gordon Samstag Museum of Art 165 Benalla Art Gallery 119 Annette Larkin Fine Art 140 Bendigo Art Gallery 118 Anthea Polson Art 179 Bett Gallery Hobart 161 ANU Drill Hall Gallery 158 Biennial of Australian Art 119 ANU School of Art Gallery 158 Bijou Gallery 117 APY Gallery 126 BlackCat Gallery 95 Araluen Arts Centre 175 Blacktown Arts Centre 145 Ararat Gallery TAMA 118 Blarney Books & Art 117 ARC ONE Gallery 86 Blender Gallery 142 arc Yinnar Gallery 116 BLINDSIDE 86 ARO 126 Blue Mountains City Art Gallery 152 Art at Linden Gate 107 Bolin Bolin Gallery 108 Art at St Francis 83 Boomalli Aboriginal Artists Co-operative 135 Art Atrium 140 Bowral Art Gallery 151 Art Gallery of Ballarat 118 Box Hill Community Arts Centre 108 Art Gallery of New South Wales 123 Bradley Hall Antiques & Art Gallery 120 Art Gallery of South Australia 166 Brett Whiteley Studio 132 Art Gallery of Western Australia 170 Bridget McDonnell Gallery 92 Art Mob 161 Brightspace 103 The Art of Dr. Seuss 83, 123 Broken Hill Regional Art Gallery 154 Artarmon Galleries 136 Brunswick Street Gallery 95 Artback NT 175 Bunbury Regional Art Gallery 172 Artbank 103, 132 Bundaberg Regional Galleries 180 Artereal Gallery 135 Bundeena Maianbar Art Trail 145 Arthouse Gallery 127 Bundoora Homestead Art Centre 108 Articulate project space 135 Buratti Fine Art 171 Artitja Fine Art 169 Burnie Regional Art Gallery 163 Arts Academy, Post Office Gallery 118 Burra Regional Art Gallery 167 Arts Project Australia 100 Burrinja Gallery 108 Artsite Galleries 135 Buxton Contemporary 90 Artspace 127 Cairns Art Gallery 180 ArtSpace at Realm 107 Cambridge Studio Gallery 95 Artspace Mackay 180 Campbelltown Arts Centre 145 ArtSpace Wonthaggi 116 Canberra Contemporary Art Space, Gorman Arts Centre 157 Ascot Theatre Gallery 167 Canberra Contemporary Art Space, Manuka 158 Australian By Design 83 Canberra Glassworks 158 Australian Centre for Contemporary Art 88 Canberra Museum and Gallery 157 Australian Centre for Photography 127 Carlisle Street Arts Space 103 Australian Centre for the Moving Image 83 Castlemaine Art Museum 119 Australian Design Centre 127 Casula Powerhouse Arts Centre 146 Australian Galleries 95, 142 Cement Fondu 142 Australian Print Workshop 95 Central Goldfields Art Gallery 119 Australian Tapestry Workshop 90 Ceramic Break Sculpture Park 154 78 Gallery Index C - J Chapman & Bailey Gallery 95 Gaffa Gallery 123 Chapter House Lane 86 GAGPROJECTS | Greenaway Art Gallery 166 Charles Darwin University Art Gallery 174 Galerie pompom 126 Charles Nodrum Gallery 101 The Gallery at Bayside Arts & Cultural Centre 103 Coffs Harbour Regional Gallery 150 Gallery 139 149 Collingwood Gallery 95 Gallery 360 171 Colville Gallery 161 Gallery 9 128 The Commercial 126 Gallery at HOTA 179 Contemporary Art Awards Exhibitions 177 GalleryONE88 Fine Arts 153 Contemporary Art Society of Victoria Inc. 101 Gallerysmith 92 Contemporary Art Tasmania 162 Gate 6 Gallery 110 Contour 556 157 Gecko Studio Gallery 116 Cool Change Contemporary 170 Gee Lee-Wik Doleen Gallery 110 Counihan Gallery In Brunswick 100 Geelong Gallery 117 Cowra Regional Art Gallery 154 Geelong Library and Heritage Centre (The Dome) 117 Craft Victoria 86 George Paton Gallery 92 Craft ACT 157 Geraldton Regional Art Gallery 172 The Cross Art Projects 128 Gippsland Art Gallery 116 The Cullen 102 Glass Artists’ Gallery 135 Davson Gallery 180 Glen Eira City Council Gallery 106 The Dax Centre 92 The Goat Gallery 119 Gordon Studio Glassblowers 115 Deakin University Art Gallery 108 Gosford Regional Gallery 149 Deakin University Burwood Library Gallery Space 108 Goulburn Regional Art Gallery 154 Defiance Gallery 132, 135 Grace Cossington Smith Gallery 136 Defiance Gallery at Mary Place 142 Grafton Regional Gallery 150 Despard Gallery 161 Graydon Gallery 177 Devonport Regional Gallery 163 Griffith Regional Art Gallery 154 Dogwood Crossing, Miles 180 Handmark Gallery 161 Duck Print Fine Art 151 Harvey Galleries 136 Duldig Studio 103 Hawthorn Studio & Gallery 106 East & West Art 106 Hazelhurst Regional Gallery & Arts Centre 146 Eastgate Gallery 106 Headland Artists and Sculpture Park 138 Edwina Corlette Gallery 177 Heartland Studio 166 Elizabeth Arthur Fine Art Gallery & Sculpture Garden 117 Heathcote Museum and Gallery 169 Eltham Library Community Gallery 110 Heide Museum of Modern Art 110 Factory 49 135 The Henry Jones Art Hotel 161 Falkner Gallery 119 Heritage Hill Museum and Gardens 110 Fellia Melas Gallery 142 HIDDEN: Rookwood Cemetery Sculpture Walk 146 FELTspace 166 Horsham Regional Art Gallery 119 Fine Arts, Sydney 128 Hugo Michell Gallery 166 Firestation Print Studio Gallery 104 Hurstville Museum and Gallery 146 FireWorks Gallery 177 The Ian Potter Museum of Art 94 Firstdraft 128 in.cube8r gallery & emporium 98 Flinders Lane Gallery 88 Incinerator Art Space 138 Flinders Street Gallery 132 Incinerator Gallery 110 fortyfivedownstairs 88 Islamic Museum of Australia 100 4A Centre for Contemporary Asian Art 126 Jahroc Galleries 172 Fox Galleries 95 JamFactory 166, 167 Fox Jensen Gallery 142 Jan Manton Art 177 Frances Keevil Gallery 128 Jan Murphy Gallery 178 Frankston Arts Centre and Cube 37 Galleries 115 Japingka Gallery 169 Fremantle Arts Centre 169 Jervis Bay Maritime Museum & Gallery 151 Gab Titui Cultural Centre 180 Joel Gallery 110 Gallery Index 79 J - P John Curtin Gallery 172 Merricks House Art Gallery 115 The Justin Art House Museum 102 Metropolis Gallery 117 Kapunda Community Gallery 167 Michael Reid Sydney 134 Kate Owen Gallery 135 Mildura Arts Centre 119 The Ken Done Gallery 123 Millicent Gallery 167 Kerrie Lowe Gallery 136 Mitchell Fine Art 178 Kerrie Warren, Artist & Pilgrim Creek Studios 120 Modern Times 98 Kerry Packer Civic Gallery 166 Mona – Museum of Old and New Art 161 KickArts Contemporary Arts 180 Monash Gallery of Art 112 King Street Gallery on William 128 MONDO ART 119 Koorie Heritage Trust 83 Montalto Sculpture park 115 Korean Cultural Centre Australia Gallery 123 Montville Art Gallery 179 Kosnar’s Picture Framing 110 Moores Building Contemporary Art Gallery 169 Kudos Gallery 142 Mornington Peninsula Regional Gallery 112 La Trobe Art Institute 119 Mosman Art Gallery 140 Lake Macquarie City Art Gallery 149 Mu Studio Gallery 140 Langford 120 94 Mundaring Arts Centre 172 The Larwill Studio 94 Museum and Art Gallery of the Northern Territory 174 Latrobe Regional Gallery 116 Museum of Brisbane 178 Lauraine Diggins Fine Art 107 Museum of Contemporary Art Australia 123 Lawrence Wilson Art Gallery 171 Museum of Sydney 124 Lesley Kehoe Galleries 83 Muswellbrook Regional Arts Centre 151 Linden New Art 102 Nancy Sever Gallery 157 Linton & Kay Galleries 171, 172 NAS Gallery 128 Lismore Regional Art Gallery 150 National Association for the Visual Arts 130 Liverpool Street Gallery 128 National Gallery of Australia 159 The Lock Up 149 National Gallery of Victoria 83, 90 Lorraine Pilgrim Gallery 179 National Library of Australia 159 Lost Bear Gallery 153 National Portrait Gallery 159 Lynn Jaanz Art Gallery 90 Neon Parc 83 M16 Artspace 158 New England Regional Art Museum 154 m2 Gallery 132 Newcastle Art Gallery 149 Macquarie University Art Gallery 146 Nexus Community Gallery 151 MADA Gallery 107 Niagara Galleries 101 Maffra Exhibition Space 116 Nicholas Thompson Gallery 98 Maitland Regional Art Gallery 149 Nishi Gallery 158 Murray Art Museum Albury 154 Nolan on Lovel Gallery 153 Manly Art Gallery & Museum 138 Noosa Regional Gallery 179 Manning Regional Art Gallery 150 Norman Lindsay Gallery & Museum 153 Manningham Art Gallery 112 Northern Centre for Contemporary Art 175 March Space 107 Nyisztor Studio 172 Margaret Lawrence Gallery 90 Oak Hill Gallery 115 Margaret River Gallery 172 The Olsen 102 Margaret Whitlam Galleries, Female Orphan School 146 Olsen Gallery 144 Margot Hardy Gallery 146 Orange Regional Gallery 154 Maroondah Access Gallery 112 Outstation Gallery 175 Martin Browne Contemporary 144 Paddington Art Prize 145 MAS Gallery 104 Pan Pacific Melbourne 84 Maunsell Wickes Gallery 144 Parramatta Artists Studios 146 MAY SPACE 132 Peacock Gallery and Auburn Arts Studio 147 McClelland Sculpture Park + Gallery 115 Penrith Regional Gallery & The Lewers Bequest 147 McGlade Gallery at the Australian Catholic University 136 Performance Space 126 McOnie Gallery 144 Perth Institute of Contemporary Arts 170 Megalo Print Studio + Gallery 159 Petrie Terrace Gallery 178 80 Gallery Index P - Z Phil Henshall Studio 120 Suki & Hugh Gallery 154 Philip Bacon Galleries 178 Sullivan+Strumpf 134 Pilbara Creative & Cultural Forum 172 Suzanne O’Connell Gallery 179 Plimsoll Gallery 162 Swan Hill Regional Art Gallery 120 Port Hedland Courthouse Gallery 172 Sydney Contemporary 126 Port Jackson Press Print Gallery 98 Sydney Road Gallery 140 Port Pirie Regional Art Gallery 167 Sydney Sculpture Conference 124 Post Office Gallery 119 Tacit Galleries 98 PROJECT [504] 140 Tactile Arts 175 Project Gallery 90 144 Tandanya 167 Qdos Arts + Sculpture Park 117 TarraWarra Museum of Art 113 Quadrant Gallery 106 Tasmanian Museum and Art Gallery 162 Queen Victoria Museum & Art Gallery 163 Ten Cubed 104 Queensland Art Gallery | Gallery of Modern Art 178 Thienny Lee Gallery 145 QUT Art Museum 179 Tinning Street Presents 100 red gallery 98 Tolarno Galleries 86 Red Tree Gallery Jindivick 120 Toowoomba Regional Art Gallery 180 Redland Art Gallery 179 Town Hall Gallery 106 Retrospect Galleries 151 Tributary Projects 159 Rex-Livingston Art + Objects 153 The University Gallery and Senta Taft-Hendry Museum 149 RMIT Gallery 84 University of Queensland Art Museum 179 RMIT Project Space / Spare Room 94 UNSW Galleries 130 Robin Gibson Gallery 130 Utopia Art Sydney 134 Roslyn Oxley9 Gallery 144 UTS Gallery 126 Sabbia Gallery 144 Vermilion Contemporary Chinese Art 124 Saint Cloche 144 Victorian Artists’ Society 98 Salamanca Arts Centre 162 Vivien Anderson Gallery 103 Sarah Scout Presents 86 Wagner Contemporary 145 SASA Gallery 167 Wagner Framemakers 162 Sawtooth ARI 163 Walker Street Gallery & Arts Centre 113 SCA Galleries 136 Wangaratta Art Gallery 120 SCOPE Galleries 117 Wanneroo Gallery 170 Scott Livesey Galleries 104 Warringah Printmakers Studio 140 S.H. Ervin Gallery 124 Warrnambool Art Gallery 117 Sheffer Gallery 126 Watch This Space ARI 175 Shepparton Art Museum 120 Watt Space 150 The Shop Gallery 136 Watters Gallery 130 Sister Gallery 167 West End Art Space 86 Siteworks 152 Western Plains Cultural Centre 155 Soho Waterloo 134 Western Sydney University Art Gallery 147 SOMA Gallery 100 Whistlewood Gallery | Contemporary Australian Art 115 Southern Buoy Studios 115 White Rabbit Gallery 126 Space2b Artspace 103 Whitehorse Artspace 113 STACKS Projects 130 William Holt Gallery 92 Stanley Street Gallery 130 William Mora Galleries 101 State Library of NSW 124 Wishart Gallery 117 State Library of South Australia 167 Wollongong Art Gallery 152 STATION 102 Women’s Art Register 1975-2015 101 Stella Downer Fine Art 134 The Woollahra Small Sculpture Prize 145 Stephen McLaughlan Gallery 88 Yandina Historic House 179 Steps Gallery 94 Yarra Ranges Regional Museum 113 Stirato Gallery 159 Yarra Sculpture Gallery 98 Strathnairn Arts 159 Yellow Dot Art Gallery 136 Studio B Gallery 103 Yering Station Art Gallery 113 Sturt Gallery & Studios 151 Yuill/Crowley 132 Gallery Index 81 Melbourne 82 Australian Centre for the Federation Moving Image (ACMI) Federation Square, Flinders Street, Melbourne 3000. Square T (03) 8663-2200. W www.acmi.net.au H Daily 10.00 to 5.00. CBD Koorie Heritage Trust Yarra Building, Federation Square, Melbourne 3000. T (03) 8622-2600. E [email protected] Art at St Francis W www.koorieheritagetrust.com CEO Tom Mosby. Contemporary Art H Daily 10.00 to 5.00. To Sept 30 Blak Design Matters – Aarli, Arkie Barton, Babbarra Women’s 326 Lonsdale Street, Melbourne 3000. Centre, Balarinji Designs, Maree Clarke, Gilimbaa T (03) 9663-2495. E [email protected] Designs, Carroll Go-Sam, Jefa Greenaway, Haus of Contact: Brigitte Remmen. H Mon-Fri 9.00 to 5.00, Dizzy, Paul Herzich, Injalak Arts, Dillon Kombumerri, Sun 9.00 to 3.00. Sept 11 to Oct 9 The Other Francoise Lane, Grace Lillian Lee, Marcus Lee, MI Shore by Rebekah Stuart – exploring painting and Arts, Nicole Monks and Lyn-Al Young – a national photography to examine counterpoints between survey of Contemporary Indigenous Design, curated timeless realms of Human and Nature. by Jefa Greenaway. See ad page 9. The Art of Dr. Seuss Lesley Kehoe Galleries presented by Harvey Galleries, Ground Floor, 101 Collins Street, Melbourne 3000. Block Arcade T (03) 9671-4311. E [email protected] The Block Arcade, 19-18/282 Collins Street, W www.kehoe.com.au H Open by appt. To make an Melbourne 3000. appointment, or request an invite to 2018 viewings E [email protected] and events email, or call the gallery. Lesley Kehoe W www.harveygalleries.com.au H Mon-Thurs 10.00 Galleries is an internationally recognised gallery for to 6.00, Fri 10.00 to 7.00, Sat 10.00 to 6.00, contemporary and historical Japanese artworks. Sun 10.00 to 5.00. Authorised editions from the The Galleries provide visitors with an immersive Seuss Estate. experience underpinned by beauty and intellect. Australian By Design National Gallery of Victoria Room 303e, 3rd Floor, Lift 1 opposite The Hopetoun The Ian Potter Centre: Tea Rooms, The Block Arcade, 282 Collins Street, NGV Australia Melbourne 3000. T (03) 9663-9883, Federation Square, cnr Russell and Flinders streets, Terrence 0404-699-033. Melbourne 3000. T (03) 8620-2222. E [email protected] W www.ngv.vic.gov.au H Daily 10.00 to 5.00. W www.australianbydesign.com.au H Open daily. Sept 28 to March 24, 2019 Hito Steyerl: Factory of the Sun. Also, Designing Women. To Sept 30 Colony: Frontier Wars. To Jan 28, 2019 Baldessin / Whiteley: Parallel Visions. To Feb, 2019 Design Storytellers: The Work Of Broached Commissions. Sept 14 to Feb 17, 2019 Ken Unsworth: Truly, Madly. Sept 28 to Feb 3, 2019 Polly Borland: Polyverse. Neon Parc 1/53 Bourke Street, Melbourne 3000. T (03) 9663-0911, Also at 15 Tinning Street, Brunswick 3056. E [email protected] W www.neonparc.com.au H Wed-Sat 12.00 to 5.00, or by appt. Sept 7 to Oct 20 Swamp Anatomy by Jamie North. Melbourne 83 ϐ RMIT Gallery 2 Convention Centre Place, South Wharf 3000. Free 344 Swanston Street, Melbourne 3000. entry. H Open daily/nightly. To Oct 4 HIDDEN FACES: T (03) 9925-1717. E [email protected] The 2018 Victorian Salon des Refusés – a curated W www.rmit.edu.au/rmitgallery Free admission. selection of portraits by Victorian artists submitted for Lift access. H Mon-Fri 11.00 to 5.00, Thurs national portrait prizes, but not hung in the official 11.00 to 7.00, Sat 12.00 to 5.00, closed Sun exhibitions. Jacqueline Taylor OAM, and public hols. Like RMIT Gallery on Facebook. Exhibition Manager/Curator 0418-357-814 Follow @RMITGallery on Twitter. Sept 14 to Nov 17 [email protected] Dynamics of Air – capturing the beauty, dynamics Preview the works here youtu.be/ric4WMSG70M and sensuality of air in our built environment and its critical role in designing for a zero carbon future, Dynamics of Air features specially commissioned works that explore radical innovations for creative sustainability. Artists and designers – Transsolar, Friederich von Borries and Edith Kollath (Germany), Breathe Earth Collective (Austria), Philippe Rahm (Switzerland/France), Enric Ruiz Geli (Spain), Little Wonder (USA), and from Australia; Natasha John- Messenger, Cameron Robbins, Chris Cottrell, Simon Watkins and Phred Petersen. Public programs: Fri Sept 14, 12.30-1.30pm Climate & design German guests Thomas Auer (Transsolar) and Edith Kollath (artist) in conversation with curator Malte Wagenfeld. Sat Sept 15, 2-3pm Hybrid Forests Breathe Earth Collective (Austria), Natural ecosystems and built environments. Public talk: Tues Oct 9, 12.30-1.30pm Scientific Photography Phred Petersen. Artist talk: Thurs Oct 11, 5.30-6.30pm Speak Percussion Polar Force (Eugene Ughetti and Philip Samartzis). Performance and talk: Thurs Oct 18, 5.30-6.30pm Drones & biomimicry Simon Watkins. Micro Flight Jaq Grantford, Lior, oil on canvas Vehicle Performance: Thurs Oct 25, 5.30-6.30pm Courtesy the artist and Pan Pacific Melbourne White Clouds of Sugar Mikael Mikael & Friedrich von Borries. Performance and artist talk: Thurs Nov 1, 5.30-6.30pm Explorations of Air Malte Wagenfeld and Jane Burry. Curator’s talk: Thurs Nov 8, 6-7.30pm Wind generated drawing systems Cameron Robbins in conversation with Malte Wagenfeld and Jan van Schaik. See ad page 4. Raelene Sharp, Self Portrait – A time in My Life, oil on linen Courtesy the artist and Pan Pacific Melbourne Transsolar, Testing Cloudscapes Courtesy Transsolar and RMIT Gallery 84 Melbourne Marco Luccio painting from the Chrysler Building, overlooking Manhattan and the Empire State Building. Photo: Sina Basila MARCO LUCCIO MANHATTAN DREAMING PAINTINGS & PRINTS OF NEW YORK 25 Sep – 20 Oct 2018 New York Stories - Artist Talk: Sat 6 Oct 11am - 1pm Free events. Bookings essential as places are limited. Please see full events calendar on website. Instagram @marcoluccioartist www.marcoluccio.com.au Sarah Scout Presents BLINDSIDE Level 1, 12 Collins Street, Melbourne 3000. Nicholas Building, 714/37 Swanston Street (enter via T (03) 9654-4429. E [email protected] Cathedral Arcade lifts, cnr Flinders Lane), Melbourne W www.sarahscoutpresents.com Directors: Kate 3000. T (03) 9650-0093. E [email protected] Barber and Vikki McInnes. H Winter opening hours W www.blindside.org.au H Tues-Sat 12.00 to 6.00. Thurs-Sat 12.00 to 5.00. All Day And All Night To Sept 8 Presence – Anna Horne, Archie Barry, created by Sandra Parker and Rhian Hinkley – Holly Bates, Isabella Hone-Saunders, Lou Fourie Sound: David Franzke. With performers Deanne and Zoë Bastin. Curated by Brigid Hansen and Zoë Butterworth and Melissa Jones. Performance times: Bastin. Sept 13 to 29 BLINDSIDE First Nations Fri Aug 31, 5.30-7.30pm. Sat Sept 1, 12-5pm. Project: All of Us – Liam Benson + Adorned, Jodie Thurs 6 Sept, 12-5pm. Fri Sept 7, 12-5pm. Sat Haynes, Karen Casey, Teresa Hseih, Mitch and Molly Sept 8, 12-5pm. Free admission. Sept 15 to Oct 14 Mahoney and Justine Youssef. (opening Fri Sept 14, 5.30pm) The Waiting Room by Kate Daw and Stewart Russell. Tolarno Galleries Level 4, 104 Exhibition Street, Melbourne 3000. T (03) 9654-6000 F 9654-7000. E [email protected] W www.tolarnogalleries.com Director: Jan Minchin (member of ACGA). H Tues-Fri 10.00 to 5.00, Sat 1.00 to 5.00. To Sept 29 The Landspace: [all the debils are here] by Danie Mellor. West End Art Space 175-185 Rosslyn Street, Melbourne 3003. Adorned – Wisdom, Memory and Song (video stills), L-R: Tacheen T 0415-243-917. E [email protected] Stuart, Hilin Kazemi, Susan Ling Young and Kathryn Yuen, 2017 W www.westendartspace.com.au H Wed-Fi 11.00 Photograph: Vera Hong and Craig Bender to 4.00, Sat 10.00 to 3.00. Sept 1 to 29 (opening Courtesy the artists and BLINDSIDE Sat Sept 1, 2-4pm) The Way We See Ourselves – a group show by ten Sydney artists – Jen Ahmad, Chapter House Lane Gemma Avery, Michelle Cawthorn, Louisa Chircop, Entry via Flinders Lane, Melbourne 3000. Julia Flanagan, Nicole Kelly, Caterina Leone, Kiata W www.chapterhouselane.org.au Sept 6 to Oct 27 Mason, Clare Thackway and Isabelle Wood. Curated (opening Fri Sept 6, 6–8pm) Sucking Breath, Jolly by Caitlin Casey. See ad page 94. Lolly by Rafaella McDonald. Craft Victoria Watson Place, off Flinders Lane behind Supernormal, Flinders Lane Melbourne 3000. T (03) 9650-7775. E [email protected] W www.craft.org.au Anna Schwartz Gallery Free entry. H Mon-Wed 11.00 to 6.00, Thurs-Fri 11.00 to 7.00, Sat 10.00 to 5.00. 185 Flinders Lane, Melbourne 3000. T (03) 9654-6131. E [email protected] W www.annaschwartzgallery.com Director: Anna Schwartz. H Tues-Fri 12.00 to 5.00, Sat 1.00 to 5.00. ARC ONE Gallery 45 Flinders Lane, Melbourne 3000. T (03) 9650-0589. E [email protected] W arcone.com.au Directors: Fran Clark and Suzanne Hampel (member of ACGA). H Tues-Sat 11.00 to 5.00. Sept 4 to Oct 6 Joy Knows No Mercy by Imants Tillers. 86 Melbourne A question, an uncertain answer, a photo exhibition Blank Image Lei Zheng Opening: 3:00 pm 15.9.2018 Duration: 15.9.18 ~ 20.10.18 MARCH SPACE GALLERY, MELBOURNE 5 Waltham Street, Sandringham VIC 3191 0413 685 488 [email protected] @march_space @marchspacegallery Flinders Lane Gallery 137 Flinders Lane, Melbourne 3000. Southbank T (03) 9654-3332. E [email protected] W www.flg.com.au Director: Claire Harris. H Tues-Fri 11.00 to 6.00, Sat 11.00 to 5.00. Please consult Sth Melbourne website for any opening hours changes. Our extensive stockroom can also be viewed on our website. Sept Australian Centre for 4 to 22 Gallery 1: Undercurrents a curated group exhibition. Gallery 2: Present Tense by Margaret Contemporary Art (ACCA) Ackland. Sept 25 to Oct 20 Gallery 1 & 2: The 111 Sturt Street, Southbank 3006. Nature of Landscape by Jo Davenport. T (03) 9697-9999. W www.acca.melbourne Free admission. H Tues-Fri 10.00 to 5.00, Sat-Sun 12.00 to 5.00, Mon by appt. To Sept 16 A Lightness of Spirit is the Measure of Happiness – Alec Baker, Benita Clements, Vicki Couzens, Robert Fielding, Jonathan Jones, Peter Mungkuri, Vincent Namatjira, Jimmy Pompey, Yhonnie Scarce, Peter Waples-Crowe, Lisa Waup, Kaylene Whiskey and Tiger Yaltangki. Curated by Hannah Presley. The first exhibition in the Yalingwa series celebrates the significance of family, community and humour in contemporary Aboriginal life. The exhibition features ten new commissions from artists from south-east Australia and beyond, in an exploration of everyday life and experiences of Aboriginal people today. Country music icons, queer identity, pop-culture and community leadership are referenced, as well as the legacy of ancestors and the importance of coming together to strengthen identity and connection. Yalingwa is a Victorian Government initiative, developed in partnership between Creative Victoria, Margaret Ackland, Last of the Autumnal Colours, 2018, watercolour ACCA and TarraWarra Museum of Art and designed to on handmade paper, 30 x 30cm support outstanding contemporary Indigenous art and Courtesy the artist and Flinders Lane Gallery curatorial practice. Sept 28 to Nov 25 Eva Rothschild – the 2018 ACCA International exhibition presents ϐ a survey of works by Irish-born, London-based artist 45 Flinders Lane, Melbourne 3000. Eva Rothschild, ahead of her appearance at the 2019 T (03) 9662-9966. E [email protected] Venice Biennale where she will represent Ireland. W www.fortyfivedownstairs.com H Tues-Fri 11.00 Shaped by a myriad of influences from minimal to 5.00, Sat 12.00 to 4.00. Aug 28 to Sept 8 art of the 1960s and 70s to classical architecture, Hyperrealism and Improvisation painting and spiritualism and pop-culture, Rothschild has an drawing by James Yuncken. Also, Melbourne international reputation for sculptural forms that are Listening interactive audio installation by Susannah both striking and spare, as sharp geometric shapes Williams and Warren Armstrong. Sept 11 to 22 ...of morph into flamboyant, enigmatic compositions. script and facture... by Catherine Bainbridge with Presented in association with Melbourne Festival, Two Shanks in collaboration with Daniel Keene (see the exhibition brings together three new sculptural ad page 89). Also, I am scattering like light painting commissions created especially for ACCA’s galleries, by Marion Harper. Sept 25 to Oct 20 Manhattan alongside recent work spanning the last decade of Dreaming painting and printmaking by Marco Luccio. Rothschild’s diverse yet distinctive practice. Artist talk: Sat Oct 6, 11am to 1pm (see ad page 85). Stephen McLaughlan Gallery Level 8, Room 16, 37 Swanston Street (cnr Flinders Lane), Melbourne 3000. T 0407-317-323. W www.stephenmclaughlangallery.com.au Director: Stephen McLaughlan. H Wed-Fri 1.00 to 5.00, Sat 11.00 to 5.00 or by appt. To Sept 8 Emidio Puglielli. South Gallery: Jenny Loft. Sept 12 to 29 Sheena Mathieson. Eva Rothschild, Border, 2018, painted concrete, wood, foam, polystyrene, 172 x 242 x 32cm Courtesy the artist, Modern Art, London, and Australian Centre for Contemporary Art 88 Melbourne 62 Lygon Street, Carlton South Vic 3053 Christine Georgiou Express Yourself Christine Georgiou, art teacher at “Arts on Burgundy” Heidelberg is showcasing her adult students’ art work for the first time. Students include: Andrea Mc Ginlay, June Gassin, Ray Lewis, Vicki Payne, Wendy Craig, Lily Sapaino, Marina Wills, Helen Bounds, Beryle Abut, Paul Guerra, Elaine Chan, Deb Van Schalk, Pierina Sassella, Julie Capetola, Margie Nelson, Trish Chapman, Marty Hirst, Morrie Malato & Angela Bergman. Steps Gallery 03 9650 3577 • [email protected] miesf.com.au/steps-gallery The classes offered are: watercolour, oil, acrylic, and abstract art. Each individual is encouraged to explore and experiment with styles and mediums whilst expressing themselves, and seeking knowledge in art history and art principles. 10 - 12 September 2018 Opening Sunday 9 September 2 - 5pm Daily 10am-4pm Melbourne 89 Australian Tapestry Workshop Buxton Contemporary 262-266 Park Street, South Melbourne 3205. Cnr Dodds Street and Southbank Boulevard, T (03) 9699-7885. E [email protected] Southbank T (03) 9035-3020. W www.austapestry.com.au Gold coin entry to the E [email protected] galleries and workshop. H Tues-Fri 10.00 to 5.00. W www.buxtoncontemporary.com H Wed-Sun 11.00 Guided tours Wed 11am and Thurs 2pm, $10 per to 5.00, Thurs to 8.00. The new purpose-built home person: bookings essential. View the weavers and for the Michael Buxton Collection of contemporary art. dyer at work on major contemporary art commissions To Oct 21 No One Is Watching You: Ronnie van Hout and artists in residence. Tapestries being woven – this ironically titled exhibition shines a spotlight on on the looms designed by Emily Floyd and Justin Ronnie van Hout, a Melbourne-based New Zealand- Hill. To Oct 26 Tapestry Design Prize for Architects born artist best known for his distinctive brand of Finalists Exhibition – featuring the 15 finalists for the existential absurdism. Tapestry Design Prize for Architects 2018. Architects were invited to respond to the brief written by MONA Lynn Jaanz Art Gallery Founder, David Walsh and design a tapestry for Level 1, 216 York Street, South Melbourne 3205. Étienne-Louis Boullée’s mooted building that inspired T 0450-955-467. W www.yorkstreetartgallery.com the Pharos Wing, MONA, Tasmania, Australia. The Curator: Anne Ioannou. International artist Lynn Jaanz TDPA 2018 is a partnership between the Australian and guest artist advertised. Viewing by appt: email Tapestry Workshop, the Museum of Old and New Art [email protected] (MONA) and Architecture Media. Margaret Lawrence Gallery 40 Dodds Street, Southbank 3006. T (03) 9035-9400. E [email protected] W www.vca.unimelb.edu.au/mlg H Tues-Sat 12.00 to 5.00. Aug 31 to Sept 22 (opening Thurs Aug 30, 5.30pm) Majlis Travelling Scholarship Exhibition – The Australian National this exhibition presents the work of shortlisted third year students from the School of Art. The travelling Brooch Show 2018 scholarship of $10,000 allows the recipient of Contemporary Art Society of Victoria Inc. the award to travel overseas at the conclusion of their studies. A showcase exhibition of small wearable contemporary artworks, created in a diverse range of media by artists from across Australia. All for sale! Average price $20 - $60 10 - 23 September Majilis Travelling Scholarship, 2017 Majilis Exhibition of award winner Tia Ansell’s work Gallery 314, Photograph: Christo Crocker 314 Church St, Richmond Courtesy the artist and Margaret Lawrence Gallery Open 11am - 6pm daily National Gallery of Victoria NGV International 03 9428 0568 or 0407 059 194 180 St Kilda Road, Melbourne 3004. T (03) 8620- [email protected] 2222. W www.ngv.vic.gov.au H Daily 10.00 to 5.00. See all works online at end of exhibition: To Oct 7 MoMA at NGV: 130 Years Of Modern and www.contemporaryartsociety.org.au Contemporary Art. Also, Rirkrit Tiravanija, and New York! New York! For Kids. To Oct 28 Japonisme: Japan and the Birth of Modern Art. To Jan 27, 2019 A Modern Life: Tablewares 1930s-1980s. To Nov Guerrilla Girls: Portfolio Compleat. Also, NGV International: 50th Anniversary. 90 Melbourne William Holt Gallery In conjunction with 100th Gallery 200 Normanby Road, Southbank 3006. T 0419-206-358. E [email protected] W www.williamholtart.com H Mon-Fri 7.00 to 4.30, or by appt. Permanent exhibition with regular new works showing 25 large-scale paintings on display – William Holt. Carlton Nth Melbourne Bridget McDonnell Gallery Carlton 130 Faraday Street, Carlton 3053. T (03) 9347-1700. E [email protected] W www.bridgetmcdonnellgallery.com.au H During Still life with fig and wasp exhibitions Tues-Fri 10.00 to 5.00, Sat 12.00 to Dena Kahan, , 2018, oil on linen, 66 x 56cm 5.00, or by appt. Courtesy the artist and Gallerysmith The Dax Centre George Paton Gallery Rear of 30 Royal Parade, Parkville 3010. Second floor, Union House, University of Melbourne T (03) 9035-6258. E [email protected] 3010. T (03) 8344-5418. W www.daxcentre.org Entry by donation. H Wed-Fri E [email protected] 12.00 to 5.00, or by appt. The Dax Centre exhibits W www.union.unimelb.edu.au/georgepaton selections of works from the Cunningham Dax H Mon-Fri 11.00 to 5.00. Aug 29 to Sept 7 Entrance Collection, all of which are created by people Gallery: Meeting Place by Michael Sandford. Closing with lived experience of mental illness or event: Wed Sept 5, 5-7pm. Main Gallery: Nothing psychological trauma. Begins or Ends – Marcelle Bradbeer, Jade Crumpler and Genevieve Douglas-Byrnes. Curated by Sophie Gallerysmith Prince. Sept 12 to 21 Entrance Gallery: Small Rooms 170-174 Abbotsford Street, North Melbourne 3051. – Louis Klee, Jack Palmer and Eitan Ritz. Closing T (03) 9329-1860. E [email protected] event: Wed Sept 19, 5-7pm. Main Gallery: MU$CLE W www.gallerysmith.com.au H Tues-Sat 11.00 to – Amie Anderson, Giordano Biondi, Brand Me Baby, 5.30. Sept 6 to Oct 6 (opening Sat Sept 8, 4-6pm) Jade Burstall, Vera Jasevski, Natalya Maller, Nico Lure by Dena Kahan. Also, Bloom by Lori Pensini. Reddaway, Phil Soliman, Maya Sollier and Rose Project Space: Nocturne by Martin Tighe. Staff. Curated by Nico Reddaway. ‘THE MESSAGE’ Opening: Saturday, 15 Sept, 2 - 4pm Exhibition Dates: 13 - 30th Sept SENYE SHEN AVAN ANWAR YSG - Yarra Sculpture Gallery Gallery Hours: Thurs - Sun, 11am - 4pm ANNETTE CHANG 117 Vere Street, Abbotsford VIC 3067 [email protected] PIMPISA TINPALIT yarrasculpturegallery.com.au 92 Melbourne head, go p ooden lay y e w our ittl par L t. B rin g 8 a 1 lit 20 t , le n e jo in y l t n o o e l i v o e , Joshua Burrowes r y m h c Jiggery Pokery e 0 a 4 r x t 5 Opening: 5 September, 6-8 pm . 3 L , Dates: 5 - 23 September e i t c t a l e F d g g o E y d red gallery o e u s contemporary art space i k m n i t o o 157 st georges rd th fr 11-6 sat sun 12-6 w b o fitzroy north 3068 +613 9482 3550 , L a victoria australia [email protected] n , s d e y w o e r t r i u t ’ s B t a r u u h e s o . J I : ’ e m g a m m I i g h t y p r o u d o o t t f e y p o p u e G - Quadrant Gallery www.quadrantgallery.com.au MY MELBOURNE ALDO BELLEMO 72 Barkers Road Hawthorn 3122 [email protected] Tues - Sat 10am - 4pm Phone: 03 9079 0943 Melbourne 93 The Ian Potter Museum of Art Steps Gallery The University of Melbourne, Swanston Street 62 Lygon Street, Carlton South 3053. (between Elgin and Faraday streets), Parkville 3010. T (03) 9650-3577. W miesf.com.au/steps-gallery T (03) 8344-5148. E [email protected] H Daily 10.00 to 4.00. Sept 10 to 12 (opening Sun W www.art-museum.unimelb.edu.au Director: Kelly Sept 9, 2-5pm) Express Yourself works by adult Gellatly. Free entry. H Tues-Fri 10.00 to 5.00, Sat- students of teacher Christine Georgiou of Arts on Sun 12.00 to 5.00. To Sept 30 Liquid Form: Ancient Burgundy, Heidelberg. Daily 10.00 to 4.00. and contemporary glass. To Oct 28 State of the See ad page 89. Union, and Eavesdropping. Langford 120 120 Langford Street, North Melbourne 3051. Fitzroy T (03) 9328-8658. E [email protected] W www.langford120.com.au Directors: Irene Barberis and Wilma Tabacco. H Thurs-Sat 12.00 to 5.00, Sun 12.00 to 5.00. Sept 8 to Oct 7 (opening Sun Collingwood Sept 9, 2-4pm) …drifting off the plane by Nobby Seymour. Also, Angels, Ghosts and Demons by Stephen Spurrier. Abbotsford The Larwill Studio Alcaston Gallery 48 Flemington Road, Parkville 3052. T (03) 9032- 11 Brunswick Street, Fitzroy 3065. 9111. W www.artserieshotels.com.au/larwill T (03) 9418-6444 F 9418-6499. A boutique hotel in Melbourne’s north dedicated to E [email protected] the work of Australian artist David Larwill. W www.alcastongallery.com.au Director: Beverly Knight (approved to value Aboriginal paintings, RMIT Project Space / ceramics, sculpture, textiles and artefacts for the Spare Room Cultural Gifts Program). H Wed-Sat 11.00 to 5.00, or by appt. Sept 5 to Oct 6 Kunkamak Ngarrwoneng – RMIT Building 94.2, 23-27 Cardigan Street, Carlton Our House of Culture by Bob Burruwal and 3053. T (03) 9925-4971. E [email protected] Lena Yarinkura. Also, Beth Inkamala and W intersect.rmit.edu.au Free entry, wheelchair access. Carlene Thompson. Sept 13 to 16 Sydney H Wed and Fri 10.00 to 5.00, Thurs 10.00 to 8.00, Contemporary 2018, Booth B01: exhibiting artists Sat 12.00 to 4.00. To Sept 27 Project Space: The – Sally Gabori, Karen Mills, Betty Kuntiwa Pumani, 2018 Austrian Arts Residency Exchange – Siegmund Dean Smith, Kawita Vatanajyankur, Tiger Yaltangki Skalar (AUT). Spare Room: Space Between – Avan and Yaritji Young. Anwar, Clara Murphy and Maria Camila Quintero Arango, curated by Felicity Griffin. 94 Melbourne Australian Galleries Cambridge Studio Gallery 35 Derby Street, Collingwood 3066. 52 Cambridge Street, Collingwood 3066. T (03) 9417-4303 F 9419-7769. T (03) 9486-0169, 0413-537-532. E [email protected] E [email protected] W www.australiangalleries.com.au Director: Stuart W www.cambridgestudiogallery.com.au H Wed-Sun Purves AM. H Daily 10.00 to 6.00. To Sept 16 Days 12.00 to 5.00. To Sept 2 Glimpses of the Moon by of Spring by Salvatore Zofrea. Sept 25 to Oct 14 Jo Amiet – textile and mixed media artworks that The Narrow Escape by Stu James. Also, Saturated explore the artist’s emotional and spiritual connection Solitude by Maryanne Couts. with the moon. Also, Featured artist Melanie Bardolia. Sept 5 to 23 More Human by Rosemarie Reber – an Australian Galleries exhibition of paintings and drawings that imagine how people interact with their environment. Also, featured Stock Rooms artist Sharon Monagle. Sept 26 to Oct 14 Internal/ 28 Derby Street, Collingwood 3066. External by Gennet Makonnen – a series of oils from T (03) 9417-2422 F 9417-3433. Gennet’s private and public scenes. Working ‘en plein E [email protected] air’ Gennet focuses on the effects of Melbourne light. W www.australiangalleries.com.au Director: Stuart Also, Featured artist Jennifer Gough. Purves AM. H Daily 10.00 to 6.00. To Sept 16 Mother Tongue by Barbie Kjar. Chapman & Bailey Gallery 350 Johnston Street, Abbotsford 3067. Australian Print Workshop T (03) 9415-8666 F (03) 9415-8811. 210 Gertrude Street, Fitzroy 3065. E [email protected] T (03) 9419-5466. E [email protected] W www.chapmanbailey.com.au H Mon-Fri 10.00 to W www.australianprintworkshop.com Director: Anne 5.00, Sat 10.30 to 4.00. Aug 29 to Sept 22 (opening Virgo OAM. Free entry. H Tues-Sat 10.00 to 5.00. Sat Sept 1, 2-4pm) Jewellery by Ros Winkler, and To Sept 15 Figuration in Print – a selection of original Photographs by Konrad Winkler. fine art prints exploring the use of the figure, produced by leading contemporary artists in collaboration with APW Printers. The exhibition includes works by Rick Collingwood Gallery Amor, Brook Andrew, Heri Dono, Emily Floyd, Louis 292 Smith Street, Collingwood 3066. T 0411-650-399. Karadada, Laith McGregor, Chris O’Doherty (aka Reg E [email protected] Mombassa), Maryanne Mungatopi, Jan Senbergs, W www.collingwoodgallery.com.au To Sept 6 Pijaju Peter Skipper and Mervyn Street. Suburban Geometry by Stephen Armstrong and John Owe Young. Sept 8 to 20 (opening Sat Sept 8, 3-7pm) Art Japan 2018 – a Fringe Festival event BlackCat Gallery featuring 25 Japanese and seven Taiwanese artists. 95 Johnston Street, Collingwood 3066. Daily 12.00 to 5.00 (except Mon). Special event: T (03) 9913-5833 , 0413-584-829. Sumie Demonstration by Kinran Kamataki, Sat-Sun, E [email protected] Sept 15-16 from 2pm. W www.blackcatgallery.com.au H Wed-Sun 12.00 to 5.00. Sept 12 to 23 Gary Upfield, JP Pemapsorn and Matthew Adcock. Sept 26 to Oct 7 Group show Fox Galleries by The 69 Collective. 79 Langridge Street, Collingwood 3066. T (03) 8560-5487. E [email protected] W www.foxgalleries.com.au H Tues-Sat 10.00 to Brunswick Street Gallery 6.00. To Sept 14 Ruin Nation by Merryn Trevethan. Level 1, 322 Brunswick Street, Fitzroy 3065. Sept 20 to Oct 13 An Internal Dialogue by T (03) 8596-0173. Victor Rubin. E [email protected] W www.brunswickstreetgallery.com.au H Tues-Fri 10.00 to 6.00. Merryn Trevethan, Ruin Nation, 2018, pigment ink print on archival paper Courtesy the artist and Fox Galleries Melbourne 95 in.cube8r gallery & emporium Pokery by Joshua Burrowes (see ad page 93). Sept 26 to Oct 14 G1: Luminosity, Satin & Paper 321 Smith Street, Fitzroy 3065. T 0414-736-659. by Ri Ying Cai. G2: Archaeology of Practice 2 by W incube8r.com.au H Mon-Wed 11.00 to 5.00, Winsome Spiller. G3: New Works by Phil Sayers. Thurs-Sat 11.00 to 6.00, Sun 12.00 to 4.00, closed public hols. Sept 7 to 19 (opening Thurs Sept 6, 6-8pm) Contour – this exhibition maximises white Tacit Galleries space. Sometimes less is more, and this show invites 123a Gipps Street (cnr Gipps and Islington streets), you to consider if maybe more of less is what our Collingwood 3066. T 0423-323-188. society’s need right now. Sept 21 to Oct 2 (opening E [email protected] W www.tacitart.com.au Thurs Sept 20, 6pm) Almost Solo 8 – four artists H Wed-Sun 11.00 to 5.00. To Sept 9 Bev Plowman, exhibit small bodies of work. Julie Edgar, Christine Gibbs and Chromatopia. Aug 29 to Sept 23 Saxon Quinn, Peter Brook, Bill Lane Modern Times and Paul Kathner. Sept 12 to Oct 7 Brenda Walsh, Peter Ward, John Rabling and Katherine Westfold. 311 Smith Street, Fitzroy 3065. T (03) 9913-8598. Sept 26 to Oct 21 Linda Pickering, Myunghee Kim, E [email protected] Irene Wellm, Peter Summers, Mel Kerr, Eugene Von W www.moderntimes.com.au H Mon-Fri 10.00 to Nagy and Ruth McIntosh. See ads pages 96 and 97. 6.00, Sat 10.00 to 5.00, Sun 11.00 to 5.00. Sept 5 to 16 Preservation by Elizabeth Barnett. Sept 27 to Oct 7 New photographic series by Derek Swalwell. Victorian Artists’ Society 430 Albert Street, East Melbourne 3002. T (03) 9662-1484. E [email protected] W victorianartistssociety.com.au/exhibitions H Mon to Fri 10.00 to 4.00, Sat-Sun 1.00 to 4.00. Yarra Sculpture Gallery Contemporary Sculptors Association 117 Vere Street, Abbotsford 3067. T (03) 9419-6177. E [email protected] W yarrasculpturegallery.com.au H Thurs-Sun 11.00 Elizabeth Barnett, Preservation, 2018, oil on linen, 152 x 246cm Courtesy the artist and Modern Times to 4.00. Sept 13 to 30 (opening Sat Sept 15, 2-4pm) The Yarra Sculpture Gallery with the Melbourne Fringe Festival presents The Message – an exhibition Nicholas Thompson Gallery of immersive installations from artists who unite to 155 Langridge Street, Collingwood 3066. transform language into visible and physical forms. T (03) 9415-7882. Featuring the work of Senye Shen, Avan Anwar, W www.nicholasthompsongallery.com.au Annette Chang and Pimpisa Tinpalit. H Wed-Sun, 11.00 to 6.00. Sept 5 to 23 Susan See ad page 92. Archer. Sept 13 to 16 Sydney Contemporary: Arryn Snowball. Sept 26 to Oct 14 Logic by Genevieve Felix Reynolds (see ad back cover). Port Jackson Press Print Gallery 67 Cambridge Street, Collingwood 3066. T (03) 9419-8988. E [email protected] W www.portjacksonpress.com.au H Wed-Sat 11.00 to 5.00. Publishers and dealers in limited-edition fine- art prints. Established 1975. red gallery contemporary art space 157 St Georges Road, North Fitzroy 3068. T (03) 9482-3550. E [email protected] W www.redgallery.com.au H Thurs-Fri 11.00 to 6.00, Sat-Sun 12.00 to 5.00. Sept 5 to 23 G1: Cloudland by Heather Davies. G2: Presence and Place – Tom Buckland, Sian Watson, Erin Linhart, Heidi Lefebvre, Amelia Chapman and Anton Poon. G3: Jiggery Avan Anwar, Dancing Letters, 2018, installation view, paper, fishing line, timber, dimensions variable Courtesy the artist and Yarra Sculpture Gallery 98 Melbourne DONALD BATE NO BOUNDARIES 29 AUG - 8 SEPT Big Red Acrylic on Canvas 97 x 122 cm Outback Wonders Mixed Media on Board 38 x 104 cm www.hawthornstudiogallery.com.au 635 Burwood Rd, Hawthorn East. VIC. 3123 (5 doors from Auburn Rd) Tuesday - Saturday 11am - 4.30 pm P: 03 9882 5553 Islamic Museum of Australia Brunswick 15 Anderson Road, Thornbury 3071. T 1300-915-171. W islamicmuseum.org.au H Tues-Sat 10.00 to 4.00. Northcote SOMA Gallery 421 Sydney Road, Brunswick 3056. Arts Project Australia T 0423-135-525. E [email protected] 24 High Street, Northcote 3070. T (03) 9482-4484 W thesomawebsite.com Facebook: bit.ly/2MeVSNN F 9482-1852. E [email protected] H Fri-Sun 12.00 to 5.00. Sept 6 to 9 (opening Thurs W www.artsproject.org.au H Mon-Fri 9.00 to 5.00, Sept 6, 6-9pm) Anon Group Show – Ryan Boserio, Sat 10.00 to 5.00. Iain Dean, Erika Gofton, Sarah Hart, Richard Healy, Nicholas Ives, Kim Hyunji, Shannon McCulloch, Counihan Gallery In Brunswick Nicholas Plowman, Andy Quilty and Jennifer Whitten. 233 Sydney Road, Brunswick 3056. T (03) 9389- 8622. E [email protected] W www.moreland.vic.gov.au/counihan-gallery Free entry. H Gallery: Wed-Sat 11.00 to 5.00, Sun 1.00 to 5.00. Office: Wed-Sat 11.00 to 5.00. Aug 31 to Sept 30 (opening Thurs Aug 30, 6-8pm) Video Echoes: Waves From the Eastern Mediterranean – Mounira Al Solh (LBN), Heba Amin (EGY), Marianna Christofides (CYP), Didem Erk (TUR), Sigalit Landau (ISR), Hrair Sarkissian (SYR), Oraib Toukan (JOR/PLE), Stefanos Tsivopolous (GRE). Curated by Victor Griss. Nicholas Ives, Self portrait as the Goat, 2016-17, oil on linen, 145 x 115cm Courtesy the artist and SOMA Gallery Tinning Street Presents Lot 5/29 Tinning Street, Brunswick 3056. E [email protected] W tinningstreetpresents.com H Thurs-Sun 11.00 to 5.00. Sept 6 to 16 The House Ov Saint Dymphna by Felix Atkinson. Sept 20 to Oct 7 Chris Humphries. 100 Melbourne Richmond Charles Nodrum Gallery 267 Church Street, Richmond 3121. T (03) 9427- 0140. E [email protected] W www.charlesnodrumgallery.com.au Director: Charles Nodrum (member of ACGA). H Tues-Sat 11.00 to 6.00. Sept 20 to Oct 13 ABSTRACTION 18: Further a-Field, c. 1975 – a group show. Contemporary Art Society of Victoria Inc. CAS Inc. PO Box 283, Richmond 3121. T (03) 9428-0568, 0407-059-194. E [email protected] W www.contemporaryartsociety.org.au A non-profit art society run by artists, for artists, established 1938. To Oct 18 Contemporary Showcase 23 at Decoy Café & Gallery, 303 Exhibition Street, Melbourne. At Gallery 314: 314 Church Street, Richmond Sept 10 to 23 CAS Inc. Annual Exhibition 2018 (see ad page 105. Also, The Australian National Brooch Show 2018. Daily 11.00 to 6.00 (see ad page 90). Niagara Galleries 245 Punt Road, Richmond 3121. T (03) 9429-3666. E [email protected] W www.niagaragalleries.com.au Director: William Rick Amor, Listening, 2017, oil on canvas, 100 x 61cm Nuttall (member of ACGA). H Tues-Fri 11.00 to 6.00, Courtesy the artist and Niagara Galleries Sat 12.00 to 5.00 or by appt. Aug 28 to Sept 22 Paintings, Drawings and Watercolours 2018 by Rick William Mora Galleries Amor. Also showing in our stockroom: Glenn Barkley, 60 Tanner Street, Richmond 3121. T (03) 9429-1199. Terry Batt, Stephen Benwell, Tony Bevan (UK), E [email protected] Angela Brennan, Robert Bridgewater, Paul Boston, W www.moragalleries.com.au Director: William Mora. Gunter Christmann, Julie Ciccarone, Brenda L. Croft, H Wed-Fri 10.00 to 4.00, or by appt. To Sept 14 Harry Dixon Mptyane, Julie Dowling, Fiona Foley, recent work by Jumaadi. Star Gossage (NZ), Michelle Grabner (US), Malaluba Gumana, Rubaba Haider, Euan Heng, Dale Hickey, Dianne Jones, Jennifer Joseph, David Keeling, Women’s Art Register Yvonne Kendall, Richard Larter, Kevin Lincoln, Song 1975-2015 Ling (CN) Travis MacDonald, Euan Macleod, Helen Richmond Library, 415 Church Street, Richmond Maudsley, Noel McKenna, Sean Meilak, Samuel 3121. E [email protected] Namunjdja, Lena Nyadbi, Martin Parr (UK), Angelina W www.womensartregister.org Member organisation Pwerle, Hu Qinwu (CN), Steven Rendall, Andreas with information on 5,000+ women artists. Ruthi (CH), Jan Senbergs, Neil Taylor, Savanhdary Supported by the City of Yarra. Vongpoothorn, Wukun Wanambi, Wolpa Wanambi, Bradd Westmoreland, Ken Whisson, Helen Wright and Liu Zhuoquan (CN). Melbourne 101 The Justin Art House Museum Toorak E [email protected] W www.jahm.com.au Bookings for guided tours of the exhibition and private collection of Charles and Leah Justin only by registration via the JAHM website. To Dec 2 A Body of Sth Yarra Work – Photography of Adrian Boddy. Prahran Alternating Current Art Space (map ref Melway 2L, K12) 248 High Street, Windsor 3181. T (03) 9528-2459. E [email protected] W www.alternatingcurrentartspace.com H Thurs-Fri 12.00 to 7.00, Sat-Sun 12.00 to 5.00. Aug 31 to Sept 22 Gallery 1: Silence by Pimpisa Tinpalit. Gallery 2: I want to die by Wolfgang Pleiades. Gallery Adrian Boddy, from the series ‘Lives Distilled’, 65 x 100cm 3: Again and again by Ruby Aitchison & Harrison Courtesy the artist and The Justin Art House Museum Jamie. Gallery 4: To Slash by Haydn Allen. The Cupboard: Forced exposure by Emily Yuting Chen. Linden New Art Visit Linden New Art, back home in St Kilda, 6 Acland Street, St Kilda 3182. T (03) 9534-0099. E [email protected] W www.lindenarts.org Director: Melinda Martin. H Tue-Fri 10.00 to 3.00, Sat-Sun 10.00 to 4.00, closed public hols. To Nov 4 Wholeness and the Implicit Order by Julia deVille, and Imaging the Dead by Natalie Ryan. The Olsen 637-641 Chapel Street, South Yarra 3141. T (03) 9040-1222. W www.artserieshotels.com.au/olsen The Olsen is an elegant hotel with suites featuring lyrical works of Australian landscape artist John Olsen. STATION 9 Ellis Street, South Yarra 3141. T (03) 9826-2470. E [email protected] W www.stationgallery.com.au H Tues-Fri 11.00 to 5.00, Sat 11.00 to 4.00. Sept 15 to Oct 13 (opening Sat Sept 15, 4-6pm) solo exhibitions by Sven T’Jolle, and Patrick Pound. Pimpisa Tinpalit, Black to gold No 5, 2018, resin, 15 x 20 x 25cm Courtesy the artist and Alternating Current Art Space The Cullen 164 Commercial Road, Prahran 3181. T (03) 9098-1555. W www.artserieshotels.com.au/ cullen A boutique hotel featuring original artwork and prints by Australian contemporary artist Adam Cullen. 102 Melbourne Studio B Gallery Archaeology: Symbols and Timepieces by Deborah Walker and Richard Stringer invites us into a world of 509 High Street, Prahran 3181. T (03) 9510-1607. navigational objects and time triggers. W www.studiobgallery.com.au Director: Tamsin Buic. H Wed-Fri 10.00 to 6.00, Sat-Sun 10.00 to 3.00. Sept5to16Hidden – explores the internal torment The Gallery at Bayside Arts and suffering of popular culture’s icons, yet this & Cultural Centre trauma is contrasted by flamboyant personalities and (map ref Melway 67 F10) cnr Wilson and Carpenter exceptional talents. streets, Brighton 3186. T (03) 9261-7111. E [email protected] W bayside.vic.gov.au/gallery www.facebook.com/thegalleryatbacc Free entry. H Wed-Fri 11.00 to 5.00, Sat-Sun 1.00 to 5.00. Closed public hols. Sept 15 to Nov 11 Rob McHaffie: This is living – a survey of the last five years of McHaffie’s practice. This period corresponds with McHaffie’s return to the beachside suburb of Brighton, which offers a fertile ground for his witty and astute observations of the people and events that make up his world. Space2b Artspace 144 Chapel Street, St Kilda 3182. T 0413-678-144. E W space2b.com.au/current-exhibition H Tues-Fri 10.00 to 5.00, Sat 10.00 to 2.00. Sept 4 to 29 BREATHE a solo show by Cheryle Bannon. Vivien Anderson Gallery Ground Floor, 284-290 St Kilda Road, St Kilda 3182. T (03) 8598 9657. E [email protected] W www.vivienandersongallery.com H Tues-Fri 11.00 to 5.00, Sat 12.00 to 4.00. Representing and Zoe Papatheodorou, David Bowie, acrylic on canvas, 96 x 92cm exhibiting Australian Indigenous artists for over 30 Courtesy the artist and Studio B Gallery years. To Sept 22 Timothy Cook new paintings. In association with Jilamara Arts & Crafts. St Kilda Armadale Elwood Malvern Brighton Artbank Melbourne 18-24 Down Street, Collingwood 3066. Brightspace T 1800-251-651. E [email protected] 8 Martin Street, St Kilda 3182. T (03) 9593-9366. W www.artbank.gov.au H Mon-Fri by appt. W www.brightspace.com.au H Wed-Fri 11.00 to A Commonwealth Government art leasing program for 5.00, Sat-Sun 12.00 to 4.00. Sept 6 to 22 CCLVX contemporary art. Supporting Australian artists. new works on paper by Paul Newcombe. Duldig Studio Carlisle Street Arts Space Museum + Sculpture Garden 99a Carlisle Street, St Kilda 3182. T (03) 9209-6777. 92 Burke Road, East Malvern 3145. E [email protected] T (03) 9885-3358. E [email protected] W www.portphillip.vic.gov.au/carlisle-st-arts-space.htm W www.duldig.org.au H Tues, Thurs and second Free entry. H Mon-Fri 8.30 to 5.00, Thurs 8.30 Sat of every month 1.00 to 3.00, or groups by appt. to 7.00 (during exhibitions). To Sept 12 Gardens Through Sept SLAWA: modernist art and design – a an exhibition of botanical solar plate etchings by Viennese modernist in Melbourne. Trudy Rice. Also, Place by local blacksmith David Wood, presents works that document change, loss and growth in our city. Sept 19 to Oct 17 Private Melbourne 103 Firestation Print Studio Gallery Ten Cubed (map ref Melway 59 A8) 2 Willis Street, Armadale 1489 Malvern Road, Glen Iris 3146. 3143. T (03) 9509-1782. E [email protected] T (03) 9822-0833. E [email protected] W www.fps.org.au H Wed-Sat 11.00 to 5.00. W www.tencubed.com.au H Tues-Sat 10.00 to 4.00. Sept5to22Out of Sight linocut and intaglio prints A private collection of contemporary art, open to the by Vivienne Breheny and Maureen King. Sept 7 to general public. To Sept 8 Pat Brassington. Sept 18 Oct 31 Firestation Print Studio Gallery, is the selected to Dec 15 Brook Andrew – Ten Cubed is excited Victorian gallery to host the Print Council Australia to announce its final exhibition for 2018 will be Print Commissions Exhibition. Sept 26 to Oct 13 artist Brook Andrew who was included in the core (opening Thurs Sept 27, 6-8pm) The Great Divide: collection this year. Andrew is an interdisciplinary Urban Melbourne, Urban Sydney – an exhibition artist who examines dominant narratives, often exchange with WEA linocut artists, Sydney. relating to colonial and modernist legacies. Through museum and archival interventions, he aims to make forgotten stories visible and offer alternative narratives for interpreting history in the world today. This exhibition will feature works acquired by the collection including ‘Systems I’ and ‘Systems II’ – the first acquisition made at Spring1883 in 2016. Brook Andrew is represented by Tolarno Galleries, Melbourne; Roslyn Oxley9 Gallery, Sydney; and Galerie Nathalie Obadia, Paris and Brussels. Marian Crawford, Diffraction, 2018, intaglio and relief prints on cut paper, thread, 76 x 56cm Photograph: Tim Gresham Courtesy the artist and Firestation Print Studio Gallery MAS Gallery 1297-1299 High Street, Malvern 3144. T (03) 9822-7813. E [email protected] W malvernartists.org.au H Daily 11.00 to 4.00 during exhibitions. Scott Livesey Galleries Brook Andrew, Systems II, 2016, mixed media 909a High Street, Armadale 3143. Courtesy the artist, Tolarno Galleries, Melbourne, and Ten Cubed T (03) 9824-7770. E [email protected] W www.scottliveseygalleries.com H Tues-Fri 11.00 to 5.30, Sat 11.00 to 4.00. Sept 8 to 29 Untethered by Camie Lyons. Also, Arcadia by Joanna Logue. 104 Melbourne Melbourne 105 Town Hall Gallery Hawthorn 360 Burwood Road, Hawthorn 3122. T (03) 9278- 4626. E [email protected] W boroondara.vic.gov.au/arts H Tues-Fri 10.00 to East & West Art 5.00, Sat-Sun 11.00 to 4.00, closed Mon and public 665 High Street, East Kew 3102. T (03) 9859-6277. hols. Aug 28 to Sept 23 Community Project Wall: E [email protected] The Legacy of Frank Werther – Rosemary Bridie, W www.eastwestart.com.au Director: Marjorie Ho. Beverley Cox, Bram Khazam, Gaby Khazam, Judith H Mon-Fri 11.00 to 5.30, Sat 11.00 to 4.30. Harley, Norman Rosenblatt and Wilma Tabacco. This Specialists in Asian Fine Arts and Antiques. Sept 6 to exhibition features the work of students who attended Oct 27 (opening Thurs Sept 6) Chinese and Japanese art classes with Frank Werther, an abstractionist who Woodblock prints – Traditional and Contemporary. taught in an old coach hall in Chrystobel Crescent, Hawthorn, in the 1970s. Work from other students Eastgate Gallery will also be included, as well as some historical pieces completed in the coach house by Werther Dealers in Fine Art himself. Sept 1 to Oct 21 Main Galleries: This Wild 158 Burwood Road, Hawthorn 3122. Song – a series of portraits of significant Australian T (03) 9818-1656. E [email protected] female artists by Ilona Nelson. Featuring 26 portraits W www.eastgatejarman.com.au H Mon-Fri 9.00 to from the series alongside an artwork by each artist 5.00, Sat 10.00 to 4.00. A Selection of traditional, pictured, this exhibition celebrates strong female abstract, and contemporary art from leading leaders in the arts community and their creative vision Australian artists past and present. Sept 1 to 29 (see ad page 31). Spring is Here! group show. Hawthorn Studio & Gallery 635 Burwood Road, Hawthorn East 3123. T (03) 9882-5553. E [email protected] W www.hawthornstudiogallery.com.au H Tues-Sat 11.00 to 4.30. Aug 29 to Sept 8 No Boundaries contemporary landscape paintings by Donald Bate (see ad page 99). Sept 12 to 22 Urban Nature by Geoff Cunningham & Joe Blundell. Exclusive preview evening: Tues Sept 11, from 6.30pm. Book at www.trybooking.com/WNGS Quadrant Gallery Jacqui Stockdale, Ilona Nelson, 2018, photograph printed on Canson Platine paper, 100 x 140cm (map ref Melway 45 A8) 72 Barkers Road, © the artist Hawthorn 3122. T (03) 9079-0943. Courtesy the artist and Town Hall Gallery E [email protected] W www.quadrantgallery.com.au H Tues-Sat 10.00 to 4.00. Sept 20 to Oct 20 My Melbourne by Aldo Bellemo – this is Bellemo’s second solo exhibition at Quadrant Gallery, and in this exhibition he continues ϐ to express his love for this city and its changes. The works convey the multi-faceted aspects of Melbourne through the architecture, displaying a deep respect for Elsternwick both old and new buildings which provide service and protection for the people who use them. The paintings show a narrative between these iconic buildings and Glen Eira City Council Gallery the people of Melbourne. See ad page 93. Cnr Glen Eira and Hawthorn roads, Caulfield 3162. T (03) 9524-3402. W www.gleneira.vic.gov.au Curator: Diane Soumilas. Free admission. H Mon-Fri 10.00 to 5.00, Sat-Sun 1.00 to 5.00, closed public hols. To Sept 9 Twenty Melbourne Painters Society: 100th Celebratory exhibition. Presented by Jenny Pihan Fine Art. Sept 13 to Oct 7 Aussie Rules: Passion and Pain. Presented by Rotary Club of Caulfield Inc. 106 Melbourne Lauraine Diggins Fine Art 5 Malakoff Street, North Caulfield 3161. Greater T (03) 9509-9855. E [email protected] W www.diggins.com.au H Tues-Fri 10.00 to 6.00, Sat 1.00 to 5.00, or by appt. Specialists in Australian Melbourne colonial, impressionist, modern, contemporary and Indigenous painting, sculpture and decorative art. Art at Linden Gate Sourcing European masterworks on request. 899 Healesville-Yarra Glen Road, Yarra Glen 3775. T (03) 9730-1861. E [email protected] W www.artatlindengategallery.com.au H Fri-Mon 10.00 to 5.00 (including public hols, except Dec 24 and 25). Aug 31 to Oct 8 Explorations, a Retrospective by Bill Proctor – from early ventures into cubism, through to bright colourful heads, decorative nudes, geometric abstracts and vibrant landscapes, this presentation of work illustrates the artist’s continuing pursuit of beauty. Arthur Merric Bloomfield Boyd (1920-1999), Ocean Beach, Rye, 1957, oil on canvas on composition board, 76 x 107cm Courtesy Lauraine Diggins Fine Art MADA Gallery Monash University, ϐ Building D, Ground Floor, 900 Dandenong Road, Caulfield East 3145. E [email protected] W www.artdes.monash.edu/gallery Free entry. H Wed-Fri 10.00 to 5.00, Sat 12.00 to 5.00 during exhibitions. Moorabbin Highett Bill Proctor, Louisa, oil on canvas Bayside Sculpture Courtesy the artist and Art at Linden Gate 16B Advantage Road, Highett 3190. T (03) 9553-0661. ArtSpace at Realm E [email protected] 179 Maroondah Highway, Ringwood 3134. W www.baysidesculpture.com.au H Daily 11.00 E [email protected] to 5.00. Sept 17 to 23 WHO WE ARE sculpture W www.artsinmaroondah.com.au H Mon-Fri 10.00 exhibition. Term 4: eight-week sculpture classes to 5.00, Sat-Sun and public hols 12.00 to 4.00. beginning Oct 15, 16 and 17. To Sept 9 Weaving Stories – Kate Beynon, Nusra Latif Qureshi, Aunty Irene Norman and Shan March Space Turner-Carroll. 5 Waltham Street, Sandringham 3191. T 0413-685-488. E [email protected] Belgrave Creative Space Director: Gang Liu. H Tues-Sun 10.00 to 5.00. 1658a Burwood Highway, Belgrave 3160. Facebook: @marchspacegallery Sept 15 to Oct 20 T 0425-831-425. W www.belgravecreativespace.com (opening Sat Sept 15, 3pm) Blank Image by Lei Space for hire: workshops, forums, exhibitions, Zheng. See ad page 87. classes, private tuition, performances, rehearsals and art projects. Melbourne 107 Bolin Bolin Gallery at Bulleen Art & Garden 6 Manningham Road West, Bulleen 3105. T (03) 8850-3030. W www.gallery.baag.com.au H Daily 9.00 to 5.00. To Sept 25 Wild and Woolly – Eastern Studio Potters and Artists. Sept 28 to Oct 21 Whimsical Fantasies sculpture by Melissa Thomas. Box Hill Community Arts Centre 470 Station Street, Box Hill 3128. T (03) 9895-8888. E [email protected] W bhcac.com.au Deakin University Contemporary Small Sculpture Award 2017 H Mon-Thurs 9.00 to 7.30, Fri 9.00 to 5.00. Photograph: Simon Peter Fox Sept 4 to 16 (opening Thurs Sept 6, 6-8pm) Courtesy Deakin University Art Gallery Smile by Alkira. Sept 18 to Oct 7 (opening Thurs Sept 20, 6-8pm) Idea to Exhibition by BHCAC youth Deakin University Burwood course participants. Library Gallery Space Foyer Building V, 221 Burwood Hwy, Burwood 3125. Bundoora Homestead E [email protected] Art Centre W deakin.edu.au/art-collection/ Free admission. 7 Prospect Hill Drive, Bundoora 3083. T (03) 9496- H Daily 8.30 to 8.00. Sept 5 to Oct 19 Portraits 1060. E [email protected] From The Collection. A portrait is a work of art that W www.bundoorahomestead.com Free admission. traditionally focuses on the face of a person, allowing H Thurs-Sun 10.00 to 5.00. To Sept 16 A1 the artist to reveal their own insight into the subject Darebin Art Salon. Sept 20 to Nov 11 Meaning and depicted. In many ways, a portrait can be like a Connection by Jessie Willow Tucker, and Holding mirror, in that it reflects as much about the artist On by Angela Tiatia. Also, All Our Secrets Are the as it does about the subject. The sitter, the artist Same by Charlotte Watson. Sept 22 to Nov 11 I, of and the rapport between the two, as well as the the Needle by Betty Musgrove. Also, Process Blue, setting, the costumes and the choice of materials, Nature Trips, Corduroy, Pine Shelving by Rozalind all contribute to capturing a precise expression that Drummond, and The Family Mantle – Sofi Basseghi, will remain preserved for eternity. This exhibition Katayoun Javan, Janelle Low, Morganna Magee, presents traditional and contemporary approaches Andy Mullens, Talia Smith and Pia Johnson. to portraiture in a diverse range of mediums and Curated by Pia Johnson. formats. All works are from the Deakin University Art Collection, including some rarely seen on public Burrinja Gallery display before. Curated by Claire Muir, Art Collection Officer, Deakin University. (map ref Melway 75 B12) Burrinja Cultural Centre, 351 Glenfern Road, Upwey 3158. T (03) 9754-8723. E [email protected] W www.burrinja.org.au H Tues-Sun 10.00 to 4.00. Deakin University Art Gallery at Melbourne’s Burwood Campus 221 Burwood Hwy, Burwood 3125. T (03) 9244-5344. E [email protected] W deakin.edu.au/art-collection/ Free admission. H Tues-Fri 10.00 to 4.00 during exhibitions, closed public hols. Sept 5 to Oct 19 Contemporary Small Sculpture Award. In its tenth year, this annual acquisitive award and exhibition is organised by the Art Collection and Galleries Unit at Deakin University. This exhibition of finalists’ work provides a fascinating snap shot of contemporary sculpture. Christian Thompson, Othering the Ethnologist, Augustus Pitt Rivers, 2016 Courtesy the artist, Sarah Scout Presents, Melbourne, and Deakin University Art Gallery 108 Melbourne Artist moving Artists - Art Courier Affordable Prices • Melbourne and Regional Victoria Call Drasko 0437 214 402 • [email protected] www.artistmovingartists.com.au Melbourne 109 Eltham Library Incinerator Gallery Community Gallery (map ref Melway 28 D7) 180 Holmes Road, Moonee (map ref Melway 21 J5) 1 Panther Place, Eltham Ponds 3039. T (03) 8325-1750. 3095. T (03) 9433-3175. E [email protected] E [email protected] W www.incineratorgallery.com.au Free entry. W nillumbik.vic.gov.au/Living-in/Arts-and-Cultural- H Tues-Sun 11.00 to 4.00. To Sept 16 One World Development H Mon-Thurs 10.00 to 8.30, Fri-Sat by John Barcham is an exhibition of works inspired 10.00 to 5.00, Sun 1.00 to 5.00, closed public by global travel and adventure. Through his extensive hols. To Sept 10 Monument – Nicola Hoyle, Libby travel, Barcham documented the beauty and Schreiber and Ann-Maree Gentile. Sept 13 to Oct 15 intimacy of people’s lives, and places that are both Down the Rabbit Hole by Clare Dunstan (Tog & Pini) extraordinary and familiar, which has been translated and Sarah Hardy (Popcorn Blue) – take a journey through his works. To Sept 30 Printing as Process down the rabbit hole of imagination and whimsical – Editions Tremblay, Larry Rawling Print Workshop, delights. Be captivated by original illustrations, works Megalo Print Studio and Gallery, Lancaster Press on wood, textiles, jewellery and exquisite sculptures. and Sunshine Print Art Space. Printing as Process explores the collaborative nature of art production in the printmaking studio. Featuring works created Gate 6 Gallery in collaboration with over 50 artists from across Gate 6, Cardinia Street, Berwick 3806. Australia, this exhibition reasserts the idea that art W secan.com.au Free entry. H Sat-Sun 11.00 to 5.00. production can be a social enterprise. Also, The eyes Sept 2 to 30 (opening Sat Sept 1, 4.00-5.30pm) that saw her were closed by Tracey Lamb is an Berwick & Surroundings by Mandi Potgieter. installation referencing the architectural drawings of Marion Mahony Griffin who was the architect and Gee Lee-Wik Doleen Gallery at co-designer of the Essendon Incinerator, now the Hume Global Learning Centre Incinerator Gallery alongside Walter Burley Griffin. The work aims to highlight the importance of her work Craigieburn within their collaborative practice. (map ref Melway 386E-F7) 75-95 Central Park Avenue, Craigieburn 3064. T (03) 9356-6117. E [email protected] W www.hume.vic.gov.au/gallery H (refer to website). To Oct 14 Our World – a group exhibition by Sunbury Art Society. Heide Museum of Modern Art 7 Templestowe Road, Bulleen 3105. T (03) 9850-1500. W www.heide.com.au H Tues-Sun 10.00 to 5.00. To Oct 7 Design For Life: Grant and Mary Featherston. To Nov 11 Heide I: House of Ideas. To Feb 24, 2019 Sweeney Reed and Strines Gallery. From Sept 1 Meditation on a Bone: John Barcham, Lonesome Road Folk Coffee Lounge, Ballarat Road, Albert Tucker Beyond the Modern. Maidstone (detail), 2014, oil on canvas, 100 x 150cm Courtesy the artist and Incinerator Gallery Heritage Hill Museum Joel Gallery and Gardens 5 Sargood Street, Altona 3018. T (03) 9398-2511. 66 McCrae Street, Dandenong 3175. E [email protected] W www.ljac.com.au H Mon-Fri T (03) 9793-4511. E [email protected] 10.00 to 4.00, Sat-Sun 11.00 to 3.00. Joel Gallery W www.heritagehill.com.au Free entry. H Tues-Fri is a contemporary exhibition space hosting a diverse 10.00 to 4.00. Sept 4 to Oct 5 Artist in Residence program of visual arts exhibitions by professional and Showcase, and a solo exhibition by Moh Abumeis. community artists. Kosnar’s Picture Framing 488 Mount Alexander Road, Ascot Vale 3020. T (03) 9370-5744. W www.kosnar.com.au We offer a large range of frame styles for the artist and collector. Expert advice in framing design for all types of artwork. 110 Melbourne Melbourne 111 Manningham Art Gallery Monash Gallery of Art (MGA) Manningham City Square (MC ), 687 Doncaster 860 Ferntree Gully Road, Wheelers Hill 3150. Road, Doncaster 3108. T (03) 9840 9367. E [email protected] W www.mga.org.au E [email protected] H Tues-Fri 10.00 to 5.00, Sat-Sun 12.00 to 5.00, W www.manningham.vic.gov.au/manningham art closed public hols. To Sept 19 LEGACY. Your gallery Free entry. H Tues Sat 11.00 to 5.00. To Oct collection. Our story. Also, LEGACY+ … collecting 6 Slippery When an exhibition that attempts to contemporary: Petrina Hicks, Darren Sylvester, answer one of the big questions in life, “Are banana Christian Thompson. Sept 29 to Nov 18 William & skins intrinsically slippery?” In all seriousness, Winifred Bowness Photography Prize. though, this is an exhibition that tries to get a grip on slipperiness as a concept. Featuring a range of works Mornington Peninsula that depict or employ slippery materials or surfaces, Slippery When is about slipperiness as a material Regional Gallery (MPRG) quality, slipperiness as an experience, an interaction (map ref Melway 145 G4) Civic Reserve, Dunns between surfaces, and slipperiness as an adjective Road, Mornington 3931. T (03) 5975-4395. that can describe people and personalities as much as E [email protected] physical objects. W mprg.mornpen.vic.gov.au H Tues-Sun 10.00 to 5.00. To Sept 9, 2018 National Works on Paper. The National Works on Paper is one of the most prestigious acquisitive prize exhibitions of its type in Australia. The 2018 National Works on Paper showcases recent work by some of Australia’s leading artists working in the field of drawing, printmaking and digital media. This diverse exhibition provides a survey of contemporary practice across Australia today. Sept 21 to Nov 18 Intimate Journals by Anne Ferran. The photographic series Intimate Journals and limited edition book Artist’s Library evolved from time spent by Anne Ferran exploring the special character of Arthur and Yvonne Boyd’s personal library located in the Bundanon Homestead. Anne Ferran is one of Australia’s leading photographic artists. A Bundanon Trust travelling exhibition. Also, Catherine Truman: No Surface Holds – JamFactory Icon 2017 James Bonnici, Sam 2, 2017, oil on linen, 31 x 36cm touring exhibition. Truman’s practice incorporates Courtesy the artist, Lindberg Galleries, Melbourne, and Manningham contemporary jewellery, objects, digital image and film Art Gallery installation with a focus upon the parallels between artistic process and scientific method. Investigating Maroondah Access Gallery Truman’s 20 years of collaborative practice at the nexus of art and science, this exhibition is an 32 Greenwood Avenue, Ringwood 3134. important retrospective of the multiple engagements T (03) 9298-4545. Truman has had working with scientists over this time E [email protected] as well as featuring a new body of work. W www.artsinmaroondah.com.au H Mon-Fri 9.00 to 5.00, closed weekends and public hols. To Sept 14 My Neighbour’s Garden – Zetta Kanta and Marlize Myburgh. Moving Art, quickly & safely. • Regional and interstate transport • Weekend bookings ART HUNTER • Short notice trips • Art Installation 0404 434 008 • arthunter.com.au • [email protected] 112 Melbourne TarraWarra Museum of Art Yarra Ranges Regional Museum 313 Healesville-Yarra Glen Road, Healesville 3777. 35-37 Castella Street, Lilydale 3140. T (03) 9294- T (03) 5957-3100. E [email protected] 6313. E [email protected] W www.twma.com.au Adults $10, seniors $8, W ach.yarraranges.vic.gov.au Free entry. concession $5, free entry for children aged 12 and H Daily 10.00 to 4.00, closed public hols. Sept 8 to under. H Tues-Sun 11.00 to 5.00, and all public hols. Oct 14 Force of Nature. Feel, sense, question and Visit website for public programs and events. To Nov connect with nature. Curated by Gretel Taylor. Proudly 6 TarraWarra Biennial 2018: From Will to Form. funded by Yarra Ranges Council Arts and Heritage Development Grant. Walker Street Gallery & Arts Centre (map ref Melway 90 D8, E7) Cnr Walker and Robinson streets, Dandenong 3175. T (03) 9706-8441. E [email protected] W www.walkerstgallery.com.au H Tues-Fri 11.00 to 5.00, Sat 11.00 to 3.00, closed Sun, Mon and public hols. Walker Street Gallery & Arts Centre is South Eastern Melbourne’s premier art centre. To Sept 15 Ron Rado Acquisitive Prize. Sept 20 to Oct 13 Travelling Exhibition – Hoa Nguyen, Van Nguyen, Ole Scovill, Yula Batuner, Virginie Faivre d Arcier, Sone Khounpasert, Catherine O’Brien, Jihyun Lim, Gwenaelle Montigne, Anna Ampleyeva, Maria Heed, Sweety Joshi, Sanjay Sawant, Marianne Smolska, Marie-Do Hyman-Boneu and Frederique Guichard. Jill Orr, Antipodean Epic Photograph: Christina Simons Courtesy the artist and Yarra Ranges Regional Museum Yering Station Art Gallery 38 Melba Highway, Yarra Glen 3775. T (03) 9730-0102. E [email protected] W www.yering.com Contact: Dr Ewen Jarvis. H Mon- Travelling Exhibition Fri 10.00 to 5.00, Sat-Sun 10.00 to 6.00. To Sept 16 Main Gallery: Roaming of the Vivids by Varuni Whitehorse Artspace Kanagasundaram. To Oct 7 Winery Viewing Gallery: Box Hill Town Hall, 1022 Whitehorse Road, Box Hill The Stillest Hour: Reimagining Victoria’s Highland 3128. T (03) 9262-6250. Forests by Chris Taylor. To Nov 18 First Floor Gallery: E [email protected] Winner of the YouthArt 2018 Yering Station Art W www.whitehorseartspace.com.au H Tues-Fri 10.00 Gallery Award – Tessa Hubble. Sept 19 to Nov 18 to 4.00, Sat 12.00 to 4.00. To Sept 15 Sweeping Main Gallery: Organic Plastic by Carolyn Cardinet. Landscapes – Sir Arthur Streeton was a key member of the Box Hill Artists’ camp – Australia’s first Impressionist group. Landscapes from the Whitehorse Art Collection will be shown alongside printed works by Streeton, courtesy of Queenscliff Gallery and Workshop. Sept 20 to Nov 3 Boyd & Davey – after 20 years of creative collaboration, friends Kevin Boyd and Philip Davey join forces in this inspiring exhibition of ceramics and landscapes. Both artists draw from an impressive body of work. More recently, artworks created together and apart reveal the influences each artist has borne on one another. Melbourne 113 Victoria 114 Merricks House Art Gallery Mornington 3460 Frankston – Flinders Road, Merricks 3961. T (03) 5989-8088. E [email protected] W www.mgwinestore.com.au H Daily 8.30 to 5.00. Peninsula Merricks House is located adjacent to Merricks General Wine Store and showcases talent from both Frankston Arts Centre the local Mornington Peninsula Region as well as artists from across Australia. Meander through the and Cube 37 Galleries garden from the café, bistro, cellar door or deck to 27-37 Davey Street, Frankston 3199. discover this hidden gem. T (03) 9784-1896. W www.thefac.com.au Free Entry. H Tues-Fri 9.00 to 5.00, Sat 9.00 to Montalto Sculpture park 2.00. Art After Dark every evening from dusk. To Sept 29 FAC Mezzanine: Local Tales from a Suitcase. 33 Shoreham Road, Red Hill South 3937. T (03) 5989-8412. W www.montalto.com.au (member of ACGA) Free entry. H Daily. Gordon Studio Glassblowers To Oct 28 Montalto Sculpture Prize 2018. A Working Hot Glass Studio & Gallery Mornington Peninsula 290 Red Hill Road (cnr Dunns Creek Road), Red Hill Regional Gallery (MPRG) 3937. T (03) 5989-7073. E [email protected] Civic Reserve, Dunns Road, Mornington 3931. W www.gordonstudio.com.au H Daily 10.00 to 5.00. W mprg.mornpen.vic.gov.au See Melbourne entry for exhibition details. Oak Hill Gallery (map ref Melway 145 G10) 100 Mornington-Tyabb Road (adjacent to the Rose Gardens), Mornington 3931. T (03) 5973-4299. E [email protected] W www.oakhillgallery.com.au H Daily 11.00 to 4.00. Southern Buoy Studios 1/19 Carbine Way, Mornington 3931. T (03) 5932-4054. E [email protected] W southernbuoystudios.com.au H Mon-Sat 10.00 to 4.00. Aug 31 to Nov 17 Regional Women’s Exhibition works by Carly LeCerf, Helen McCullagh, Wendy McDonald, Sophie Perez and Winnie Sampi. Whistlewood Gallery | Contemporary Australian Art 642 Tucks Road, Shoreham 3916. T (03) 5989- 8282. E [email protected] W www.mccullochandmcculloch.com.au H Sat-Sun 11.00 to 4.00. Sept 1 to 29 (opening Sat Sept 1, 2.30pm) Durrmu: Weaving | Painting | Identity – new paintings, weavings and works on paper by established and emerging artists of Durrmu, Peppimenarti, NT. Opening event includes weaving Grant Donaldson, Encalmo Bottle, 2018, handblown glass Venetian demonstration plus in conversation with artists encalmo technique, carved and sandblasted, 60 x 26cm Regina Pilawuk Wilson and Kathleen Korda, Courtesy the artist and Gordon Studio Glassblowers Durrmu executive director Kade McDonald and co-curator Susan McCulloch. Bookings essential McClelland Sculpture Park mccullochart.eventbrite.com.au + Gallery (map ref Melway 103 E3) 390 McClelland Drive, Langwarrin 3910. T (03) 9789-1671. E [email protected] W www.mcclellandgallery.com Director: Lisa Byrne. Entry by donation. H Gallery, shop and café Tues-Sun 10.00 to 5.00. Victoria 115 Gippsland South East arc Yinnar Gallery 19 Main Street, Yinnar 3869. T (03) 5163-1310. W www.arcyinnar.org.au H Tues-Fri 12.00 to 4.00, Sat 11.00 to 3.00. Sept 15 to Oct 13 (opening Sat Sept 15, 2pm) Spring Fever an open entry exhibition. ArtSpace Wonthaggi 1 Bent Street, Wonthaggi 3995. T (03) 5672-5767. Emma Hearnes, Plunge, 2018, oil and graphite on canvas, E [email protected] 50.8 x 60.9cm W www.artspacewonthaggi.com.au Courtesy the artist and Gippsland Art Gallery H Daily 10.00 to 4.00. 2D and 3D contemporary and traditional art. Sept 4 to Oct 15 (opening Sun Latrobe Regional Gallery Sept 9, 2-4pm) Arts Print Exhibition – an exclusive 138 Commercial Road, Morwell 3840. selection of original limited edition prints created by T (03) 5128-5700 F 5128-5706. our Gippsland Printmakers. E [email protected] W latroberegionalgallery.com H Mon-Fri 10.00 to 5.00, Sat-Sun 11.00 to 4.00. Gecko Studio Gallery To Oct 7 Mineral | Art of Matter 1400-2000: and ArtHouse accommodation Highlights from Latrobe Regional Gallery Object 15 Falls Road, Fish Creek 3959. T (03) 5683-2481. Collection. To Oct 21 Richard Tipping: Art Word, E [email protected] Signs, Drawings, Typographs. To Oct 28 Beyond the W www.geckostudiogallery.com.au Valley – a voyage in time by Martine Corompt. Facebook: geckostudiogallery. H Thurs-Mon 9.00 to Sept 1 to Nov 25 Blurred Boundaries by Helle Cook. 4.00. Also including Headquarters Café. To Sept 17 So I see (postcard from Morocco) by Rita Lazauskas. Sept 20 to Oct 15 (opening Fri Sept 21, 6-8pm) Juxtaposition – four artists working with collage, a medium with a sense of revolutionary possibility – Maggie Malone, Harry Pullar, Chris Tuttle and Kerry Spokes. Gippsland Art Gallery 70 Foster Street, Sale 3850. T (03) 5142-3500. E [email protected] Beyond the Valley W www.gippslandartgallery.com H Mon-Fri 9.00 to Martine Corompt, , 2018, digital screen still Courtesy the artist and Latrobe Regional Gallery 5.30, Sat-Sun and public hols 10.00 to 4.00. To Sept 9 Call of the Wild – Wildlife art from the Gallery Collection. Also, Posthumous Tableaux by Maffra Exhibition Space Michelle Molinari. To Sept 16 Event Horizon by 150 Johnson Street, Maffra 3860. T Enquiries to Peter Gardiner. Also, Gunailand by Steaphan Paton. Gippsland Art Gallery (03) 5142-3500. H Mon, Wed- To Jan 20, 2019 The Art of Annemieke Mein. Fri 10.00 to 6.00, Sat 10.00 to 12.00, closed Tues Sept 15 to Nov 18 Connections to Country by and Sun. To Sept 3 Guiding Lights by Gippsland Art Dr Aunty Eileen Harrison. Also, Impressions of Gallery Volunteer Guides. Sept 6 to Oct 22 Actuality Gippsland by Kevin Lincoln. by Emma Hearnes. 116 Victoria Metropolis Gallery Geelong 64 Ryrie Street, Geelong 3220. T (03) 5221-6505. W www.metropolisgallery.com.au Director: Robert Avitabile. H Mon-Fri 9.00 to 5.00, Sat 10.00 to South West 4.00, Sun 12.00 to 4.00. Qdos Arts + Sculpture Park 35 Allenvale Road, Lorne 3232. T (03) 5289-1989. Great Ocean W www.qdosarts.com Director: Graeme Wilkie OAM. H Thurs-Mon 9.00 to 5.00. Art Intensive: Workshops: Road Sept 25, 26 and 27, Graeme Altmann – Oil Painting on Paper. Oct 9, 10 and 11, Phil Doggett-Williams – QDOS Drawing Intensive: Technique, Process and Bijou Gallery Invention. Oct 13, David Long – Dry Stone walling as Jenni Mitchell and sculpture or plinth. Oct 20 and 21, Jock Clutterbuck – Mervyn Hannan Drawing with the Mind’s Eye. Oct 27 and 28, Dianne Longley – Encaustic Workshop. Oct 30 and 31, and Petschel House, 107 Petschels Lane, Hamilton 3300. Nov 1, Rimona Kedem – Conservations with Self. Nov T 0417-585-102. W www.petschelhouse.com.au 13, 14 and 15, Shona Wilson – Collaborations with H Thurs-Sun, or by appt. Through Sept Jenni Nature. For all workshop details please call Qdos Mitchell and Mervyn Hannan selected works. Arts or visit website. On-site accommodation at Classes and workshops. student rates. Blarney Books & Art SCOPE Galleries 37 James Street, Port Fairy 3284. T (03) 5568-2174. 38 Kelp Street, Warrnambool 3280. E [email protected] T (03) 5561-4758, 0410-464-330 F 5561-5692. W www.blarneybooks.com.au E [email protected] W www.scopegalleries.com Instagram: blarneybooksandart. H Thurs-Sun 11.00 Director: Liza McCosh. H Sat-Sun 1.00 to 4.00, or by to 4.00. Unique book-related art space bookshop, in appt. Contemporary paintings, prints and sculpture. beautiful Port Fairy. Elizabeth Arthur Fine Art Warrnambool Art Gallery 26 Liebig Street, Warrnambool 3280. Gallery & Sculpture Garden T (03) 5559-4949. E [email protected] 35 Carmichael Street, Hamilton 3300. W www.thewag.com.au Director: Vanessa Gerrans. T (03) 5572-2851. E [email protected] H Mon-Fri 10.00 to 5.00, Sat-Sun and public hols Director: Dr Elizabeth Arthur. H Thurs-Fri 10.00 to 10.00 to 3.00. To Sept 23 The Warrnibald 2018. 6.00, Sun 12.00 to 4.00, or by appt. To Sept 30 Once Women Won the Vote by Danielle O’Brien and Marie Cook. To Oct 14 Code Breakers: Geelong Gallery Women in Games. Also, Humanise by Leah Heiss. 55 Little Malop Street, Geelong 3220. To Dec 2 On Country: Stories of Gunditjmara Elders. T (03) 5229-3645. W geelonggallery.org.au Director: Jason Smith. Free entry unless otherwise Wishart Gallery stated. H Daily 10.00 to 5.00. Sept 1 to Nov 25 19 Sackville Street, Port Fairy 3284. Cuttings by Elizabeth Gower. Sept 22 to Nov 18, T (03) 5568-2423. E [email protected] 2018 Archibald Prize (see ad page 16). W www.wishartgallery.com.au Art, Antiques, Bar. Geelong Library and Heritage Centre (The Dome) 51 Little Malop Street, Geelong 3220. T (03) 4201-0666. To Sept 8 Near & Far photographic works by Lynne Alderton and Tess Rice. Mon-Fri 8.00 to 8.00pm, Sat-Sun 10.00 to 5.00. Victoria 117 Central Victoria Ararat Gallery TAMA Town Hall, Vincent Street, Ararat 3377. T (03) 5355-0220 , . E [email protected] W ararat.vic.gov.au H Mon-Sun 10.00 to 4.00. Closed Good Friday, Christmas Day, Boxing Day and New Year’s Day. To Oct 28 Material Constructs: The Home Stretch by Sarah crowEST. Heidi Wood, Covici, Croatia, 2017, unsized digital image Art Gallery of Ballarat Courtesy the artist and Post Office Gallery 40 Lydiard Street North, Ballarat 3350. T (03) 5320-5858. E [email protected] Ballarat – Gallery on Sturt W artgalleryofballarat.com.au Free entry unless 421 Sturt Street, Ballarat 3350. T (03) 5331-7011. specified. H Daily 10.00 to 5.00. To Sept 9 Into E [email protected] Light: French masterworks from the Musée de la W www.galleryonsturt.com.au Chartreuse, Douai. A unique showcase of 19th and Director: Leigh Tweedie. H Mon-Fri 10.00 to 5.00, early 20th century paintings by French masters. Sat 10.00 to 2.00. Tickets available from the gallery website. Sept 1 to April 9, 2019 solis by Louiseann King – a re-imagining of two rooms of the gallery’s collection combining images of women and landscapes with contemporary works. Part of BOAA ART 2018. Sept 21 to Nov 6 BOAA ART 2018 – a city-wide celebration of contemporary art, as BOAA is the largest ever showcase of Australia’s living artists. Artists featured at the Art Gallery of Ballarat are Kim Anderson, Asher Bilu, Faridah Cameron, Gerwyn Davies, Phillip George, Marlene Gilson, David Jensz, Louiseann King, The Numina Sisters, Pip & Pop and Jason Sims. Full details at boaa.net.au (see ad page 28). Arts Academy, ϐ Federation University Australia, cnr Sturt and Lydiard streets, Ballarat 3350; PO Box 663, Ballarat 3353. T (03) 5327-8615. E [email protected] Murray Walker, The Artist’s Model, 1968, oil on canvas, W federation.edu.au/pogallery Curator: Shelley Hinton. 110.5 x 110.5cm Courtesy the artist and Ballarat – Gallery on Sturt H Wed-Sat 12.00 to 5.00. To Sept 15 Benchmark18: Arts Academy Undergraduate Visual Arts – FedUni’s Ballarat Arts Academy’s important annual exhibition Bendigo Art Gallery of recent work by Visual Arts students showcases the 42 View Street, Bendigo 3550. T (03) 5434-6088. skills of our next hot crop of designers, printmakers, E [email protected] ceramicists, painters and new-media artists, highlighting W www.bendigoartgallery.com.au Director: Karen the breadth and depth of their material investigations, Quinlan. Entry by donation unless specified. creative inquiry and visual expression within a broad H Gallery/shop daily 10.00 to 5.00. range of disciplines. Sept 22 to Nov 6 (opening Fri Sept To Sept 9 Paul Guest Drawing Prize. To Sept 16 21, 7pm) BOAA: Biennale Of Australian Art – Heidi Myuran Sukumaran: Another Day in Paradise. Wood: Off The Map. Paris-based Australian artist Heidi From Sept 22 Jessie Boylan: Rupture. Wood’s immersive new work will continue her ongoing curiosity about tourism and the unpopularity of tourist zones particularly within the ex-Soviet bloc. Creating her own promotional environment utilising a repertoire of commercial pictograms, mementos and symbols, Wood deliberately questions the very position of culture, the messages it can provide and the people it aims to target. Artist talk: Sat Sept 22, 1-2pm. 118 Victoria Biennial of Australian Art BOAA North W www.boaa.net.au/tickets Sept 21 to Nov 6 BOAA ART 2018 – presenting a showcase of 150+ artists from across Australia 65 curated solo exhibitions North East & presented throughout three ‘Art Villages’ within 14 of Ballarat’s heritage buildings and historic locations. Visit website for program and ticketing. North West See ad inside back cover. Art at Linden Gate Castlemaine Art Museum W www.artatlindengategallery.com.au 14 Lyttleton Street (PO Box 248), Castlemaine 3450. For exhibition details see Melbourne section. T (03) 5472-2292. E [email protected] W www.castlemainegallery.com Benalla Art Gallery H Thurs-Sun 12.00 to 5.00. (map ref Melway 619 D6) Botanical Gardens, Bridge Street West, Benalla 3672. T (03) 5760-2619. ϐ E [email protected] Old Fire Station, Neil Street, Maryborough 3465. W www.benallaartgallery.com.au H Daily 10.00 to T (03) 5460-4588. E [email protected] 5.00. Closed Tues, Good Friday, Christmas Day and W www.visitmaryborough.com.au H Thurs-Sun Boxing Day. To Sept 30 Ornament and Subject. 10.00 to 4.00. Central Goldfields Art Gallery is a To Nov 4 Looking But Not Seeing. cultural facility of the Central Goldfields Shire Council. From Sept 8 Jeff Makin-Survey a survey. The Goat Gallery 87A Main Street, Natimuk 3409. T 0417-307-824. Falkner Gallery W facebook.com/TheGoatGallery H Sat-Sun 1.00 to 35 Templeton Street, Castlemaine 3450. 4.00, or by appt. To Sept 2 A Sampler: SEALP After T (03) 5470-5858. E [email protected] School Art, Horsham College. Supported by Horsham W www.falknergallery.com.au H Wed 1.00 to 5.00, Rural City Council. Sept 7 to 16 Very Young Artists: Thurs-Sat 11.00 to 5.00, Sun by appt. To Oct 6 Natimuk Pre-school. Supported by Dr Rob Grenfell. Solitude oil paintings by Jan McNeill, and Fleet of Sept 21 to Oct 7 Folio: Studio Arts 2 & 4, Horsham Foot watercolours by Liz McLennan. College. Supported by Horsham Rural City Council. La Trobe Art Institute Horsham Regional Art Gallery 121 View Street, Bendigo 3550. T (03) 5444-7272. 80 Wilson Street, Horsham 3400. E [email protected] W www.latrobe.edu.au/ T (03) 5382-9575. E [email protected] art-institute H Mon-Fri 10.00 to 5.00, Sat 12.00 W www.horshamtownhall.com.au H Tues-Fri 10.00 to 5.00. Sept 18 to Oct 27 Artivisms Now featuring to 5.00, Sat 11.00 to 4.30, Sun 1.00 to 4.30. Caroline Garcia, Parallel Park, Pierra Van Sparkes and Xanthe Dobbie. Also, Chart Form featuring Mildura Arts Centre Ashley Mariani, Dylan Martorell, Sean Hogan and Yuria Okamura. 199 Cureton Avenue, Mildura 3500. T (03) 5018-8330. E [email protected] W www.milduraartscentre.com.au H Daily 10.00 MONDO ART to 5.00. To Dec 2 Considering Mildura: Mildura E [email protected] Sculpture Triennials, 1982-88: Mildura Arts Centre W www.mondoartgallery.com A marketplace and Collection. Also, Self-made: zines and artist books – consultancy of innovative, collectable, contemporary State Library Victoria. Aug 30 to Oct 14 Art Directions 2D and 3D art for commercial and private spaces, 2018 – Arts Educators. Sept 6 to Oct 21 Sense of with a focus on large-scale works. Place – Barbara Bennetts, Bronwen Gibbs, Dawna Richardson-Hyde and Sharron Shalekoff. Sept 6 to ϐ Oct 28 A Good Yarn 50 Years Long: 1968-2018 A satellite space of Bendigo The Embroiderers Guild, Victoria, Mildura Branch. Art Gallery 51-67 Pall Mall, Bendigo 3550. T (03) 5434-6179. E [email protected] W www.bendigoartgallery.com.au Director: Karen Quinlan. Entry by donation. H Daily 9.00 to 5.00. To Oct 7 Bankrolling Bendigo: building a city. Victoria 119 Shepparton Art Museum (SAM) (map ref Vic Roads map 273 L8 or 32 H8) 70 Warragul Welsford Street, Shepparton 3630. T (03) 5832-9861. E [email protected] W sheppartonartmuseum.com.au Region Director: Dr Rebecca Coates. Free entry. H Daily 10.00 to 4.00, public hols 1.00 to 4.00. Closed Bradley Hall Antiques Christmas Day, New Year’s Day and Good Friday. Join SAM on Facebook, Twitter and Instagram! To Nov 11, & Art Gallery 2018 Indigenous Ceramic Award (ICA) (see ad page Australian Studio of Gary Miles 51). Also, Subject / Object. 12 Old Telegraph Road West, Drouin West 3818. T (03) 5626-8355, 0407-443-606. Swan Hill Regional Art Gallery E [email protected] Horseshoe Bend, Swan Hill 3585. W www.garymilesart.com.au H Sat-Sun and public T (03) 5036-2430. E [email protected] hols 11.00 to 5.00 or by appt. Artist: Gary Miles. W www.facebook.com/swanhillregionalartgallery Gallery viewing of available paintings of past series. H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 4.00. Kerrie Warren, artist TarraWarra Museum of Art & Pilgrim Creek Studios W www.twma.com.au Crossover (East of Melbourne) See Melbourne entry for exhibition details. T 0411-480-384. W www.kerriewarren.com.au Large-scale paintings, ceramics, sculpture. Wangaratta Art Gallery 56 Ovens Street, Wangaratta 3677. T (03) 5722- Phil Henshall Studio 0865. E [email protected] 1116 Main Neerim Road, Rokeby 3821. W www.wangarattaartgallery.com.au Free entry. T 0418-318-187. W philhenshall.com.au H Tues-Sun 10.00 to 4.00, closed Mon. Office hours H Studio open the second weekend each month Mon-Fri 9.00 to 5.00, closed public hols and for 10.00 to 5.00. Exploring ASPECTIVISM™. exhibition installations. Wangaratta Art Gallery is a Sept 8 and 9 BEN HALL and other PERSONS OF Cultural Service of the Rural City of Wangaratta. INTEREST. Oct 13 to 14 ALTITUDE. To Sept 16 Gallery 2: Inside Out: Art Outreach program with Beechworth Correctional Centre. Sept 1 to Nov 18 Gallery 1: Mayoral Chain: A Red Tree Gallery Jindivick Craft Victoria Travelling Exhibition. Also, Local 420 Main Jindivick Road, Jindivick 3818. Links: A local artist response to the Rural City of T (03) 5628-5224. E [email protected] Wangaratta’s Mayoral Chain. W www.lauriecollins.com.au Ongoing Laurie Collins. 120 Victoria Graeme Altmann September 25, 26, 27 Oil painting on Paper Explore how to ‘see’ the landscape, develop your own style and creative expression through the medium of oil paint on paper. Phil Doggett-Williams October 9,10,11 QDOS Drawing Intensive: Technique, Process and Invention This workshop presenting a series of scaffolded drawing lessons teaching foundation skills and advanced. Jock Clutterbuck October 20, 21 Drawing with the Mind’s Eye Art is created from a sacred, special place in one’s mind, drawing on the mind’s eye is a way to access that space learning how to see differently and powerfully is fundamental to what we do as Artists. David Long October 13 Dry Stone walling for sculpture or plinth Lectures, demonstrations, a hands-on understanding of straight and curved walling. Dianne Longley October 27, 28 Encaustic Workshop Using photographs or drawings on wooden panels Rimona Kedem October 30, 31, November 1 Conservations with Self This workshop provides you with strategies for tapping into the unconscious pictorial vocabulary by overcoming the blocks that keep one from expressing one self freely. Shona Wilson November 13, 14, 15 Collaborations with Nature The intersects between nature, science, spirit, and art are potent environments to research and play creatively within. Art making can become Ceremony. For all Workshop details, please call Qdos Arts 52891989 or visit www.qdosarts.com On site accommodation at student rates. LORNE Sydney 122 The Ken Done Gallery CBD 1 Hickson Road, The Rocks 2000. T (02) 8274-4500 F (02) 8274-4545. E [email protected] W www.kendone.com.au H Daily 10.00 to 5.30. Our recent hang in The Ken Done Gallery features some The Rocks colourful, new Sydney Harbour paintings and a mix of new reef canvases. Complimenting these are some Art Gallery of New South Wales quintessential Sydney drawings and small canvases of Chinamans Beach alongside pen and ink sketches to (AGNSW) complete the show. Limited edition prints, posters and Art Gallery Road, Sydney 2000. T (02) 9225-1744, other art related products are available for sale in the 1800-679-278. W www.artgallery.nsw.gov.au gallery shop including the artist’s latest publication Admission charges apply to some exhibitions. ‘Ken Done: Paintings you probably haven’t seen’. H Daily 10.00 to 5.00. Art After Hours: Wed to 9pm. To Sept 9 Archibald, Wynne and Sulman Prizes 2018. Also, Henry VR. To Oct 21 Playback: Dobell Korean Cultural Centre Australian Drawing Biennial 2018. Australia Gallery Also, Spacemakers and roomshakers: installations Ground Floor, 255 Elizabeth Street, Sydney 2000. from the collection. To Nov 11 John Russell: T (02) 8267-3400. E [email protected] Australia’s French impressionist. To Jan 13, 2019 W www.koreanculture.org.au Fearless: contemporary South Asian art. Sept 8 to H Mon-Fri 10.00 to 6.00. March 24, 2019 William Kentridge: that which we do not remember. Museum of Contemporary Art Australia (MCA) The Art of Dr. Seuss 140 George Street, The Rocks 2000. presented by Harvey Galleries, T (02) 9245-2400. W www.mca.com.au QVB Free entry. H Mon-Tues 10.00 to 5.00, Wed 10.00 Queen Victoria Building , Level 2, 33-35 / 455 to 9.00, Thurs-Sun 10.00 to 5.00. To Sept 23 John George Street, Sydney 2000. T (02) 9261-0275. Mawurndjul: I am the old and the new. To Oct 14 E [email protected] Sun Xun. Now Showing MCA Collection: Today W www.harveygalleries.com.au H Mon-Wed 10.00 Tomorrow Yesterday. See ads pages 10 and 11. to 6.00, Thurs 10.00 to 8.00, Fri-Sat 10.00 to 6.00, Sun 11.00 to 5.00. Authorised editions from the Seuss Estate. Gaffa Gallery 281 Clarence Street, Sydney CBD 2000. T (02) 9283-4273. W www.gaffa.com.au H Mon-Fri 10.00 to 6.00, Sat 11.00 to 5.00. Closed Sun and public hols. Gaffa is an independent creative precinct, artist-run in attitude and execution. Aug 30 to Sept 10 Distant Lands and Familiar Shores – Elesa Bennett, Harriet Loneragan, Carol Roche, Kaye Shumack and Jo Willcocks. Also, In Camels’ Footsteps – Leah Hardy, Emily Copp, Elizabeth Mitchell, Fiona Meller, Toni Mosley and Andrew Welch. Also, Space and John Mawurndjul: I am the old and the new, Museum of Silence by Alicia Douglas. Sept 13 to 24 Wanderlust Contemporary Art Australia, installation view – Robin Moon, Timothy Moon, Kath Salier and Roger Photograph: Jessica Maurer Wood. Also, Beckoning by Melinda Giblett. Also, Past Courtesy the artist and Museum of Contemporary Art Australia and Present by Mark Dober and Elizabeth Nelson, and The Becoming by Sean Peters. Sept 27 to Oct 8 the girl with a rabbit ring by Emma Beer. Also, Bittersweet by Melinda Clyne, New World by Katrina Lezaic, and Indirect Landscapes by Gabrielle Freer. Sydney 123 Museum of Sydney Cnr Phillip and Bridge streets, Sydney 2000. T (02) 9251-5988 . W sydneylivingmuseums.com.au Free with Museum entry, Adults $12, Conc $8, Family $30, Members Fee. H Daily 10.00 to 5.00. Closed Good Friday and Christmas Day. Sept 1 to Nov 25 Bohemian Harbour: Artists of Lavender Bay – artists include Brett Whiteley, Peter Kingston, Tom Carment, Philip Cox, Joel Elenberg, Robert Jacks, Rollin Schlicht, Garry Shead and Tim Storrier. William Robinson, The blue pools, Springbrook to Beechmont, 2000, oil on linen 206.5 x 263cm QUT Art Collection purchased through the William Robinson Art Collection Fund, 2013 Courtesy S.H. Ervin Gallery State Library of NSW Cnr Shakespeare Place and Macquarie Street, Sydney 2000. T (02) 9273-1414. W www.sl.nsw.gov.au/ galleries Free entry. H Mon-Thurs 9.00 to 8.00, Fri 9.00 to 5.00, Sat-Sun 10.00 to 5.00. Be the face of NSW – share your portrait on Instagram using #NewSelfWales to be featured in our new exhibition galleries, opening Oct 6. See ad page 8. Sydney Sculpture Conference: Brett Whiteley, Seagull over Lavender Bay, 1979, oil and mixed a universal language media on board, 87.5 x 82.5cm Sydney Opera House, Bennelong Point, Sydney 2000. © Wendy Whiteley W www.sculpturebythesea.com Courtesy Sotheby’s Australia and Sydney Living Museums, Sydney Mon Nov 5, 9.30am to 5.30pm International and Australian scholars and artists, with a panel of S.H. Ervin Gallery academics and artists from CAFA, China’s leading National Trust of Australia (NSW), Watson Road, tertiary art school, come together to discuss the Observatory Hill, The Rocks 2000. T (02) 9258-0173. importance, impact, challenges and opportunities E [email protected] of sculpture. This annual conference coincides with W www.shervingallery.com.au H Tues-Sun 11.00 the 22nd Sculpture by the Sea, Bondi exhibition, to 5.00. To Oct 7 William Robinson: Genesis. on from Oct 18 to Nov 4. Visit the website for William Robinson is recognised as one of Australia’s information and ticketing. See ad page 30. most important contemporary landscape painters, celebrated in particular for his original and powerful Vermilion Contemporary approaches to depicting the Australian environment Chinese Art through a multi-dimensional viewpoint. For over five 5/16 Hickson Road, Walsh Bay 2000. decades he has produced works of great originality T (02) 9241-3323. E [email protected] and vision that have informed a new vernacular of WWH www.vermilionart.com.au Tues-Sat 11.00 to 7.00. the Australian landscape. William Robinson: Genesis brings together a selection of more rarely seen works alongside those that have been exhibited more widely, allowing the viewer to clearly see the development of Robinson’s distinctive use of colour and move towards the multidimensional perspective for which his large landscape paintings are so acclaimed. A QUT William Robinson Gallery travelling exhibition. Supported by the Meij Family Foundation, Philip Bacon AM and Stuart Purves AM of Australian Galleries. 124 Sydney Exhibition on now • Museum of Sydney Sydney Contemporary Chippendale Carriageworks 245 Wilson Street, Eveleigh 2015. W www.sydneycontemporary.com.au Sept 13 to 16 Central Featuring over 80 galleries accompanied by packed program of events including; curated exhibitions, panel discussions, guided tours, workshops, The Commercial performance, video and more, Sydney Contemporary 148 Abercrombie Street, Redfern 2016. celebrates the vibrance and diversity in current and T (02) 8096-3292. E [email protected] emergent contemporary arts practice. General open W www.thecommercialgallery.com Director: Amanda hours: Thurs 13th, 12 to 5pm. Fri 14th, 12 to 8pm. Rowell. H Wed-Sat 11.00 to 6.00. Please visit our Sat 15th, 11am to 6pm. Sunday 16th 11am to 6pm. website for current exhibition information. Visit the website for program and ticketing. See ad page 38. 4A Centre for Contemporary Asian Art UTS Gallery University of Technology Sydney, Level 4, 702 Harris 181-187 Hay Street, Haymarket, Sydney 2000. Street, Ultimo 2007. T (02) 9514-1652. T (02) 9212-0380. W www.4a.com.au Free entry. E [email protected] W art.uts.edu.au H Tues-Fri 11.00 to 5.00, Thurs nights to 8.00, Senior Curator: Tania Creighton. H Mon-Fri 12.00 to Sat-Sun 11.00 to 4.00. Aug 31 to Oct 14 (opening 6.00, Sat 12.00 to 4.00. To Sept 14 Hello World: Thurs Aug 30, 6-8pm) Temporary Certainty – Rushdi Code and Design, curated by Aaron Seymour. Sept Anwar, Alana Hunt and Sarker Protick. Curated by 25 to Nov 16 Void, curated by Emily McDaniel. Pedro de Almeida. Please Explain panel discussion: Census, Map, Museum: Sat Sept 1, 2-3.30pm. Congee Breakfast Tour: Sat Sept 22, 10.30am. White Rabbit Gallery 30 Balfour Street (near Central Station), Galerie pompom Chippendale 2008. T (02) 8399-2867. W www.whiterabbitcollection.org H Wed-Sun 10.00 2/39 Abercrombie St, Chippendale 2008. to 5.00. Gallery closed until Sept 6 inclusive. From T 0430-318-438. E [email protected] Sept 7 Supernatural – a journey through the reshaped W www.galeriepompom.com H Wed-Sat 11.00 to Chinese landscapes of the 21st century. 5.00, Sun 1.00 to 5.00, or by appt. Sept 19 to Oct 14 In Time by Mimi Tong. Performance Space Carriageworks, Level 2, 245 Wilson Street, Eveleigh East Sydney 2042. T (02) 8571-9111. E [email protected] APY Gallery W www.performancespace.com.au Presenting a 45 Burton Street, Darlinghurst 2010. program for experimental art practice. Visit website E [email protected] for more info. W www.apygallery.com H Mon-Fri 9.00 to 5.00, Sat 10.00 to 4.00, Sun by appt. The APY Gallery is a Sheffer Gallery platform for emerging Indigenous artists from the APY 38 Lander Street, Darlington 2008. Art Centre Collective. www.apyartcentrecollective.com T (02) 9310-5683. E [email protected] W www.sheffergallery.com H Wed-Sat 11.00 to 6.00. ARO Sept 12 to 15 Matt Bromhead. 51 William Street, Darlinghurst 2010. Sept 19 to 29 Philippa Johnson. T 0414-946-894. E [email protected] W www.arogallery.com H Tues-Fri 12.00 to 6.30, Sat-Sun 12.00 to 5.00. Sept 4 to 16 (opening Tues Sept 4, 6-8pm) Votives painted offerings and wood engravings by Ian Kingsford-Smith. www.iankingsfordsmith.com See ad page 143. 126 Sydney Arthouse Gallery Australian Design Centre 66 McLachlan Avenue, Rushcutters Bay 2011. 101/113-115 William Street, Darlinghurst 2010. T (02) 9332-1019. E [email protected] T (02) 9361-4555. E hello@australiandesigncentre W www.arthousegallery.com.au H Tues-Fri 9.30 W www.australiandesigncentre.com H Tues-Sat, to 6.00, Sat 10.00 to 5.00. To Sept 15 In the 11.00 to 4.00, and by appt. To Sept 26 Urban Decay beginning there were stars by Leah Fraser. Sept 13 by Joshua Smith – miniature models of overlooked to 16 Sydney Contemporary Carriageworks, Stand buildings, the grime, decay and graffiti. F03: Surface Immersion by Emma Walker. Also, Group Show featuring Janet Beckhouse, Fabrizio Biviano, Michaye Boulter, Samantha Everton, Belinda Fox, Katherine Hattam, Aaron Kinnane, Kendal Murray and Joshua Yeldham. Sept 27 to Oct 20 The River Passes by Dean Home. Joshua Smith, Dumpster, 2018, mixed media consisting of cardboard, paper, plastic, weathering pigments and styrene Graffiti artists: Disco Rice and Vader Photograph: Rhiannon Hopley Courtesy the artist and Australian Design Centre Emma Walker, Immersion, oil and acrylic on carved board, 180 x 150cm Courtesy the artist and Arthouse Gallery Artspace 43-51 Cowper Wharf Road, Woolloomooloo 2011. T (02) 9356-0555. E [email protected] W www.artspace.org.au H Mon-Fri 11.00 to 5.00, Sat-Sun 11.00 to 6.00. Visit website for exhibition program. Australian Centre for Photography Project Space Gallery 72 Oxford Street, Darlinghurst 2010. T (02) 9332-0555. E [email protected] W www.acp.org.au Free entry. H Tues-Fri 10.00 to 5.00, Sat 11.00 to 4.00. Closed public hols. Sydney 127 The Cross Art Projects Gallery 9 8 Llankelly Lane (off Orwell Street), Kings Cross 9 Darley Street, Darlinghurst 2010. 2011. T (02) 9357-2058, 0406-537-933. T (02) 9380-9909. E [email protected] E [email protected] W www.crossart.com.au W www.gallery9.com.au Director: Allan Cooley. Director: Jo Holder. H Thurs-Sat 11.00 to 6.00. Manager: Octavia Knox. H Wed-Sat 11.00 to 6.00, Sept 21 to Oct 20 Abuzz: Jacqueline Rose with Sun-Tue by appt. Sept 5 to 29 (opening Wed Sept 5, words by Johanna Featherstone. 6-8pm) Ry David Bradley. Fine Arts, Sydney King Street Gallery on William Suites 204 & 205, 20-22 Bayswater Road, Potts 177 William Street, Darlinghurst 2010. Point 2011. T (02) 9361-6200. T (02) 9360-9727. E [email protected] E [email protected] W www.finearts.sydney W www.kingstreetgallery.com.au H Tues-Sat 10.00 H Wed-Sat, 12.00 to 6.00. To Sept 22 Choux: Still to 6.00. To Sept 8 Paris windows by Wendy Sharpe. Lifes, 2006-2018 by Yvonne Todd. Sept 11 to Oct 6 Jumaadi and Myfanwy Gullifer. Firstdraft Liverpool Street Gallery 13-17 Riley Street, Woolloomooloo 2011. 243a Liverpool Street, East Sydney 2010. T (02) 8970-2999. E [email protected] T (02) 8353-7799. E [email protected] W www.firstdraft.org.au H Wed-Sun 12.00 to 6.00. W www.liverpoolstgallery.com.au Director: James An artist run organisation for emerging and Erskine. H Tues-Sat 10.00 to 6.00. Aug 31 to Sept experimental art practice. Visit website for 26 (opening Sat Sept 1, 2-5pm) Interior Decorating exhibition program. by Roy Batty by Nick Collerson. Frances Keevil Gallery NAS Gallery Bay Village, 28-34 Cross Street, Double Bay 2028. Forbes Street, Darlinghurst 2010. T (02) 9339-8686. T (02) 9327-2475. E [email protected] E [email protected] W www.nas.edu.au/place/ W www.franceskeevilgallery.com.au H Tues-Sat gallery Free entry. H Mon-Sat 11.00 to 5.00. 10.00 to 5.00, Sun 11.00 to 4.00. Sept 5 to 23 Paradiso by Diana Watson. See ad page 17. 1 September - 1 October Discover Rookwood Cemetery and immerse yourself in an array of outdoor sculptures that explore history, culture, remembrance and love. Diana Watson, Saskia, oil on linen, 122 x 122cm Courtesy the artist and Frances Keevil Gallery FREE ENTRY sunrise to sunset 128 Sydney National Association Stanley Street Gallery for the Visual Arts (NAVA) 1/52-54 Stanley Street, Darlinghurst 2010. T (02) 9368-1900. E [email protected] T (02) 9368-1142. E [email protected] W www.nava.net.au NAVA is the peak body W www.stanleystreetgallery.com.au Directors: Merilyn representing and advancing the professional interests Bailey and Liza Feeney. H Wed-Sat 11.00 to 6.00. of the Australian visual arts, craft and design sector. To Sept 8 Drawings and Jewellery by Margaret West. This exhibition marks the first solo showing of West’s work since her death four years ago. It has been Robin Gibson Gallery eagerly awaited, since it offers the opportunity to look 278 Liverpool Street, Darlinghurst 2010. again at West’s tough and loving vision of the world. T (02) 9331-6692. W www.robingibson.net Sept 12 to Oct 6 Interfacing by Tom Christophersen H Tues-Sat 11.00 to 6.00. and Michael Simms. Sept 13 to 16 Sydney Sept1to26Martin Edge and Geoff Harvey. Contemporary Art Fair: David Collins, Amy Dynan, Jackson Farley and Shaun Hayes. STACKS Projects 191 Victoria Street, Potts Point 2011. E [email protected] W www.stacksprojects.com Directors: Chloe Gunn, Zachary Harold, Annelies Jahn, Jane Lush and Joanne Makas. H Thurs-Sat 11.00 to 6.00, Sun 11.00 to 4.00. To Sept 9 Revisiting the Corpse: A Year in Drawing – Jan Handel, Jane Lush, Di Strange and Lisa Woolfe. Sept 13 to 16 STACKS will be participating in this years Sydney Contemporary at Carriageworks, presenting artists Anthony Hodgkinson and Nadia Odlum (see ad page 139). Sept 13 to 23 (opening Sat Sept 15, 2-4pm) Sydney Contemporary at STACKS Potts Point, presenting artists Susan Andrews and Henry Curchod (see ad page 139). Sept 24 to Oct 7 STACKS Project Space: Joanne Makas will stage an investigation into the convergence between mapping body movements and material forms. Margaret West, Drawings in paint for Fatal flowers, 2004, gouache, 27 x 19.7cm Photograph: Catherine Rogers Courtesy the artist and Stanley Street Gallery UNSW Galleries UNSW Art & Design, Oxford Street (cnr of Greens Road), Paddington 2021. T (02) 8936-0888. E [email protected] W www.artdesign.unsw.edu.au/unsw-galleries H Tues-Sat 10.00 to 5.00. To Sept 8 Make Known: The Exquisite Order of Infinite Variation. To Sept 15 Local Colour: Experiments in Nature. Sept 29 to Nov 3 John Fries Award (see ad page 39). Also, The Freedman Foundation Scholarship Award. Exhibition projects: Beth Dillon, David Eastwood, Chelsea Lehmann and Kynan Tan. Watters Gallery 109 Riley Street, East Sydney 2010. T (02) 9331-2556. E [email protected] W www.wattersgallery.com H Tues and Sat 10.00 Susan Andrews, Topsy-Turvy, 2018, acrylic on ply, 50 x 50 x 8cm Courtesy the artist and STACKS Projects to 5.00, Wed-Fri 10.00 to 7.00. Sept 5 to 22 John Peart: paintings from the estate. From Sept 26 Derek O’Connor: Human Smoke. Also, Euan Macleod: PAPER, and Fiona Fell: From Shadow to Shadow, and Euan Macleod & Gregory O’Brien: Collaborations. Artist talk: Greg O’Brien and Euan Macleod, Wed Sept 26, 5.30pm. 130 Sydney Anniebell Marrngamarrnga, Namarnkorl (Barramundi), 2018, pandanus and natural dyes, 27 x 86cm Djang in Fibre: From Bim to Form Fibre art from Maningrida 1/24 Wellington Street, Waterloo NSW 2017 telephone 612 9699 2211 Tues-Sat 11.00-5.00 September email info@aboriginalpacificart.com.au exhibition web www.aboriginalpacificart.com.au Sydney 131 Yuill/Crowley Yellow House, 57-59 Macleay Street, Potts Point 2011. T 0418-634-712. E [email protected] W www.yuillcrowley.com H Wed-Fri 11.00 to 6.00, Sat 11.00 to 4.30. Sept 6 to Oct 6 this time now – et al. Redfern Surry Hills Green Square Ƭ ϐ 1/24 Wellington Street, Waterloo 2017. T (02) 9699-2211. E [email protected] Floria Tosca, Aphrodite, 2018, acrylic on canvas,107 x 83cm W www.aboriginalpacificart.com.au Director: Gabriella Courtesy the artist and Flinders Street Gallery Roy (member of ACGA). H Tues-Sat 11.00 to 5.00. Through Sept Djang in Fibre: From Bim to Form. m2 Gallery Fibre art from Maningrida. See ad page 131. 450 Elizabeth Street, Surry Hills W m2gallery.com.au Sept 13 to 17 Unpublished [and rarely seen] Works Artbank, Sydney by Jeffrey Hamilton – gestural abstract works on 222 Young Street, Waterloo 2011. T (02) 9697-6000. paper, collage and stained glass. Thurs-Tues 9am to E [email protected] W www.artbank.gov.au 6.30pm. www.stainedglass.com.au See ad page 137. H Mon-Fri 9.00 to 5.00. MAY SPACE Brett Whiteley Studio 409b George Street, Waterloo 2017. 2 Raper Street, Surry Hills 2010. T (02) 9225-1881. T (02) 9318-1122. E [email protected] E [email protected] W www.mayspace.com.au H Tues-Sat 10.00 to W www.brettwhiteley.org Free admission made 5.00. Sept 5 to 22 Charlie Sheard. Sept 13 to 16 possible by J.P. Morgan. H The Studio is open to the Sydney Contemporary, booth F01: Charlie Sheard. public Fri-Sun 10.00 to 4.00. The Brett Whiteley From Sept 26 Julie Brooke, Kevin McKay and Claire Studio is managed by the Art Gallery of New Anna Watson. South Wales. ϐ 270 Devonshire Street, Surry Hills 2010. T (02) 9557-8483. E [email protected] W www.defiancegallery.com Directors: Campbell Robertson-Swann and Lauren Harvey. H Tues-Fri 11.00 to 5.00, Sat-Sun 10.00 to 1.00. Sept 23 to Oct 19 (opening Sun Sept 23, 10am-1pm) Six Artists | Seven Days: The AWC Newhaven Exhibition. Defiance Gallery in conjunction with the Australian Wildlife Conservancy and Lea and Bill Ferris. See ads inside front cover and page 3. Flinders Street Gallery 61 Flinders Street, Surry Hills 2010. T (02) 9380-5663. E [email protected] W www.flindersstreetgallery.com H Wed-Sat 11.00 to 6.00, or by appt. Sept 6 to 29 Floria Tosca. Charlie Sheard, Pure Abstraction [Eldreyik], 2017-2018, oil and acrylic on polyester, 214 x 198cm Courtesy the artist and MAY SPACE 132 Sydney kate owen gallery colours of spring ‘Bush Plum’ by Polly Ngale (192 x 295 cm) 25 august - 23 september an exciting curation of handpicked artworks a burst of colour and a breath of fresh air shake off the winter blues and celebrate spring www.kateowengallery.com free fully insured worldwide delivery (rolled) kate owen gallery 680 darling street rozelle nsw 2039 (02) 9555 5283 open 7 days 10-6 [email protected] Michael Reid Sydney Sullivan+Strumpf Standard House, 105 Kippax Street (enter from Waterloo 799 Elizabeth Street, Zetland 2017. Street), Surry Hills 2010. T (02) 8353-3500. T (02) 9698-4696. E [email protected] W www.michaelreid.com.au Directors: Michael Reid, W www.sullivanstrumpf.com Directors: Ursula Toby Meagher and Will Sturrock. H Wed-Sat 11.00 to Sullivan and Joanna Strumpf. H Tues-Sat 10.00 5.00. Aug 29 to Sept 29 Alesandro Ljubicic. to 5.00, or by appt. To Sept 15 The Waves – a Sept 1 to 29 Michael Reid Murrurundi: John group exhibition. Curated by Kate Britton. Panel Honeywill. Sept 12 to 16 Sydney Contemporary. discussion: Sat Sept 15, 10am, mediated by Kate Britton at Sullivan+Strumpf Sydney. To Sept 23 Soho Waterloo Sullivan+Strumpf Singapore: Reminiscence by Fx Harsono. Sept 13 to 16 Sydney Contemporary, Waterloo Design Centre, 105/197 Young Street, Carriageworks. Sept 28 to Oct 20 (opening Fri Sept Waterloo 2017. T (02) 9326-9066 F 9358-2939. 28, 6-8pm) Cargo by Alex Seton. E [email protected] W www.sohogalleries.net H Daily trading, closed public holidays. Sept 1 to Oct 5 (opening Sat Sept 15, 2-4pm) Utopia Art Sydney Towards the Clouds by Marshall Williams – paintings 72 Henderson Rd, Alexandria 2015. and group sculpture exhibition. T (02) 9699-2900. E [email protected] W www.utopiaartsydney.com.au Director: Christopher Hodges. H Tue-Sat 10.00 to 5.00. Sept 1 to 29 (opening Sat Sept 1, 3-5pm) Satellites: Objects in Space by Helen Eager – reveals complex forms floating in a field of white, weighed down by the tension created between the bold and vibrant colours and shapes. Inner West Marrickville Balmain Marshall Williams, Stern View, acrylic on canvas, 167 x 107cm Courtesy the artist and Soho Galleries AIRspace Projects Stella Downer Fine Art 10 Junction Street, Marrickville 2204. 1/24 Wellington Street, Waterloo 2017. T 0438-020-661. E [email protected] T 0402-018-283. E [email protected] W www.airspaceprojects.com.au Directors: Sally W www.stelladownerfineart.com.au H Tues-Fri 10.00 Clarke and Brenda Factor. H Thurs-Fri 11.00 to 6.00, to 5.00, Sat 11.00 to 5.00. Sept 4 to Oct 6 (opening Sat 11.00 to 5.00 first three weeks each month. Sept Sat Sept 8, 3-5pm) Ceramics by Richard Spoehr and 7 to 22 Gallery 1: Anthony Cahill and Pollyxenia Prue Venables. Joannou. Gallery 2: Janelle Evans. The Cranny: Michelle Le Dain. Deep Space: Angela Butler. AIRSEUM: Season 2. FLAGspace: Paula do Prado. Annandale Galleries 110 Trafalgar Street, Annandale 2038. T (02) 9552-1699. E [email protected] W www.annandalegalleries.com.au Directors: Bill Gregory and Anne Gregory (members of ACGA). H Tues-Sat 11.00 to 5.00. To Sept 22 New Paintings, Drawings, and The Figure by Geoffrey de Groen. Also, New Pastels in the Project Space by David Altman. Oct 2 to Dec (opening Sat Oct 6, 6.30-8.30pm) Right Into Her Arms: drawings, sculpture and installation by William Kentridge. Preview: October 2 to 6. Richard Spoehr, The Soup Is Getting Cold, 2018, six porcelain pieces, variable dimensions Courtesy the artist and Stella Downer Fine Art 134 Sydney Artereal Gallery ϐ 747 Darling Street, Rozelle 2039. T (02) 9818-7473. 47 Enmore Road, Newtown 2042. E [email protected] W www.artereal.com.au T (02) 9557-8483. E [email protected] Director: Luisa Catanzaro. H Wed-Sat 11.00 to 5.00. W www.defiancegallery.com Directors: Campbell Sept5to29A Profound Gravity by Zan Wimberley. Robertson-Swann and Lauren Harvey. H Wed-Sat Also, Coincidence of Identity by Emily Sandrussi. 11.00 to 5.00. Sept 12 to Oct 20 (opening Wed Sept 12, 6-8pm) Group Exhibition – Ivor Fabok, Peter Articulate project space Godwin, Clara Hali, Roy Jackson, Kevin Norton, Dave Teer, Ann Thomson, Peter Powditch, Joe 497 Parramatta Road (opposite Cass Bros), Furlonger, Ana Pollak and Alison Coates. Leichhardt 2040. W articulate497.blogspot.com.au articulateupstairs.blogspot.com.au. H Fri-Sun 11.00 to 5.00. To Sept 9 String Along a group show Factory 49 featuring Helen Amanatiadis, Cathy Ball, Patricia 49 Shepherd Street, Marrickville 2204. Flanagan, Jody Graham, Judy-Ann Moule, Christine T (02) 9572-9863. E [email protected] Wiltshire and Marcelo Zavala-Baeza. Sept 15 to W factory49.blogspot.com H Thurs-Sat 1.00 to 6.00. 30 (opening Fri Sept 14, 6-8pm) De-Interlaced by Sept 12 to 22 Pamela Leung. Sept 26 to Oct 6 Max Kenneth Craig Lambert. Articulateupstairs:to9 Lawrence White. Sept Navigation 3: Caitlin Hespe – Which Way by Caitlin Hespe. Sept 15 to 30 (opening Fri Sept 14, Glass Artists’ Gallery (upstairs) 6-8pm) Navigation – Rebecca Gallo, Sara Morawetz, Vanessa Berry, Judy Marsh, Margaret Seymour and Gauge Gallery (street level) Mollie Rice with writer Nadia Odlum. Curated by 68 Glebe Point Road, Glebe 2037. Nadia Odlum. T/F (02) 9552-1552. E [email protected] W www.glassartistsgallery.com.au www.gaugegallery.com.au. H Tues-Sat 10.00 to Artsite Galleries 5.30, Sun 1.00 to 5.00. 165 Salisbury Road, Camperdown 2050. T (02) 8095-9678. E [email protected] W www.artsite.com.au/whats-on-now.php Kate Owen Gallery H Wed-Sun 11.00 to 5.00 during exhibitions. 680 Darling Street, Rozelle 2039. T (02) 9555-5283. E [email protected] W www.kateowengallery.com Member of the Boomalli Aboriginal Artists Aboriginal Art Association of Australia. H Daily Co-operative 10.00 to 6.00. Kate Owen Gallery is a multiple 55-59 Flood Street, Leichhardt 2040. award-winning gallery specialising in contemporary T (02) 9560-2541. E [email protected] Aboriginal art. Artworks range from small affordable W www.boomalli.com.au works to large investment pieces. Three light-filled www.facebook.com/boomalligallery, floors showcase major exhibitions of Indigenous www.instagram.com/boomalliartgallery H Wed-Sun masters, established artists and new talent. The 11.00 to 4.00. Sept 12 to Oct 21 (opening Wed Sept ground breaking Collectors’ Gallery is dedicated 12, 6-8pm) Healing Our People, Healing Our Land to museum-quality works from Australia’s leading Exhibition. As Aboriginal people we naturally care for Indigenous artists. To Sept 23 KOG Presents Colours our mob and homelands. This exhibition is about the of Spring – a burst of colour and a breath of fresh air healing of our people and healing of our country. to shake off the winter blues and celebrate spring. Kate Owen Gallery staff have chosen their favourite pieces for this show from leading artists including Gloria Petyarre, Barbara Weir, Kudditji Kngwarreye and Polly Ngale. See ad page 133. Sharon Smith, Trees of our ancestors, acrylic on canvas, 91 x 122cm Courtesy the artist and Boomalli Aboriginal Artists Co-operative Sydney 135 Kerrie Lowe Gallery Grace Cossington Smith Gallery 49-51 King Street, Newtown 2042. T (02) 9550- Gate 7, 1666 Pacific Highway, Wahroonga 2076. 4433 F 9550-1996. E [email protected] T (02) 9473-7878. W www.gcsgallery.com.au W kerrielowe.com H Mon-Sat 10.00 to 5.30, Thurs facebook.com/gcsgallery Free entry. H Mon-Fri 10.00 to 7.00, Sun 12.00 to 4.00. To Sept 16 The 10.00 to 5.00, Sat 9.00 to 4.00. Sept 4 to Oct 3 Sydney Teapot Show – a competition and exhibition (opening Sat Sept 8, 2-4pm) Unconscious Places: featuring eccentric, extraordinary, inventive and Photography and History – Jane Brown, Richard amusing handmade ceramic teapots (see ad page Glover, Lynne Roberts-Goodwin and Kurt Sorensen 141). Sept 21 to Oct 16 Form / Surface / Structure – – this exhibition considers the ways in which an exhibition of ceramic sculpture. photography can capture traces of the history of places and events that occurred at the site before the McGlade Gallery at the photograph was taken. Curated by Donna West Brett. Australian Catholic University Mount St. Mary, Gate 3, 25a Barker Road, Strathfield 2135. T (02) 9701-4256. W www.acu.edu.au H Mon-Sat 11.00 to 4.00 during exhibition periods. SCA Galleries Sydney College of the Arts Balmain Road (enter opposite Cecily Street), Rozelle 2040. T (02) 9351-1008. E [email protected] W sydney.edu.au/sca Free admission. H Mon-Fri 11.00 to 5.00, Sat-Sun 11.00 to 4.00 (during exhibitions). Sept 21 to 22 (opening Thurs Sept 20, 6-8pm) HDR Examination Exhibition. The Shop Gallery 112 Glebe Point Road, Glebe 2037. T 0438-550-835. E [email protected] Kurt Sorensen, Widows Creek 1910 # 4, 2010, Cibachrome print, W www.theshopgalleryglebe.com Visit website for 60 x 60cm exhibition program. Courtesy the artist and Grace Cossington Smith Gallery Yellow Dot Art Gallery Harvey Galleries Shop 3-4, 654-670 King Street, Newtown 2042. Mosman T 0413-319-293. E [email protected] 842 Military Road, Mosman 2088. W yellowdotartgallery.com Director: Yvette Linton- T (02) 9968-2153. E [email protected] Smith. H Wed-Sun 10.00 to 5.00. To Sept 30 Coded W www.harveygalleries.com.au H Tues-Sat 11.00 by Judith Duquemin. See ad page 131. to 6.00, Sun 12.00 to 5.00. Select key works from important artists. Harvey Galleries Nth Sydney Seaforth 515 Sydney Road, Seaforth 2092. T (02) 9907-0595, 0408-359-199. F 9907-0657. Northern E [email protected] W www.harveygalleries.com.au H Wed-Sat 11.00 Beaches to 6.00, Sun 12.00 to 5.00. Curated monthly exhibitions, see website. Artarmon Galleries 479 Pacific Highway, Artarmon 2064. T (02) 9427-0322. W www.artarmongalleries.com.au H Mon-Fri 10.00 to 5.00, Sat 11.00 to 3.00. Sept 8 to 29 Glen Preece and Rod Spicer. 136 Sydney FLAME SEED 5 - 30 SEPTEMBER 2018 An exhibition that reimagines the old furnace door of the Incinerator Art Space as a portal to ‘other worlds’. Eight artists explore fantasy, futuristic spaces and surreal i actions. nowsky, Adam Norton, Denese Oates, , Samuel Quinteros, Kate Rohde, Linda Seiffert Wijaya. vent September, 6pm - 8pm y Council curated exhibition L owsky, Keeping (detail), 2017, watercolour and gouache on found photographic postcard c.1910 Jeffrey Hamilton UNPUBLISHED [and rarely seen] WORKS Gestural abstract works on paper, collage and stained glass Thursday 13th – Monday 17th September 2018 m2 Gallery 450 Elizabeth Street, Surry Hills NSW 9.00am-6.30pm • m2gallery.com.au • www.stainedglass.com.au Fugue, 2010, permanent marker and gouache on 300gsm paper, 56cm x 128cm Sydney 137 Headland Artists Manly Art Gallery & Museum and Sculpture Park West Esplanade Reserve, Manly 2095. T (02) 9976- Read Place, Headland Park at Georges Heights 1421. E [email protected] entrance off Middle Head Road (opposite Cobittee W www.magam.com.au Free entry. H Tues-Sun Street), Mosman 2088. T 0409 653 222. 10.00 to 5.00. Sept 7 to 23 Manly Arts Festival E [email protected] 2018 – artists and performers are getting ready to W www.headlandartists.com In beautiful Headland take part in the most inspiring and creative event Park 20+ artists working and selling from their on Sydney’s Northern Beaches cultural calendar, studios, three art schools, art restoration and the 25th annual Manly Arts Festival. Offering over Frenchy’s Cafe. Sept 7 to 23 Red Dirt to Golden 60 exciting events including exhibitions, concerts, Sands recent paintings by Sung Hee Ahn. On show at talks, dance, film and creative workshops, this is Ethel St Gallery: 50 Ethel Street Seaforth 2092. an inclusive and energised family-friendly festival. Mon Fri 10.00 to 5.00, Sat Sun 10.00 to 4.00. Sept 7 to Oct 14 Octennial: Reg Mombassa & Peter Contact: [email protected], O’Doherty – the celebrated art of Reg and Pete [email protected] or call (02) 9949 7477, returns to Manly Art Gallery & Museum. Octennial 0432 892 001. includes recent and early works featuring Mombassa’s iconic allegorical landscapes and O’Doherty’s studies of deceptively mundane domestic and suburban Australian scenes. Reg Mombassa, Replacing a differential, south western NSW Courtesy the artist and Manly Art Gallery & Museum Sung Hee Ahn, Kangaroo Valley, acrylic and ink on canvas, 60 x 60cm Courtesy the artist Incinerator Art Space 2 Small Street, Willoughby 2068. T 0401-638-501. W www.willoughby.nsw.gov.au/whats-on/visual-arts H Wed-Sun 10.00 to 4.00. Sept 5 to 30 (opening Thurs Sept 6, 6-8pm) Flame Seed – Tara Marynowsky, Adam Norton, Denese Oates, Louis Pratt, Samuel Quinteros, Kate Rhode, Linda Seiffert and Agus Wijaya. See ad page 137. Peter O’Doherty, North East Corner Dee Why Courtesy the artist and Manly Art Gallery & Museum 138 Sydney Anthony Hodgkinson, Seep, 2018. Silver gelatin print.146x 106cm 13 – 16 September STACKS will be participating in this years Sydney Contemporary at Carriageworks presenting artists Anthony Hodgkinson and Nadia Odlum. 13 – 23 September Sydney Contemporary at STACKS Potts Point presenting artists Susan Andrews and Henry Curchod Opening Event: Saturday 15 September | 2 - 4pm 191 Victoria Street Potts Point Mosman Art Gallery Sydney Road Gallery 1 Art Gallery Way, Mosman 2088. Shop 2, 561-563 Sydney Road, Seaforth 2092. T (02) 9978-4178. E [email protected] T 0404-996-739. E [email protected] W www.mosmanartgallery.org.au Director: John W www.sydneyroadgallery.com H Thurs-Sun 10.00 Cheeseman. Free entry. H Daily 10.00 to 5.00, to 4.00. Sydney Road Gallery is a commercial art closed public hols. To Sept 8 New Sacred – gallery that is co-run by practising artists and changes developed as a partnership between Parramatta exhibitions every four weeks. Aug 30 to Sept 23 Artists Studios and Mosman Art Gallery in response (opening Sat Sept 1, 3-6pm) Oil and Water Don’t to critical discourses in contemporary Australian Mix by Fiona Chandler. art practices. Artists include Adorned, Khadim Ali, Cigdem Aydemir, Keg de Souza, Mehwish Iqbal, Warringah Printmakers Studio Elena Papanikolakis, Marikit Santiago, Salote Tawale Cnr Condamine and Lovett streets (entry on and Shireen Taweel. Sept 26 to Nov 18 Mosman Art Condamine Street), Manly Vale NSW 2093. Prize 2018 – an annual, acquisitive prize for painting E [email protected] W www.printstudio.org.au and the oldest and most prestigious local government Sept 15 and 16, 10am to 3pm POP UP SALE an art award in Australia. The 2018 Prize will be judged exhibition of prints from members of Warringah by artist and former Prize winner Cressida Campbell. Printmakers Studio. Paddington Woollahra Annette Larkin Fine Art Suite 4, 8 Soudan Lane, Paddington 2021. T (02) 9332-4614. E [email protected] W www.annettelarkin.com Director: Annette Larkin. H Wed-Fri 11.00 to 5.00, Sat 12.00 to 5.00, or by appt. Deals in post-war and contemporary art and provides tailored advice in all aspects of purchasing, valuing and collection management. To Sept 22 Inside Outside Upside-down stoneware by Liane Rossler. Sept 26 to Oct 13 A Private Collection works by Imants Tillers, Robert Macpherson and Robert Hunter. Jumaadi, Some kind of record, 2017, acrylic on found card index dividers, 119 x 99cm Art Atrium Winner of 2017 Mosman Art Prize 181 Old South Head Road, Bondi Junction 2022. Courtesy the artist and Mosman Art Gallery T 0411-138-308. E [email protected] W www.artatrium.com.au Director: Simon Chan. Mu Studio Gallery H Wed-Fri 12.00 to 6.00, Sat 12.00 to 4.00, or Headland Park Artist Precinct, 8 Read Place by appt. To Sept 16 Light and Space by Graham (cnr Middle Head Road), Mosman 2088. Kuo. At Art Atrium, in association with Live in Art: T (02) 9960-1777. E [email protected] 515 Crown Street Surry Hills. VIP viewing: Sat W www.studiomu.com.au H Tues-Sat 10.00 to 4.00 Sept 16, 6.30-8pm. Sept 12 to 16 Art Atrium at (during exhibitions). Sept 1 to 22 Found, Foraged and Sydney Contemporary, Booth G11 – Kate Briscoe, Formed by Tracy Dickason. Paul Connor, Tony Costa, Graham Kuo and Andrew Tomkins. Sept 21 to Oct 6 (opening Sun Sept 23, PROJECT [504] 2.30-4pm with the artists) David Middlebrook & Andrew Tomkins, at 515 Crown Street Surry Hills. 65 Berry Street, North Sydney 2060. T 0450-468-387. Sept 26 to Oct 13 Drawn by Design – The Art of E [email protected] Architecture. W www.project504.com.au H Mon-Fri 12.00 to 4.30. 140 Sydney wwas.org.au/9-x-5-landscape-prize/ Sydney 141 Australian Galleries ϐ 15 Roylston Street, Paddington 2021. 12 Mary Place, Paddington 2021. T (02) 9360-5177 F 9360-2361. T (02) 9557-8483. W www.defiancegallery.com E [email protected] Directors: Campbell Robertson-Swann & Lauren W www.australiangalleries.com.au Director: Stuart Harvey. H Wed-Sun 11.00 to 5.00. Sept 9 to Oct 20 Purves AM. H Daily 10.00 to 6.00. Sept 4 to 23 The (opening Sun Sept 9, 12-4pm) Group Exhibition – Questioning Eye by Janet Luxton. Also, Here and Ivor Fabok, Peter Godwin, Clara Hali, Roy Jackson, There by Pam Tippett. Kevin Norton, Dave Teer, Ann Thomson, Peter Powditch, Joe Furlonger, Ana Pollak and Alison Coates. Fellia Melas Gallery 2 Moncur Street, Woollahra 2025. T (02) 9363-5616. E [email protected] W www.fmelasgallery.com.au H Mon-Sat 10.00 to 5.00, Sun 11.00 to 5.00. Sept 22 to Oct 14 Exhibition 4x4 works by Tony Irving, Sally Paxton, Sophie Haythornthwaite and Nick Young. Fox Jensen Gallery Cnr Hampden Street & Cecil Lane23a Roylston Street, Paddington 2021. T (02) 8084-4298. E [email protected] W www.jensengallery.com H Wed-Sat 12.00 to 5.00. Kudos Gallery 6 Napier Street, Paddington 2021. T (02) 9326-0034. E [email protected] W www.arc.unsw.edu.au/ kudos H Wed-Fri 11.00 to 6.00, Sat 11.00 to 4.00. Sept 11 to 29 @jadefad: a social media feed in Janet Luxton, Tarentaise Cow, 2015-16, oil on linen, 130 x 110cm paint by Amber Boardman. Courtesy the artist and Australian Galleries BAROMETER Gallery 13 Gurner Street, Paddington 2021. T (02) 9358-4968. E [email protected] W www.barometer.net.au H Wed-Sat 12.00 to 5.00. To Sept 22 In Reverse textiles and works on paper by Catherine Rogers and Barbara Rogers. Blender Gallery 16 Elizabeth Street, Paddington 2021. T (02) 9380-7080. E [email protected] W blender.com.au www.facebook.com/ BlenderGallery.H Wed-Sat 11.00 to 5.00, Tues by appt. Cement Fondu 36 Gosbell Street, Paddington 2021. T (02) 9331-7775. E [email protected] W www.cementfondu.org H Thurs-Sun 11.00 to 5.00. To Sept 16 Between Suns – existing between two places and cultural identities, five NSW-based artists examine their migrant experiences through modes of healing and reflection. Amber Boardman, #renovatedpainting Sooooo @amberboardman tried to paint a portrait of me. Then I decided to make some changes ; ), 2018, oil on polyester, 41 x 31cm Courtesy the artist and Kudos Gallery 142 Sydney Martin Browne Contemporary Olsen Gallery 15 Hampden Street, Paddington 2021. 63 Jersey Road, Woollahra 2025. T (02) 9327-3922. T (02) 9331-7997. E [email protected] W www.olsengallery.com E [email protected] H Tues-Fri 10.00 to 6.00, Sat 10.00 to 5.00, Sun W www.martinbrownecontemporary.com Director: 11.00 to 5.00. Aug 29 to Sept 16 John Olsen. Martin Browne (member of ACGA). H Tues-Sun Also, Nicholas Harding. Olsen Annexe: at 74 Queen 10.30 to 6.00. To Sept 16 Birdland by Joanna Street, Woollahra 2025. T (02) 9327-3922. Braithwaite. Also, Extra by Adrienne Doig. H Tues-Sun 11.00 to 5.00. Project Gallery 90 90 Oxford Street, Paddington, Sydney 2021. T 0402-144-350. E [email protected] W www.projectgallery90.com Sept 6 to 12 Nicola Jarvie. Sept 13 to 26 Group Show. Sept 27 to Oct 10 Peter Berner. See ad page 129. Roslyn Oxley9 Gallery 8 Soudan Lane (off Hampden Street), Paddington 2021. T (02) 9331-1919. E [email protected] W www.roslynoxley9.com.au Director: Roslyn Oxley (member of ACGA). H Tues-Fri 10.00 to 6.00, Sat 11.00 to 6.00. To Sept 8 Mikala Dwyer, and Louise Hearman. Sept 11 to Oct 13 (opening Sat Sept 15, 6-8pm) Michael Parekowhai. Sabbia Gallery 120 Glenmore Road, Paddington 2021. T (02) 9361-6448. E [email protected] Joanna Braithwaite, Tropical, 2018, oil on canvas, 106.5 x 91cm W www.sabbiagallery.com Directors: Anna Grigson Courtesy the artist and Martin Browne Contemporary and Maria Grimaldi. H Tues-Fri 11.00 to 6.00, Sat 11.00 to 4.00. Sept 5 to 29 Gained in Translation – Maunsell Wickes Gallery new ceramic works by Janet DeBoos. Sept 13 to 16 Sydney Contemporary at T 19 Glenmore Road, Paddington 2021. (02) 9331- Carriageworks, Booth A05 – Galia Amsel, Pepai 4676 F 9380-8485. E [email protected] Jangala Carroll, Tim Edwards, Simone Fraser, W www.maunsellwickes.com H Tues-Sat 11.00 to Brenden Scott French, Yurpiya Lionel, Jeffery 5.30, Sun 12.00 to 5.00. Sept 1 to 14 Sculpture Mincham AM and Derek Jungarrayi Thompson. 2018. Sept 15 to 30 Ceramics II/2018. McOnie Gallery Saint Cloche 37 MacDonald Street, Paddington 2021. 37b Elizabeth Street, Paddington 2021. E [email protected] W www.saintcloche.com T E (02) 9363-2891. [email protected] Director: Kitty Wong. H Wed-Sat 10.00 to 5.00, Sun W mconiegallery.com.au There is an exciting new 11.00 to 4.00, Mon-Tues by appt. Visit website for Contemporary Art Gallery in Paddington. It is a small exhibition program. boutique gallery which features art by emerging and established artists. 144 Sydney Thienny Lee Gallery The Woollahra Small 176 New South Head Road (opp Edgecliff Train Sculpture Prize Station), Edgecliff 2027. T (02) 8057-1769. Woollahra Council Chambers E [email protected] W www.thiennyleegallery.com H Tues-Fri 10.00 to 536 New South Head Road, Double Bay 2028. T 4.00, Sat 11.00 to 4.00. To Sept 4 Yve & Marion by (02) 9391-7000. W Yvonne Steinberg and Marion Kramer. Sept 6 to 25 sculptureprize.woollahra.nsw.gov.au Oct 20 to Shifting Landscapes by Jody Rosen. Sept 27 to Oct Nov 11 The Woollahra Small Sculpture Prize 2018 16 Everyday Mix-Ups by Joanna Gambotto. finalist exhibition. Includes artist talks and workshops. Visit website for full program. Mon-Fri 9-5pm, Sat-Sun 10-4pm. See ad page 76. Greater Sydney Blacktown Arts Centre 78 Flushcombe Road, Blacktown 2148. T (02) 9839-6558. E [email protected] W www.blacktownaustralia.com.au/3057/blacktown- arts-centre H Tues-Sat 10.00 to 5.00, closed public hols. Bundeena Maianbar Art Trail Royal National Park W www.arttrail.com.au H 10.00 to 4.00 – 1st Sun every month. A collective of over 20 artists who open their studios to the public. Joanna Gambotto, Grid, oil on board, 104 x 82cm Courtesy the artist and Thienny Lee Gallery Campbelltown Arts Centre 1 Art Gallery Road, Campbelltown 2560. T (02) 4645-4100. Wagner Contemporary E [email protected] 2 Hampden Street, Paddington 2021. W www.c-a-c.com.au Free entry. H Daily 10.00 T (02) 9360-6069, 0419-251-013. to 4.00. To Oct 14 We are all connected to E [email protected] Campbelltown (one way or another). Also, Australian W www.wagnercontemporary.com.au H Tues-Sun Artist of the 80s. 10.30 to 6.00, Mon by appt. Eastern Suburbs Paddington Art Prize Menzies Art Brands 12 Todman Avenue, Kensington 2033. E [email protected] YOUR DIRECTOR W Heath Franco, , 2018, installation with multi- www.paddingtonartprize.com.au Sept 15 to 22 channel video and multi-channel audio, dimensions variable (opening Mon Sept 17, 6-8pm) finalists exhibition Commissioned by Campbelltown Arts Centre and announcement of six non-acquisitive prizes Courtesy the artist and Campbelltown Arts Centre including the inaugural Defiance Gallery Prize. See ad page 147. Sydney 145 Casula Powerhouse Arts Centre Hurstville Museum and Gallery A cultural facility of 14 MacMahon Street, Hurstville T (02) 9330-6444. Liverpool City Council E [email protected] W www.georgesriver.nsw.gov.au/HMG 1 Powerhouse Road, Casula 2170 (access via H Tues-Sat 10.00 to 4.00, Sun 2.00 to 5.00. Shepherd Street, Liverpool). T (02) 9824-1121. E [email protected] W www.casulapowerhouse.com Free entry. Ample Macquarie University parking available or alight at Casula Train Station. Art Gallery H Mon-Fri 9.00 to 5.00, Sat-Sun 9.00 to 4.30, Building E11A, Eastern Road, North Ryde 2109. closed public hols. To Sept 16 LAKA. Also, 2168: T (02) 9850-7437. E [email protected] Estate of Tomorrow by Catherine O’Donnell. Also, W www.artgallery.mq.edu.au Senior Curator: Rhonda Copper, and Collection Highlights. Sept 22 to Oct 21 Davis. H Tues-Fri 10.00 to 5.00. Soft Centre exhibition. Margaret Whitlam Galleries, Hazelhurst Regional Gallery Female Orphan School & Arts Centre Western Sydney University 782 Kingsway, Gymea 2227. T (02) 8536-5700 F 8536-5750. E [email protected] (Parramatta) W www.hazelhurst.com.au Free admission. First Level, West Wing, EZ Building, Parramatta H Daily 10.00 to 5.00, closed Christmas Day, Boxing Campus, cnr of James Ruse Drive and Victoria Road, Day, New Year’s Day and Good Friday. To Oct 21 Rydalmere 2116. T (02) 9685-9210. Alexander McKenzie: The adventurous gardener. W virtualtours.westernsydney.edu.au/home The first major solo exhibition for artist Alexander H Thurs-Fri 10.00 to 4.00. Parking $9 per day. McKenzie, known for his evocative luminous To Oct 26 Promiscuous Provenance by Anna Glynn landscape paintings. See ad page 21. – using a range of different media, the artist re- examines our relationship with our colonial past. A travelling exhibition from Shoalhaven Regional Gallery, presented by Whitlam Institute. Margot Hardy Gallery Western Sydney University (Bankstown) Foyer, Building 23, Bankstown Campus, Bullecourt Avenue, Milperra 2214. T (02) 4620-3450. W virtualtours.westernsydney.edu.au/home H Mon-Fri 9.00 to 5.00. Parking $7 per day. Sept 8 to Oct 5 Travelling through Thailand – an exhibition featuring artworks by students from Greenway Park Alexander McKenzie, Five Porches Pool, 2016, oil on linen, Public School. 137 x 197cm Private collection Photograph: Jenni Carter Parramatta Artists Studios Courtesy the artist, Martin Browne Contemporary, Sydney and Level 1 & 2, 68 Macquarie Street, Parramatta 2150. Hazelhurst Regional Gallery T (02) 9687-6090. E [email protected] HIDDEN: Rookwood Cemetery W www.parramattastudios.com.au H Open during Sculpture Walk 2018 events and by appt. Hawthorne Avenue, Rookwood Cemetery. 2141. W www.hiddeninrookwood.com.au Free entry. H Open daily from sunrise to sunset. Sept 1 to Oct 1 Discover Rookwood Cemetery and immerse yourself in an outdoor exhibition of sculpture – exploring history, culture, remembrance and love. See ad page 128. 146 Sydney Peacock Gallery and Penrith Regional Gallery Auburn Arts Studio & The Lewers Bequest Auburn Botanic Gardens, cnr Chisholm and Chiswick 86 River Road, Emu Plains 2750. T (02) 4735-1100. streets, Auburn 2144. T (02) 8745 9794. W www.penrithregionalgallery.org Free entry. E [email protected] H Daily 9.00 to 5.00. Visit website for exhibitions. W cumberland.nsw.gov.au/arts H Tues Sun 11.00 to 4.00. Sept 15 to Oct 21, 4A Curators’ Intensive Western Sydney University X Peacock Gallery. As part of the 2018 Curators’ Intensive presented by 4A Centre for Contemporary Art Gallery Asian Art, an emerging curator will be selected to (Penrith, Werrington North) curate an exhibition at Peacock Gallery. AD Building, Penrith (Werrington North) Campus, With support from both 4A and the gallery, the curator Great Western Highway, Werrington 2747. will present a five week exhibition and associated T (02) 4620-3450. public programs. W virtualtours.westernsydney.edu.au/home H Mon-Fri 9.00 to 5.00. Parking $7 per day. To Sept 28 By the time I get to Puning, she’ll be rising, 600 years old – an exhibition featuring the photography of David Cubby, Dawne Fahey, Michaela Gamble and Enrico Scotece. Peacock Gallery PADDINGTON PRIZE 2018 EXHIBITION OF NATIONAL FINALISTS & OPENING NIGHT PRESENTATION ~ Monday, 17th September 2018 ~ MENZIES ART BRANDS 12 Todman Ave, Kensington Exhibition Dates: Saturday, 15th ~ 22nd September ALL PAINTINGS ARE AVAILABLE FOR SALE ANNUAL LUNCHEON AT LUCIO'S Join us in celebration of the winner at Lucio's Italian Restaurant Oct 27th, 12.30pm ~ 47 Windsor Street, Paddington 2021 Bookings: www.lucios.com.au www.paddingtonartprize.com.au [email protected] 0418 167 135 Sydney 147 New South Wales 148 Newcastle Central Coast Gallery 139 139A Beaumont Street, Hamilton 2303. T 0434-886-450. W www.gallery139.com.au H Thurs-Sat 11.00 to 4.00, Sun 11.00 to 2.00. Aug 30 to Sept 19 Sprung – Rieteka Geursen, Em Warren, Lydia Miller, Ros Elkin, Sharon Taylor, Barbara Nanshe, Olivia Parsonage, Jane Collins and Kayo Yokoyama. Sept 20 to Oct 7 WE – Peta Lumley, Liz O’Brien, Justine Cogan, Lucy Maher, Jade Miller, Kelly Barlin, Chloe Hey and Maisie Neale. Curated by Clare Weeks. Joan Ross, Colonial Grab (still), 2014, digital animation, 7:38 mins Courtesy the artist, Michael Reid Gallery, Berlin + Sydney, and Lake Macquarie City Art Gallery The Lock Up 90 Hunter Street, Newcastle 2300. T (02) 4925- 2265. W www.thelockup.org.au H Wed-Sat 10.00 to 4.00, Sun 11.00 to 3.00. Sept 1 to 23 Behave by Penny Thwaite & Matthew Tome. Sept 28 to Oct 14 Full Circle – Presented by Critical Animals as part of TiNA. Lydia Miller, El.Blooms III, 2016, 36 x 46cm Courtesy the artist and Gallery 139 Maitland Regional Art Gallery Gosford Regional Gallery 230 High Street, Maitland 2320. T (02) 4934-9859 F 4933-1657. E [email protected] W 36 Webb Street, East Gosford 2250. T (02) 4304- www.mrag.org.au Cultural Director Brigette Uren. H 7550. E [email protected] W www. Tues-Sun 10.00 to 5.00. gosfordregionalgallery.com Free entry. H Daily 10.00 to 4.00. Newcastle Art Gallery Lake Macquarie City Art Gallery 1 Laman Street, Newcastle 2300. T (02) 4974- 5100. E [email protected] W www.nag. First Street, Booragul 2284. T (02) 4921 0382 F org.au Gallery Director: Lauretta Morton. H Tues-Sun (02) 4921 0329. E [email protected] 10.00 to 5.00, seven days during school hols. To Oct W artgallery.lakemac.com.au Free entry. H Tues-Sun 21 Kilgour Prize 2018. Sept 8 to Nov 4 The 1818 10.00 to 4.30. To Sept 23 Yes Yes Yes Yes: Graphics Project (see ad page 13). from the 1960s and 1970s – Joe Tilson, Eduardo Paolozzi, Sigmar Polke and Gerhard Richter. An Art Gallery of New South Wales touring exhibition. Also, The University Gallery Moving Histories // Future Projections – a showcase and Senta Taft-Hendry Museum of leading female contemporary artists working across of Oceanic Art screen-based media. A dLux MediaArts exhibition toured by Museums & Galleries of NSW. Sept 29 to University of Newcastle, University Drive, Callaghan T Dec 2 STEEL: art design architecture. A JamFactory 2308. (02) 4921-5255. E touring exhibition. Also, Your Collection: Hunter [email protected] W Steel. www.newcastle.edu.au/universitygallery H Wed-Fri 10.00 to 5.00, Sat 12.00 to 4.00. Sept 5 to Nov 10 The Long Shadow. New South Wales 149 Watt Space Grafton Regional Gallery Northumberland House, cnr King and Auckland 158 Fitzroy Street, Grafton 2460. T (02) 6642-3177. streets, Newcastle 2300. T Office (02) 4921-5188. E [email protected] Gallery 4921-8733. E [email protected] W www.graftongallery.nsw.gov.au H Daily 10.00 W www.newcastle.edu.au/community-and-alumni/ to 4.00. Prentice House 9.00 to 5.00. Public hols arts-and-culture/watt-space-gallery H Wed-Sun 11.00 may differ. Grafton Regional Gallery is home of the to 5.00. Sept 5 to 23 (opening Fri Sept 7, 5.30- Jacaranda Acquisitive Drawing Award (JADA) with a 7.30pm) Exhibitions by the Students of Architecture total prize of $40,000. The award is now in it’s 30th Peripheries: Research in architecture and the Built year. Sept 7 to Oct 21 Tracey Moffatt – a touring Environment, and Timothy Burke Exquisite Drawing exhibition by the Murray Art Museum Albury. Also, Liz Machine. Slater: Undergrowth, and Dave Sparkes: Luminosity. Northern Rivers Bank Art Museum Moree 25 Frome Street, Moree 2400. T (02) 6757-3320. W www.bamm.org.au H Mon-Fri 10.00 to 5.00, Sat 10.00 to 1.00. Coffs Harbour Regional Gallery Tracey Moffatt, Something More 3, 99.5 x 125cm Cnr Coff and Duke streets, Coffs Harbour 2450. Courtesy the artist and Grafton Regional Gallery T (02) 6648-4863. E [email protected] W www.coffsharbour.nsw.gov.au/gallery Free entry. Lismore Regional Art Gallery H Tues-Sat 10.00 to 4.00. To Sept 8 David Fairbairn: Drawn to Print and Aleph Geddis: hard/soft 2018. 11 Rural Street, Lismore 2480. T (02) 6627-4600. Line is the foundation of David Fairbairn’s art, from a E [email protected] density of line work, form emerges. In this exhibition W www.lismoregallery.org Free entry. H Tues, Wed, of large scale portraiture, Fairbairn experiments with Fri, Sat and Sun 10.00 to 4.00, Thurs 10.00 to etching. The sculptural works of Aleph Geddis live at 6.00. Sept 8 to Oct 14 (opening Fri Sept 28, 6pm) the intersection of traditional methods and modernist Far to Go by Victoria Pitel. forms, informed by the stylised naturalism of Pacific Northwest carving and the essence of Platonic solids. Sept 14 to Nov 10 Clay Intersections – this exhibition highlights the work of eight contemporary makers selected for their diverse approaches to their ceramic practice – Kenji Uranishi, Tania Rollond, Bridget Bodenham, Helen Earl, Ulrica Trulsson, Natalie Rosin and Cone 11’s Colin Hopkins and Ilona Topolcsanyi. Curated by Gallery Co-ordinator Cath Fogarty. This is an ADC on Tour national touring exhibition, first presented by Australian Design Centre in 2016. Victoria Pitel, Far to Go Courtesy the artist and Lismore Regional Art Gallery Manning Regional Art Gallery 12 Macquarie Street, Taree 2430. T (02) 6592-5455. E [email protected] W mrag.midcoast.nsw.gov.au H Wed-Sat 10.00 to 4.00, Sun 1.00 to 4.00. To Sept 30 Gathering Threads – Faye Collier, Pat Davidson, Pat Land, Jana Helen Earl, She-Oak Vessels, 2017 Pearceova, Kath Soper Hadley Westwood Photograph: Greg Piper and . Courtesy the artist and Coffs Harbour Regional Gallery 150 New South Wales Muswellbrook Regional Arts Centre South Coast Cnr Bridge and William streets, Muswellbrook 2333. T (02) 6549-3800. E [email protected] Bega Valley Regional Gallery W www.muswellbrook.nsw.gov.au/index.php/mrac- Zingel Place, Bega 2550. T (02) 6499-2202. home H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to E [email protected] 1.00, Mon by appt. Sept 1 to Oct 21 The Locals – W gallery.begavalley.nsw.gov.au 60 years of collecting in the Upper Hunter. facebook.com/begavalleyregionalgallery. Also, Miniatures. H Tues-Fri 10.00 to 4.00, Sat 9.00 to 12.00. To Sept 8 Balnhdhurr – A Lasting Impression – 20 Years of Yirrkala Print Space. An ARTBACK NT Nexus Community Gallery touring exhibition. Sept 15 to Oct 20 (opening Fri Old Butter Factory, Doepel Street, Bellingen 2454. Sept 14, 6pm) South/East Interference Volume I by W www.bcac.org.au H Daily 10.00 to 4.30. Rosie Deacon. Facebook: Nexus Gallery To Sept 14 The Botanic Ashes – England v. Australia by Bronwyn Rodden. An exhibition of works depicting Australian native plants created from inks made from Australian plants: Wattle, Smilax, Davidson’s Plum, Native Olive, Rusty Plum, and Eucalyptus, as well as English inks used in medieval manuscripts and traditional dyeing. www.bronwynrodden Retrospect Galleries 52 Jonson Street, Byron Bay 2481. T (02) 6680-8825. E [email protected] W www.retrospectgalleries.com H Daily 9.30 to 5.30. Cutting-edge collectable art from established and emerging Australian artists and designers. Rosie Deacon, Fun Foam Fantastical-Fabulous Fun, 2015 Southern Courtesy the artist and Bega Valley Regional Gallery Duck Print Fine Art Highlands 39-41 Wentworth Street, Port Kembla 2505. T (02) 4276-1135. W www.duckprintfineart.com.au Bowral Art Gallery Prints for sale, workshops available, custom printing + editions. 1 Short Street, Bowral 2576. T (02) 4861-4093. E [email protected] W www.bdasgallery.com www.facebook.com/bowralartgallery. H Daily 10.00 Jervis Bay Maritime Museum to 4.00, closed Wed for change of exhibitions. & Gallery The Bowral Art Gallery, home of the Bowral & Woollamia Road, Huskisson 2540. T (02) 4441-5675. District Art Society and BDAS workshops. Sept 6 W www.jervisbaymaritimemuseum.com.au to 11 Under Pressure – Bowral District Art Society H Daily 10.00 to 4.00. Sept 8 to Nov 25 Report Printmakers. Sept 13 to 18 The Art of Zhen Shan from the Littoral Zone paintings, sculpture, video and Ren International Exhibition. Sept 21 to Oct 1 installation by Kurt Brereton. www.kurtbrereton.com (opening Fri Sept 21, 6.30pm) John Copes Portrait See ad page 19. Prize Exhibition. Sturt Gallery & Studios Cnr Range Road and Waverley Parade, Mittagong 2575. T (02) 4860-2083. E [email protected] W www.sturt.nsw.edu.au H Daily 10.00 to 5.00. Sturt was established in 1941 and is a nationally significant and award winning centre for the teaching, sale, production and exhibition of contemporary Australian craft and design. New South Wales 151 Siteworks Bundanon Trust 533 Bundanon Road, Illaroo 2541. T (02) 4422-2100 . E [email protected] W www.bundanon.com.au Siteworks (MICRO) – shift your mind from big ideas and let yourself think small for a change. At Siteworks this year we’ll narrow the view and see what comes into focus when we turn our attention to the miniature and microscopic. Tiny gods, dancing spiders, microbes in both the soil and your gut - are you ready for the new world that awaits us? Artists include Maria Fernanda Cardoso, Emily Hunt, Helen Pynor, Patrick Nolan with Dance North, One Step at a Time Like This, Theatre Kantanka and Deborah Kelly. All of this and more will be explored at Bundanon’s annual spring event that brings scientists, artists and community voices together to share knowledge and ideas arising from the Bundanon sites through discussions, presentations and experiences. As always, there will be artworks, talks, workshops, kids’ activities, food, drink, camping plus inspiration, stimulation, and relaxation. Shuttle bus available Christopher Zanko, Flanked, 2017, acrylic on wood relief carving, from Nowra to and from the event. Midday until late. 100 x 91cm Café and bar onsite. Bookings essential for camping Courtesy the artist and Wollongong Art Gallery and bus. $12 adults, $8 conc., U16 Free. $10 pp camping. Blue Mountains Blue Mountains City Art Gallery 30 Parke Street, Katoomba 2780. T (02) 4780-5410. E [email protected] W www.bluemountainsculturalcentre.com.au Adults $5/Conc. $3. Children under 16 free. H Mon-Fri 10.00 to 5.00, Sat-Sun 10.00 to 4.00. Public hols 10.00 to 2.00. To Oct 7 Mycorrhizal Futurae – Maria Fernanda Cardoso, from ‘Dancing with Spiders’, Maratus Ferox – Inferius. This exhibition is Freedom Wilson’s speciosus male new body of work, which raises awareness of the Courtesy the artist and Siteworks endangered Buttercup Doubletail Orchid (Diuris aequalis). Wilson participated in botanical surveys Wollongong Art Gallery and field research in the Kanangra Boyd Wilderness Cnr Kembla and Burelli streets, Wollongong 2520. area and in Snow Gum habitat near the Wombeyan T (02) 4227-8500 F 4226-5530. Caves and Canberra. She was guided in her research E [email protected] by Ecologist and Saving Our Species Project Officer W www.wollongongartgallery.com H Tues-Fri Anna Murphy from the Office of Environment and 10.00 to 5.00, Sat-Sun 12.00 to 4.00, closed Heritage. To Oct 14 Blue Mountains Botanica – Mon and public hols. Sept 1 to Nov 25 Here + delves into the history of botanical exploration of Now – showcases the work of eight young artists the Blue Mountains and features historical botanical who live, work or who have a close connection to illustrations, plant specimen and archival material this region and takes a ‘snapshot’ of their practice drawn from the National Herbarium of NSW, the at this particular time in their careers. Participating Daniel Solander Library and the Blue Mountains artists are Jessica Cochrane, Tex Crick, Ebony Eden, Botanic Garden, Mount Tomah. The exhibition will Misha Harrison, India Mark, Paige Northwood, Nick also feature a selection of works by contemporary Santoro and Chris Zanko. Curated by Aaron Fell- Sydney and Blue Mountains artists who incorporate Fracasso who through Egg & Dart Gallery, Thirroul has botanical elements in their works through a range been an important advocate supporting and nurturing of media such as drawing, photography and the practices of a cohort of young regional artists. installations. Exhibiting artists are James Blackwell, Here + Now celebrates the diverse and unique Tania Bowers, Ona Janzen, Jennifer Leahy & Edith creative energy of this region. Pass, Angela Lober, Julie Nettleton, Edith Rewa and Jacqueline Spedding. Developed in partnership with the Royal Botanic Gardens and Domain Trust. 152 New South Wales Nolan on Lovel Gallery 56a Lovel Street, Katoomba 2780. T (02) 4782-6231. E [email protected] W nolanonlovelgallery.com.au H Thurs-Sun 10.00 to 5.00. Sept 22 to 30 (opening Sat Sept 22, 2-4pm) from there to here, cut and paste old school recent mixed media work on paper by Louise Holmes. Norman Lindsay Gallery & Museum 14 Norman Lindsay Crescent, Faulconbridge 2776. T (02) 4751-1067. E [email protected] W www.normanlindsay.com.au H Daily 10.00 to 4.00. The Norman Lindsay Gallery is the home of the Magic Pudding and displays the work of artist and Telopea speciosissima, botanical illustration from Curtis’s Botanical writer Norman Lindsay (1879-1969). Magazine, 1808 Courtesy Royal Botanic Gardens and Domain Trust, and Blue Mountains City Art Gallery Rex-Livingston Art + Objects 182-184 Katoomba Street, Katoomba 2780. T (02) 4782-9988. E [email protected] W www.rex-livingston.com Director: David Rex- Livingston. H Thurs-Tues 10.00 to 5.00. Ceramic Break Sculpture Park Sculpture Prize Call For Entries Freedom Wilson, Boyd River Buttercup Double tail Orchid, 2018, An acquisitive mono print, 77 x 57cm Photograph: Marty J Walker prize of $12,000 Courtesy the artist and Blue Mountains City Art Gallery GalleryONE88 Fine Arts Entries close 186-188 Katoomba Street, Katoomba 2780. 1 July 2019 T (02) 4782-3141, 0411-131-000. E [email protected] Exhibition dates W www.galleryone88finearts.com H Tues-Sun 10.00 7 September 2019 to 5.00. Aug 28 to Sept 9 Clear and Distant View a to 31 January 2020 solo show by Boyd McMillan. @boydmcmillanartwork Enter online at Lost Bear Gallery https://form.jotform.co/81779289306875 98 Lurline Street, Katoomba 2780. T (02) 4782-1220. E [email protected] W www.lostbeargallery.com.au Director: Geoff White. H Daily 10.00 to 5.00. New South Wales 153 Goulburn Regional Art Gallery Central Goulburn Mulwaree Council, Civic Centre, Cnr Bourke and Church streets, Goulburn 2580. T (02) 4823- 4494. E [email protected] Tablelands W www.grag.com.au Free entry. H Mon-Fri 10.00 to 5.00, Sat 1.00 to 4.00. Aug 31 to Oct 13 Inhabiting Western the Woodlands by Carolyn Young. Also, ACO Virtual. ϐ Districts 167 Banna Avenue, Griffith 2680. T (02) 6962-8444. E [email protected] W www.griffithregionalartgallery.com.au H Wed-Fri 10.00 to 5.00, Sat-Sun 11.00 to 2.00. To Sept 23 Greater NSW The National Contemporary Jewellery Award. Sept 29 to Nov 4 Elsewhere: Travels to Syria, Iran, Egypt, Bathurst Regional Art Gallery Morocco and Central Asia by Wendy Sharp and Bernard Ollis 70-78 Keppel Street, Bathurst 2795. T (02) 6333- . 6555. W www.bathurstart.com.au Free entry. H Tues-Sat 10.00 to 5.00, Sun and public hols Murray Art Museum Albury 11.00 to 2.00. To Oct 7 Objectivity by Terry Burrows 546 Dean Street, Albury 2640. T (02) 6043-5800. – a Bathurst Regional Art Gallery exhibition. Also, E [email protected] Salient: Contemporary artists at the Western Front. W mamaalbury.com.au H Mon-Fri 10.00 to 5.00, A New England Regional Art Museum and King Street Thurs 10.00 to 7.00, Sat-Sun and public hols 10.00 Gallery exhibition. to 4.00. To Oct 7 Leon deMontignie: The Life and Death of an Unknown Artist. To Nov 4 Immortality. Broken Hill Regional Art Gallery To Dec 9 Mechelle Bounpraseuth: Westside Story. 404-408 Argent Street, Broken Hill 2880. To Dec 31 Land & Title. T (08) 8080-3444. E [email protected] W www.bhartgallery.com.au H Daily 10.00 to 4.00. New England Regional To Sept 23, 2018 Pro Hart Outback Art Prize – an Art Museum annual acquisitive competition. The prize showcases 106-114 Kentucky Street, Armidale 2350. work in any media which reflects the spirit and T (02) 6772-5255. E [email protected] diversity of the Australian Outback. W www.neram.com.au H Tues-Sun 10.00 to 4.00. Ceramic Break Sculpture Park Orange Regional Gallery T ‘Bondi’, Warialda 2402. (02) 6729-4147. 149 Byng Street, Orange 2800. T (02) 6393-8136. E [email protected] E [email protected] W www.org.nsw.gov.au W H www.cbreaksculpturepark.com.au Thurs-Sun H Daily 10.00 to 4.00. Closed Christmas Day, Boxing 10.00 to 5.00, or by appt. Through Sept (opening Day and Good Friday. To Sept 9 Highlights from the Sat Sept 1, 12-5pm) oil and acrylic paintings, mixed Chroma Collection. To Sept 23 ARTEXPRESS 2018. Robyne media and water colours by Sydney artists To Oct 14 Mary Turner Collection and Bequest. Berling, Suzanne Lane Sylvia Davies and . Also, Sept 15 to Oct 14 Connections: from the prizes awarded for the Inaugural Travelling Quilting Gutenberg Press to Richard Swinbourne’s Competition. Quilts on display until Sept 16. ‘The Etching Press Company’. Cowra Regional Art Gallery Suki & Hugh Gallery T 77 Darling Street, Cowra 2794. (02) 6340-2190. 38A Gibraltar Street, Bungendore 2621. E [email protected] T (02) 6238-1398. E [email protected] W www.cowraartgallery.com.au Admission free. W www.sukihugh.com.au H Thurs-Sun 10.00 to H Tues-Sat 10.00 to 4.00, Sun 2.00 to 4.00. 4.00. To Sept 30 The Architecture of Light – a solo Sept 8 to Oct 7 ARTEXPRESS – featuring a selection exhibition by Susie Dureau presenting a series of of outstanding student artworks developed for the paintings examining light as a subject and entity art making component of the HSC examination in unto itself rather than an assumed component in the Visual Arts 2017. ARTEXPRESS provides insight into illumination of other subjects. It asks the viewer to students’ creativity and the issues important to them. breach the traditionally held binary relationship of light to dark and apprehend the rich nuances present in the materiality of light. Oct 6 to Nov 18 Above 154 New South Wales and Beyond by Stefan Gevers – an exhibition of Western Plains Cultural Centre watercolours based on memories travelling through Dubbo Regional Gallery The Armati Bequest, Dubbo the landscape. These artworks depict a sense of Regional Museum and Community Arts Centre, 76 stillness that makes us reflect on ourselves. Wingewarra Street, Dubbo 2830. T (02) 6801-4444. W www.westernplainsculturalcentre.org H Daily 10.00 to 4.00, Fri 10.00 to 6.00. To Oct 28 Michael Cook: Undiscovered. Sept 1 to Dec 19 Primavera At 25: MCA Collection. Abdul Abdullah, Caliban (detail), 2015, oil on board, 9 parts: each 90 x 90 x 3cm, overall 270 x 270cm Stefan Gevers, From Above, 2018, watercolour, 123 x 95cm Photograph: Jessica Maurer Courtesy the artist and Suki & Hugh Gallery © the artist Courtesy the artist, Museum of Contemporary Art Australia and Western Plains Cultural Centre New South Wales 155 Australian Capital Territory 156 Canberra Museum and Gallery Civic Cnr London Circuit and Civic Square, Canberra City 2600. T (02) 6207-3968. W www.cmag.com.au H Mon-Fri 10.00 to 5.00, Sat-Sun 12.00 to 4.00. To Nov 4 Crafting the house on the hill: Art, Design Inner North and the Building of Australian Parliament House – reveals the stories behind the building’s major art and ANCA Gallery design commissions. See ad page 20. 1 Rosevear Place, Dickson 2602. T (02) 6247-8736. E [email protected] W www.anca.net.au H Wed-Sun 12.00 to 5.00. Aug 29 to Sept 16 (opening Wed Aug 29, 6pm) The Uncertainty Principle – Katie Hayne & UK Frederick, Ross Gibson, Dianne Firth, Saskia Beudel, Jen Webb, John White, Paul Munden & Paul Hetherington, Caren Florance, Michael Jasper, Tony Eaton and Shane Strange. The Uncertainty Principle is drawn from Werner Heisenberg’s famous phrase that points to the fuzziness in the natural world, and the impossibility of knowing in any certain way what things are, and how they operate. Sept 19 to Oct 7 (opening Wed Sept 19, 6pm) Queen Size by Kieran Butler. Butler uses photography and drag’s shared properties of illusion, transformation and magic to Max Dupain, Untitled,1988, gelatin silver print on paper, validate and recognise non-binary identities, 38.8 x 50cm how they come into being and how they can be Commissioned 1988, Parliament House Construction Photography diversely represented. Project Courtesy the artist, Parliament House Art Collection and Canberra Museum and Gallery Contour 556 Canberra’s Public Art Biennial W www.contour556.com.au Oct 5 to 28 A free public art event presenting artworks and performances by 60 artists in the world famous public realm and national cultural icons around Lake Burley Griffin, Canberra. All artworks and performances are site specific – drawing inspiration from, or reflecting on the cultural or physical character of Canberra. Visit website to view full program. See ad page 18. Craft ACT Kieran Butler, Study for Pollux (spicey), 2018, digital image file, Craft and Design Centre dimensions variable Level 1, North Building, 180 London Circuit, Courtesy the artist and ANCA Gallery Canberra 2601. T (02) 6262-9333. E [email protected] W www.craftact.org.au Canberra Contemporary Art H Tues-Fri 10.00 to 5.00, Sat 12.00 to 4.00. Space, Gorman Arts Centre 55 Ainslie Avenue, Braddon 2612. Nancy Sever Gallery T (02) 6247-0188. E [email protected] Gorman Arts Centre, B Hall, cnr Batman and Currong W www.ccas.com.au H Tues-Sat 11.00 to 5.00. streets, Braddon 2604. T (02) 6182-0055. To Sept 8 Does she know the revolution is coming? E [email protected] by Amala Groom. Also, Heart-in-Hand by Brenda W www.nancysevergallery.com.au L Croft. Sept 21 to Nov 17 Kate Stevens, and H Wed-Sun 11.00 to 5.00. Jess Higgins. Also, FENCES BORDERS WALLS by Janenne Eaton. Australian Capital Territory 157 Acton Foreshore NewActon Southside ANU Drill Hall Gallery Beaver Galleries Kingsley Street (off Barry Drive), Acton 2601. 81 Denison Street, Deakin, Canberra 2600. T (02) 6125-5832. E [email protected] T (02) 6282-5294. E [email protected] W dhg.anu.edu.au Director: Terence Maloon. W www.beavergalleries.com.au Directors: Martin Free admission. H Wed-Sun 10.00 to 5.00. & Susie Beaver (member of ACGA). H Tues-Fri To Oct 7 Painting Amongst Other Things – Peter 10.00 to 5.00, Sat-Sun 9.00 to 5.00. Canberra’s Alwast, Lynda Benglis, Merlin James, Natasha largest private gallery featuring regular exhibitions of Kidd, Rose Nolan, Raquel Ormella, Ti Parks, Jacob contemporary paintings, prints, sculpture, glass and Potter, Robert Rauschenberg, Richard Tuttle and ceramics by established and emerging Australian Karl Wiebke. artists. Sept 6 to 23 On uneven ground paintings and works on paper by Graeme Drendel. Also, Lowlands ANU School of Art Gallery paintings by Kirrily Hammond. 105 Childers Street, Acton 2602. T (02) 6125-5841. E [email protected] W soad.cass.anu.edu.au Canberra Contemporary Art H During Main Gallery exhibitions Tues-Fri 10.30 Space, Manuka to 5.00, Sat 12.00 to 5.00, closed Sun-Mon and 19 Furneaux Street, Manuka 2603. public hols. T (02) 6247-0188. E [email protected] W www.ccas.com.au H Fri-Sun 11.00 to 5.00. Sept Nishi Gallery 6 to 16 Between Here and Now by Leonie Andrews. 17 Kendall Lane, NewActon 2601. Sept 20 to 30 At Home with Ohm by John Hart. T (02) 6287-6170. E [email protected] W newacton.com.au/place/nishi-gallery H Wed-Sun Canberra Glassworks 11.00 to 3.00. To Sept 29 Greybilly is an exhibition 11 Wentworth Avenue, Kingston 2604. T (02) 6260- about landscapes and colour scapes. Photographs by 7005. E [email protected] Melbourne-based artist Abigail Varney present a vivid W www.canberraglassworks.com Free entry. perspective on depleting resources in the opal mining H Wed-Sun 10.00 to 4.00. To Oct 21 A Profusion of town of Coober Pedy. Conceptual jewellery by Sydney- plumes by B. Jane Cowie – Cowie is an Australian based artist Nina Baker sees the transformation of artist based in Singapore. She has created public disposable plastic containers into objects of beauty. art commissions in many parts of the world and Curated by Yasmin Masri, Greybilly explores the most recently at Bondi Sculpture by the Sea 2018. search for (and creation of) what’s precious, and the These new works created at Canberra Glassworks reality of finite resources. will coincide with Canberra’s iconic Floriade Festival. See her work colonising the exterior of the Canberra Glassworks. Sept 21 to 30 (opening Fri Sept 21, 6pm with the announcement of the winner) Hindmarsh Prize – in its third year the Hindmarsh Prize will come of age following the exhibition in the Fitters’ Workshop, the selected finalists will travel to Japan where it will be exhibited at the internationally renowned Toyama Glass Museum from Oct 26 to Nov 11, 2018. M16 Artspace 21 Blaxland Crescent, Griffith 2603. T (02) 6295-9438. E [email protected] W www.m16artspace.com.au H Wed-Sun 12.00 to 5.00. Sept 6 to 23 Gallery 1: Holding the line by Bruce Tunks. Gallery 2: Under Ice by Justine McLaren. Gallery 3: Reimagined Perspectives by Madisyn Zabel. Sept 27 to Oct 14 Gallery 1: Silk on the Road by Jeff Skewes. Gallery 2: Testamur – artist from Canberra Art Workshop, curated by Prue Power. Gallery 3: Edible Plants in Art – artist from The Untitled Abigail Varney, Watercolour Group, curated by Lesley Wallington. Courtesy the artist and Nishi Gallery 158 Australian Capital Territory Madisyn Zabel, Split Detail, 2018, glass, paint, metal Courtesy the artist and M16 Artspace Megalo Print Studio + Gallery 21 Wentworth Avenue, Kingston 2604. T (02) 6232-6041. E [email protected] W www.megalo.org H Tues to Sat 9.30 to 5.00. Linde Ivimey, Dana Bergstrom, Penguin, 2018, steel armature, National Gallery of Australia acrylic resin, dyed cotton, natural turkey bones, leather, fox fur, wood, steel, dyed and sewn viscera, osprey feathers and carnelians, (NGA) 82 x 38 x 25cm Parkes Place, Parkes, Canberra 2600. Courtesy the artist and National Portrait Gallery T (02) 6240-6411. E [email protected] W www.nga.gov.au Admission to the permanent collection is free. H Daily 10.00 to 5.00. To Sept 24 Picasso: The Vollard Suite. To Nov 11 American Masters 1940-1980. To Nov 18 Watercolours by Greater HRH The Prince of Wales. To Dec Art Deco. To Jan 28, 2019 Power & Imagination: Conceptual Canberra Art. Sept 1 to Jan 20, 2019 Performing Drawing. National Library of Australia Belconnen Arts Centre 118 Emu Bank, Belconnen 2617. T (02) 6173-3300. Parkes Place, Canberra 2600. T (02) 6262-1111. E [email protected] W www.nla.gov.au Free entry. H Daily 10.00 to 5.00. W www.belconnenartscentre.com.au H Tues-Sun 10.00 to 4.00. Visit the gallery website National Portrait Gallery for exhibition program. King Edward Terrace, Parkes 2600. T (02) 6102-7000. E [email protected] Stirato Gallery W www.portrait.gov.au H Daily 10.00 to 5.00. 1/21 Iron Knobb Street, Fyshwick 2609. To Sept 9 Express Yourself – this collection draws T 0430-320-757. E [email protected] attention to portraits of Australians whose unique life W www.stiratogallery.com H Mon-Sat 8.30 to 6.00. experiences symbolise social and cultural themes. To Sept 16 Collections: Icons Volume two – the second instalment of a display featuring bold contemporary Strathnairn Arts portraits drawn from the collection. To Oct 1 So 90 Stockdill Drive, Holt 2615. T (02) 6254-2134. Fine: Contemporary women artists make Australian E [email protected] W www.strathnairn.com.au history – ten women artists explore the possibilities of Free entry, all welcome. H Thurs-Sun 10.00 to 4.00. portraiture as a contemporary art form and reinterpret To Sept 16 Strathnairn Homestead Gallery 1: A Hat Australia’s past. Sept 22 to April 17, 2019 Electric! of Many Dreams by Akka Ballenger Constantin. Portraits that pop! – the collection exhibition features Strathnairn Arts Woolshed Gallery: Natural a mix of bright, bold and colourful paintings, prints Abstraction by Tony Fleming. Sept 20 to Oct 14 and photographs, and buoyant video portraits. (opening Sat Sept 22, 4pm) Birds by Carol Cooke. A body of work comprising of mixed media sculptures. Tributary Projects Unit 9 Molonglo Mall, 105 Newcastle Street, Fyshwick 2609. E [email protected] W www.tributaryprojects.xyz H Thurs-Sun 11.00 to 5.00, or by appt. Australian Capital Territory 159 Tasmania 160 Despard Gallery Hobart Level 1, 15 Castray Esplanade, Hobart 7000. T (03) 6223-8266. E [email protected] W www.despard-gallery.com.au H Mon-Fri 11.00 to 6.00, Sat 10.00 to 4.00, Sun 11.00 to 4.00. Sullivans Cove To Sept 16 Have one on me by Sam Field. Sept 19 to Oct 14 Lisa Garland and Lucia Usmiani. Oct 17 to Nov 11 Micheila Petersfield recent Battery Point photographs. Art Mob Handmark Gallery 29 Hunter Street, Hobart 7000. T (03) 6236-9200, Unique Tasmanian Art & Design, 77 Salamanca 0419-393-122. E [email protected] Place, Hobart 7000. Also, 2 Russell Street, Evandale, T W www.artmob.com.au Director: Euan Hills. 7212. Hobart: (03) 6223-7895, H Daily 10.00 to 6.00. Aboriginal fine art, including Evandale: (03) 6391-8193. E Tasmanian Aboriginal artists. Hobart: [email protected], Evandale: [email protected] W www.handmark.com.au Bett Gallery Hobart Evandale: To Sept 12 Carmel Dilger – new paintings. Level 1, 65 Murray Street, Hobart 7000. Hobart: Sept 7 to Oct 1 Junko Go – new paintings. T (03) 6231-6511. E [email protected] Sept 16 to Oct 10 Jeff Gatt – new paintings. W www.bettgallery.com.au Directors: Carol Bett, Emma Bett and Jack Bett . H Mon-Fri 10.00 to 5.30, The Henry Jones Art Hotel Sat 10.00 to 4.00. To Sept 15 Surface by Patrick T Grieve. Sept 21 to Oct 13 Doble Yolker! by Mish 25 Hunter Street, Hobart 7000. (03) 6210-7700. E W Meijers. Also, Digital Satiety by Nathan Taylor. [email protected] www.thehenryjones.com Showcasing leading and emerging Tasmanian artists with a changing display of original Colville Gallery contemporary artworks. 91a Salamanca Place, Hobart 7004. T (03) 6224-4088, 0419-292-626. Mona E [email protected] W www.colvillegallery.com.au H Daily 10.00 to 5.00. Museum of Old and New Art Sept1to18We Said Yes by Jane James. Sept 21 to 655 Main Road, Berriedale, Hobart 7011. Oct 9 Liminal by Jason Cordero. T (03) 6277-9900. E [email protected] W www.mona.net.au Visit website for details. To Feb 4, 2019 The Unmanned: Fabien Giraud and Raphaël Siboni, Part Two. To April 22, 2019 ZERO. Fabien Giraud and Raphaël Siboni, 1953 – The Outlawed, The Unmanned Saison 1, Episode 3, 2018, HD video, 13mins © the artists Courtesy the artists and Mona – Museum of Old and New Art Jane James, ‘E’ (II), synthetic polymer on linen, 71.12 x 50.8cm Courtesy the artist and Colville Gallery Tasmania 161 Plimsoll Gallery Salamanca Arts Centre School of Creative Arts, 65-77 Salamanca Place, Hobart 7000. University of Tasmania T (03) 6234-8414. E [email protected] W www.salarts.org.au H Daily 10.00 to 5.00. T Hunter Street, Hobart 7000. (03) 6226-4300. Sept 1 to 30 Top Gallery: Self-Dissolve : Reiteration E W [email protected] www.utas.edu.au/ by Dexter Rosengrave. Sept 3 to 29 Studio Gallery: H creative-arts/events/plimsoll-gallery Daily 12.00 to Harmony & Balance by Eun Ju Cho. Sept 8 to 30 5.00 during exhibitions, closed on Tues and public Long Gallery: The People’s Library (Salamanca Arts hols. Sept 8 to Oct 14 (opening Fri Sept 7, 5.30pm) Centre major exhibition for 2018) – Justy Phillips & Ian Burns, Laura Woodward, Patrick Systematic – Margaret Woodward (A Published Event). Pound, Tricky Walsh, Jacob Leary, Tega Brain, Nadège Philippe-Janon and Bill Hart. Systematic is an exhibition showcasing eight Australian artists whose works engage with the creative potential of systems to critique, re-imagine or re-invent their workings. The exhibition is a playful blend of vibrant and kinetic works that invites viewers to reflect on the relationships between various human and non- human systems, and concepts of organisation, inter- relatedness and connectivity. Curated by Eliza Burke. Artwork by Dexter Rosengrave Courtesy the artist and Salamanca Arts Centre Tasmanian Museum and Art Gallery Dunn Place (enter via the Watergate), Hobart 7000. T (03) 6165-7000. E [email protected] W www.tmag.tas.gov.au H Tues-Sun 10.00 to 4.00 closed Mon, Good Friday, Anzac Day and Christmas Day. Wagner Framemakers 72 Brisbane Street, Hobart 7000. T (03) 6234-8599. E [email protected] W www.wagnerframemakers.com.au Wagner Framemakers offers a fresh and contemporary approach to fine art picture framing. Tricky Walsh, Playable conjunction 7 (no sooner than), gouache on North Hobart paper, 96 x 76cm Courtesy the artist, Bett Gallery, Tasmania, MARS Gallery, Melbourne and Plimsoll Gallery Contemporary Art Tasmania 27 Tasma Street, North Hobart 7000. T (03) 6231-0445. E [email protected] W www.contemporaryarttasmania.org H Wed-Sun 12.00 to 5.00. Sept 21 to Nov 4 Beyond the Field (Still) – 17 artists across two venues. Presented in partnership with Moonah Arts Centre. 162 Tasmania Sawtooth ARI Level 1, 160 Cimitiere Street, Launceston 7250. T (03) 6331-2777. E [email protected] W www.sawtooth.org.au Director: Paul Eggins. Free entry. H Wed-Fri 12.00 to 5.00, Sat 10.00 to 2.00. Through Sept Front Gallery: PALIMPSEST by Beth Emily & Eloise Kirk. Middle Gallery: Samantha Dennis. Project Space Gallery: Travey Delphin. Dark Space Gallery: iLandscape by Tammy Honey. Gate Space Gallery: Mia Kenway. North West Coast Paul Zika, Stellar 2, 2017 Courtesy the artist and Contemporary Art Tasmania Burnie Regional Art Gallery Burnie Arts & Function Centre, Wilmot Street, Burnie 7320. T (03) 6430-5875. E [email protected] W www.burniearts.net H Mon-Fri 10.00 to 4.30, Launceston Sat-Sun and public hols 1.30 to 4.00. Devonport Regional Gallery Academy Gallery 45-47 Stewart Street, Devonport 7310. School of Creative Arts, Academy of the Arts, T (03) 6424-8296. E [email protected] University of Tasmania, Invermay Road, Inveresk, W www.devonportgallery.com Free entry. H Mon-Fri Launceston 7250. T (03) 6324-4410. 10.00 to 5.00, Sat 12.00 to 5.00, Sun and public E [email protected] hols 1.00 to 5.00. To Sept 30 Main Gallery: From W www.utas.edu.au/creative-arts Director: Dr Malcom Here to There – celebrating over three decades of Bywaters. Free admission. H Mon-Fri 9.00 to 5.00, Devonport Regional Gallery at 45 Stewart Street closed weekends and public hols. Sept 24 to Oct 15 before it’s moved to the Paranaple Arts Centre. Object Design – University of Tasmania, curated by Sara Lindsay. Queen Victoria Museum & Art Gallery Art Gallery at 2 Wellington Street, and Museum at 2 Invermay Road, Launceston 7250. T (03) 6323-3777. W www.qvmag.tas.gov.au H Daily 10.00 to 5.00. To Sept 20 Material Memories – brings together six interdisciplinary practitioners who are interested in creating work which sits at the interstices between art/craft/and design. To Oct 7 Landmarks by Ilona Schneider – haunting yet beautiful depictions of the Tasmanian landscape exploring humanity’s uses and imprints. To Nov 11 Robyn McKinnon: Disappearing into Being a survey exhibition. Sept 22 to Oct 28 Lace Guild – the 2018 Australian Lace Guild Triennial Award displayed with highlights from QVMAG’s collection of historic lace. Museum: To Oct 28 Spiders – this is a face-to-face interactive encounter with real spider specimens including live Australian Tarantulas, Giant Water Spiders and deadly Funnel- webs and Redbacks. A joint project between the Australian Museum and Questacon – The National Science & Technology Centre. Allan Francis, Baptist Church once; Art Gallery now, 1987, from ‘Homes of Devon 6: Open House’, b&w photograph, DCC Permanent Collection Courtesy Devonport Regional Gallery Tasmania 163 South Australia 164 Adelaide ACE Open Lion Arts Centre, North Terrace (West End), Kaurna Yarta 5000. T (08) 8211-7505. E [email protected] W www.aceopen.art Free admission. H Tues-Sat 11.00 to 4.00. South Australia’s leading organisation for contemporary visual art and artists. To Sept 15 SONGS FOR A ROOM by Gerry Wedd. Also, The Garden by Julia McInerney. Experience new immersive exhibitions by two of South Australia’s leading artists in ACE Open’s South Australian Artist Commissions for SALA Festival 2018. Adelaide Central Gallery 7 Mulberry Road, Glenside 5065. T (08) 8299-7300. Jess Taylor, We suffer from inward growth (I), 2018, 3D printed E [email protected] W www.acsa.sa.edu.au plastic, dimensions variable Courtesy the artist and Adelaide Central Gallery H Mon, Tues Thurs-Fri 9.00 to 5.00, Wed 9.00 to 6.45. After hours by appt. To Sept 7 Good Mother – Fran Callen, Zoe Freney, Jess Mara, Jess Taylor and Anne & Gordon Samstag Fight for Self Collective – by exploring the nuances Museum of Art of the lived maternal experience, these artists show University of South Australia us the struggles and triumphs of motherhood. Sept T 17 to Oct 12 The Drawing Exchange 2018 – Louise 55 North Terrace, Adelaide 5000. (08) 8302-0870. Haselton & Damian Dillon, Bernadette Klavins & Toni E [email protected] Warburton, Michael Kutschbach & Marian Tubbs, W www.unisa.edu.au/samstagmuseum Mary-Jean Richardson & Chelsea Lehman, Hossein Free admission, all welcome. H Tues-Fri 10.00 to Valamanesh & Gary Deirmendijan and Laura Wills & 5.00, Sat 12.00 to 5.00. Closed public hols and Kirtika Kain – an ongoing collaboration between the during exhibition changeovers. Sept 14 to Nov 30 nation’s top art schools. This year 12 artists will work Starstruck: Australian Movie Portraits. Also, The Molly Reynolds Rolf de Heer in pairs to produce new works for Adelaide Central Waiting Room by and . Gallery and Rayner Hoff Project Space at the National Art School in Sydney. The exhibition encompasses a range of interdisciplinary approaches to drawing and explores the generative potential of collaboration. Proof sheet of David Gulpilil as Chris Lee, from the film The Last SPECIALISING IN SENNELIER OIL PAINTS, WATERCOLOURS, Wave, 1977, directed by Peter Weir PASTELS, DRAWING INKS & BELGIAN LINEN. Courtesy McElroy and McElroy, National Film and Sound Archive of ALSO STOCKING ART SPECTRUM, DANIEL SMITH, Australia and Anne & Gordon Samstag Museum of Art ARCHES, LANGRIDGE, CONTE, LUKAS PLUS MANY MORE. 83 Commercial Road, Port Adelaide SA 5015 Ph: (08) 8241 0059 • Fax: (08) 8241 0058 Open: Monday-Friday 8.30-5.00, Saturday 9.00-2.00 [email protected] • www.portartsupplies.com.au South Australia 165 Art Gallery of South Australia North Terrace, Adelaide 5000. T (08) 8207-7000. W www.artgallery.sa.gov.au Free entry. H Daily 10.00 to 5.00. Guided tours daily at 11.00 and 2.00. To Oct 1 Tracey Moffatt: Body Remembers – see the first Australian display of Tracey Moffatt’s photographic series ‘Body Remembers’ and video work ‘Vigil’, from her critically acclaimed 57th Venice Biennale exhibition, My Horizon, curated by Natalie King and commissioned by the Australia Council for the Arts. Also, Diane Arbus: American Portraits – this Ray Harris, On My Breath, 2018, HD digital video still, 2:45min exhibition explores one of America’s most provocative Courtesy the artist and FELTspace photographers through 36 rare vintage prints captured during the last decade of her life. For its Adelaide GAGPROJECTS | season, this exhibition has been augmented by several Arbus photographs uncovered in a private Greenaway Art Gallery South Australian collection. A National Gallery of 39 Rundle Street, Kent Town 5067. Australia touring exhibition. To Oct 28 塩田千春 by T (08) 8362-6354. E [email protected] Chiaro Shiota – the Art Gallery of South Australia W gagprojects.com Director: Paul Greenaway. presents three major projects by internationally H Tues-Fri 11.00 to 6.00, Sat-Sun 12.00 to 4.00. acclaimed contemporary Japanese artist Chiharu Aug 29 to Oct 14 Christian Lock. Shiota. See a trilogy of offerings, which include the artist’s first major solo survey exhibition to Heartland Studio be shown in an Australian public gallery, a site- 558 Marion Road, Plympton Park 5038. specific installation featuring Shiota’s iconic string T 0458-742-715. W www.facebook.com/Jungle- practice, and a new public work made for the façade Phillips-84033841545/ H Wed-Sun 10.00 to 3.00. of the Gallery. Jungle Phillips and Frantastic Fran. Hugo Michell Gallery 260 Portrush Road, Beulah Park 5067. T (08) 8331- 8000 F 8331-7000. E [email protected] W www.hugomichellgallery.com H Tues-Fri 10.00 to 5.00, Sat 11.00 to 4.00, or by appt. Aug 30 to Oct 13 Word – a group show. JamFactory Contemporary Craft & Design 19 Morphett Street, Adelaide 5000. T (08) 8410-0727. W www.jamfactory.com.au Tracey Moffatt, Spanish Window, from the series ‘Body Remembers’, H Daily 10.00 to 5.00. To Sept 16 JamFactory Icon 2017, digital pigment print on paper, 162 x 244cm 2018: Clare Belfrage: A Measure of Time. Collection of Neil Balnaves AO Courtesy the artist, Roslyn Oxley9 Gallery, Sydney, and Art Gallery of South Australia Kerry Packer Civic Gallery at the Bob Hawke FELTspace Prime Ministerial Centre 12 Compton Street, Adelaide 5000. T 0418-267-005. UniSA Hawke Building, Level 3, 55 North Terrace, E [email protected] W www.feltspace.org Adelaide 5000. T (08) 8302-0371. H Wed-Thurs 1.00 to 4.00, Fri 1.00 to 7.00, Sat W www.hawkecentre.unisa.edu.au 10.00 to 4.00, or by appt. FELTdark hours Wed-Sat H Mon-Fri 9.00 to 5.00, Thurs 9.00 to 7.00. Dusk to 12.00am. Sept 5 to 22 (opening Wed Sept Sept 5 to Oct 3 Japan: Archipelago of Houses – an 5, 5.30pm with the artists) Front Gallery: Ghosts exhibition of contemporary Japanese architecture in the Machine by Ray Harris (SA). Back Gallery: focused on the house – once the most iconic and Chelsea Farquhar (SA). FELTdark: Ghosts in the most approachable of the multi-faceted contributions Machine by Ray Harris (SA). Artist talks: Wed Sept that Japan has made to the discipline of architecture. 5, from 6pm. 166 South Australia SASA Gallery JamFactory University of South Australia, Level 2 Kaurna ϐ Building, cnr Hindley Street and Fenn Place, Adelaide 730 Seppeltsfield Road, Seppeltsfield 5355. 5000. T (08) 8302-9274. T (08) 8562-8149. W www.jamfactory.com.au E [email protected] H Daily 11.00 to 4.00. To Sept 16 FUSE Glass Prize. W www.unisa.edu.au/sasa-gallery H Mon-Fri 11.00 to 5.00. Closed public hols and during exhibition changeovers. Kapunda Community Gallery 67-69 Main Street, Kapunda 5373. E [email protected] Sister Gallery W www.kapundagallery.com Free entry, wheelchair 26 Sixth Street, Bowden 5007. access. H Mon-Sat 10.00 to 4.00, Sun 10.00 E [email protected] to 3.30. Sept 9 to Oct 21 NorthernVisions – W www.sistergallery.com.au Artsnorth Group. www.facebook.com/sistergallerysister Artist-run gallery and project space Sister Gallery is a Fontanelle Gallery and Studios supported project. State Library of South Australia SA Regional North Terrace and Kintore Avenue, Adelaide 5000. T (08) 8207-7250. W www.slsa.sa.gov.au Ascot Theatre Gallery H Mon-Wed 10.00 to 8.00, Thurs-Sun 10.00 to 48 Graves Street, Kadina 5554. T (08) 8821-2404. 5.00. Visit website for exhibition program. W www.coppercoast.sa.gov.au H Mon-Fri 10.00 to 4.00, Sat 10.00 to 12.00. Tandanya – National Aboriginal To Sept 20 Just By Chance by Janette Ireland and Cultural Institute Judy Parham. Sept 24 to Oct 18 Art For All. 253 Grenfell Street, Adelaide 5000. T (08) 8224-3200. W www.tandanya.com.au Belalie Art Gallery Established in 1989. Australia’s oldest Aboriginal- 6 Irvine Street, Jamestown 5491. T (08) 8664-0455, owned and managed multi-arts centre. 8664-1567. W www.visitjamestown.com.au/belalie- art-gallery The modern gallery hosts a vast range of curated exhibitions all year round. At other times the gallery’s own collection is on display. Barossa Valley Millicent Gallery Civic Centre, Ridge Terrace, Millicent 5280. T (08) 8733-0903. E [email protected] Adelaide Hills W www.wattlerange.sa.gov.au www.facebook.com/MillicentLibraryGallery. H Tues and Fri 9.00 to 5.30 and 6.30 to 8.30, Greater Wed-Thurs 9.00 to 5.30, Sun 2.00 to 4.00. Adelaide Port Pirie Regional Art Gallery 3 Mary Elie Street, Port Pirie 5540. T (08) 8633- 0681. W pprag.org.au H Mon-Fri 9.00 to 5.00, Barossa Regional Gallery Sat-Sun and public hols 11.00 to 3.00. Closed Good 3 Basedow Road, Tanunda 5352. Friday and Christmas Day. To Sept 9 Fibrespace – a T (08) 8563-0849. E [email protected] forum for exploring textiles as an art. Sept 15 to Oct W www.barossagallery.com H Daily 11.00 to 4.00. 28 Photographic Society Competition – amateur and professional travel photographers from around Burra Regional Art Gallery the world. 5-6 Market Street, Burra 5417. T (08) 8892-2411. W www.burragallery.com H Tues-Sun 1.00 to 4.00. Aug 30 to Oct 7 Locals by Margaret Walsh. Also, Focus by Barbara Hanrahan. South Australia 167 Western Australia 168 a selection of 50 works from established, emerging and cross-disciplinary artists from across the nation. Fremantle In 2018, the award continues to present works that celebrate the traditions of printmaking while Artitja Fine Art simultaneously looking towards the future of the medium. South Fremantle, 6162. T (08) 9336-7787, 0418-900-954. E [email protected] W www.artitja.com.au Directors: Anna Kanaris and Arthur Clarke. H By appt. Call or email to view art in a relaxed environment. Artitja Fine Art holds up to four external exhibitions a year, details of which can be found on their website. Recipients: Outstanding Cultural Enterprise award 2017 Fremantle Business Awards. Sept 1 to 24 Spring Salon Art + Objects at Gallery 152: 152 Avon Terrace, York, WA. Christine Druitt-Preston, My Place, 2018, lino block print on Wenzhou paper, 45 x 116cm Fremantle Arts Centre Printer: Brenda Tye Courtesy the artist and Fremantle Arts Centre 1 Finnerty Street, Fremantle 6160. T (08) 9432- 9555. E [email protected] W www.fac.org.au Free entry. H Daily 10.00 to 5.00. To Sept 8 Bush Heathcote Museum and Gallery Women: 25 years on. FAC re-stages the ground- Swan House, Heathcote Cultural Centre, 58 Duncraig breaking show Bush Women: Fresh Art from Road, Applecross 6153. T (08) 9364-5666. Remote WA, 25 years after the original exhibition. E [email protected] Bush Women was the first exhibition to focus on the W www.heathcotewa.com/heathcotegallery H Tues-Fri practices of key Aboriginal artists in the Kimberley and 10.00 to 3.00, Sat-Sun 12.00 to 4.00. Sept 7 to Oct Western Desert. The exhibition presented paintings by 14 (opening Thurs Sept 6, 6-8pm) Mindmatter by Paji Honeychild Yankkarr, Daisy Andrews, Queenie Bjoern Rainer-Adamson. McKenzie, Kanytjuri Bates, Tjingapa Davies and Mary McLean. Twenty-five years on, their work is held Japingka Gallery in public and private collections across the country 47 High Street, Fremantle 6160. T (08) 9335-8265. and is appreciated as a testament to the strength and E [email protected] W JapingkaAboriginalArt.com diversity of Aboriginal women’s artistic practice in H Open daily. Sept 21 to Nov 6 Gallery 1: Painting WA. Bush Women reassembles the original paintings on Country – Utopia Artists. Gallery 2: Ikuntji Artists from around Australia to restage this extraordinary from Haasts Bluff. exhibition. Co-curated by John Kean and FAC’s Erin Coates. Also, Running Deep: Holly Story and Kati Thamo | City of Fremantle Art Collection – an Moores Building exhibition which looks at the practices of senior WA Contemporary Art Gallery artists Holly Story and Kati Thamo through the lens 46 Henry Street, Fremantle 6160. of their enduring friendship and creative engagement T (08) 9432-9898. E [email protected] with WA’s South Coast. The artists initially shared the W www.fac.org.au/about/moores-building transformative, life-affirming experiences of raising H Daily 10.00 to 4.00. Sept 8 to 16 (opening families and building homes on a shared property in Fri Sept 7, 6pm) Fremantle Arts Centre Courses the bush. Subsequently they have each developed a Exhibition is a showcase of painting, drawing, visual language to interpret the natural heritage of the photography, jewellery and ceramics created by country they know so well, and their relationship to it. students who have participated in FAC’s learning Both utilise natural materials and work across a wide program in the past 12 months. Sept 22 to Oct range of media. Running Deep includes examples of 7 KOPA – is an exhibition celebrating the 100 their work from the City of Fremantle Art Collection year anniversary of independences of the 3 Baltic alongside a selection of both new and older work from countries, Estonia, Latvia and Lithuania, involving the artist’s collections. The exhibition encompasses artists from each of these countries in all art forms. print making, artist books, sculpture, dyed and Artists include Peteris Ciemitis, Julian Ciemitis, embroidered textiles and video. Sept 14 to Nov 4, Isabel Ciemitis, Selga Esots, Indra Geidans, Gabrielle 2018 Fremantle Arts Centre Print Award Supported Mazalevskis, Janis Nedela, Anita Ozolins, Ema by Little Creatures Brewing. This year the 43rd Raudzins, Maris Raudzins, Ileana Rozitis, Lolita annual Fremantle Arts Centre Print Award presents Skye-lark, Liva Ulmana, Jana Wallace-Braddock, Len the best of Australian printmaking. Australia’s premier Zuks, Linda Skrolys, Sue Briggs and Pat Madigan. showcase of prints and artists’ books returns with Western Australia 169 Cool Change Contemporary Perth City 1F, 74-84 Barrack Street, Perth 6000. E [email protected] W www.coolchange.net.au H Wed-Sun 11.00 to 6.00. A new artist-run-initiative Art Gallery Of Western Australia for exhibitions, performances, screenings, workshops Perth Cultural Centre, James Street Mall, Perth 6000. and events across multiple galleries. T (08) 9492-6600 F 9492-6655. W www.artgallery.wa.gov.au Free entry unless stated Perth Institute of otherwise. H Wed-Mon 10.00 to 5.00 (closed Tues). To Sept 17 Chinese Ceramics Revealed, 5th Century Contemporary Arts (PICA) BC-1983: Highlights from the Yuen Collection Perth Cultural Centre, 51 James Street, Perth 6000. – drawing from a significant recently revealed T (08) 9228-6300. E [email protected] private collection in Perth, this exhibition presents W www.pica.org.au Free entry. H Tues-Sun 10.00 an overview of over 70 Chinese ceramic objects of to 5.00. To Oct 7 please open hurry by Argentinian- superb artistic quality, ranging from the Warrior State born, London-based artist Amalia Pica showcases period (5th century BCE) to the late 20th century, attempts to communicate with Great Apes and test highlighting the path of its production, with its their language abilities, inspired by approaches similarities and differences, for nearly 2,500 years. To applied by primatologists over the last 50 years. Also, Nov 12 the Sidney Nolan, The Ned Kelly series – the A Self Portrait by Lebanese-born, Sydney-based Sidney Nolan rebel masterpiece series comes to Perth. artist Khaled Sabsabi features a selection of works AGWA explores the iconic Australian rebel, Ned Kelly, produced over an 11-year period. Sabsabi works as immortalised in Nolan’s celebrated series of 26 across multiple mediums and his research deals works from the 1940s. On short-term loan from the with concepts of nationhood, identity and change. National Gallery of Australia, it’s a rare opportunity to Exhibitions curated by Eugenio Viola. view this renowned series depicting the story of bush outlaw Ned Kelly through Nolan’s bold and expressive sense of landscape and vivid storytelling. To Jan 7, 2019 spaced 3: north by southeast – organised by WA-based International Art Space spaced 3: north by southeast brings together 11 artists, from Australia and the Nordic region. Each artist presents works made after immersive residencies in their opposing hemispheres and track, amongst other things, the ways that identity is composed in dynamic exchange with the forces of nature and economics. From Sept 8 WA Now – Biomess – The Tissue Culture & Art Project (Oron Catts/Ionat Zurr) – is it art? Science? Or both. Including a range of strange, bewildering, rarely seen and, just maybe, brand new organisms, this exhibition defies categorisation. In the anniversary year of Mary Shelley’s Frankenstein, the provocative project asks some moral as well as creative questions about how science operates today and might in the future. The exhibition will be presented in the form of a high-end retail installation. As the display set up implies, it will also offer a critique of the ways that humans commodify nature for our own ends. See ad page 53. Khaled Sabsabi, Corner (detail), 2017 Courtesy the artist and Perth Institute of Contemporary Art Wanneroo Gallery Wanneroo Library and Cultural Centre, 3 Rocca Way, Wanneroo 6065. W wanneroo.wa.gov.au/wanneroogallery Free entry. H Mon-Sat 10.00 to 4.00, closed Sun and public hols. To Oct 6 Find Your Treasure. 170 Western Australia material, this exhibition examines the legacy of The Artemis Women’s Art Forum, a group who aimed to Subiaco raise the status of women in the arts and to foster interest in women’s art practice and ideas. Presented Buratti Fine Art by the Cruthers Collection of Women’s Art. Also, HERE&NOW18: Besides, it is always others who Suite 6, 217 Hay Street, Subiaco 6008. die – new works from Western Australian artists – T E 1300-028-728. [email protected] Perdita Phillips, Alex Spremberg, Carly Lynch, Peter W www.buratti.com.au H Tues-Fri 10.00 to 5.00, & Molly, Julie Dowling and Bjoern Rainer-Adamson Sat-Sun by appt. responding to the challenge of contemporary art set by Marcel Duchamp 100 years ago. Gallery 360 309 Hay Street, Subiaco 6008. T (08) 9381-6577. Linton & Kay Galleries E [email protected] W www.gallery360.com.au H Mon-Fri 8.30 to 5.30, Subiaco Thurs 8.30 to 6.30, Sat 9.00 to 4.00. 299 Railway Road (cnr Nicholson Rd), Subiaco 6008. T (08) 9388-3300. E [email protected] W www.lintonandkay.com.au H Mon-Sat 10.00 to Lawrence Wilson Art Gallery 4.00, Sun 11.00 to 4.00. To Sept 16 Investment Art UWA, 35 Stirling Highway (cnr Fairway), Crawley And Secondary Sales. 6009. T (08) 6488-3707. E [email protected] W lwag.uwa.edu.au H Tues-Sat 11.00 to 5.00. To Dec 8 Stockyards and Saddles: A story of Gibb Linton & Kay Galleries River Station – explores the lives of those living West Perth and working on the remote cattle station of Gibb 11 Old Aberdean Place, West Perth 6005. River in the East Kimberley region from the early T (08) 6465 4314. E [email protected] 1900s until the 1990s. Presented by the Berndt W www.lintonandkay.com.au Museum. Sept 1 to Dec 8 No Second Thoughts: H Mon-Sat 10.00 to 4.00. Reflections on the Artemis Women’s Art Forum – including newly commissioned works and archival Western Australia 171 Geraldton Regional Art Gallery Greater Perth 24 Chapman Road, Geraldton 6530. T (08) 9956-6750. E [email protected] W artgallery.cgg.wa.gov.au H Mon-Sat 10.00 to John Curtin Gallery 4.00, public hols 1.00 to 4.00. To Sept 22 Creations Building 200, Curtin University, Kent Street, Bentley From The Man Cave by Neil Elliott. To Oct 6 Angelica 6102. T (08) 9266-4155. E [email protected] Mesiti: Relay League. W jcg.curtin.edu.au Free entry. H Mon-Fri 11.00 to 5.00, Sun 12.00 to 4.00. Jahroc Galleries 83 Bussell Highway, Margaret River 6285. Linton & Kay Galleries T (08) 9758-7200. E [email protected] Mandoon Estate Gallery W www.jahroc.com.au H Daily 10.00 to 5.00. 10 Harris Road, Cavisham 6055. T (08) 6465-4314. E [email protected] Margaret River Gallery W www.lintonandkay.com.au H Fri-Sun and public Shop 4, 1 Charles West Avenue, Margaret River hols 11.00 to 5.00. 6285. T (08) 9757-2729. E [email protected] Mundaring Arts Centre W www.margaretrivergallery.com.au H Mon-Sat 7190 Great Eastern Hwy, Mundaring 6073. 10.00 to 5.00, Sun 10.00 to 3.00. T (08) 9295-3991. E [email protected] W www.mundaringartscentre.com.au Free entry. Pilbara Creative H Tues-Fri 10.00 to 5.00, Sat-Sun 11.00 to 3.00, & Cultural Forum closed Mon and public hols. To Sept 16 Don’t East Pilbara Arts Centre, Newman Drive, Newman Jettison Everything – MAC Members Show. Also, 6753. T (08) 9226 2799. Plastic Pollution: Reducing Our Footprint and Caring E [email protected] For Our Planet – a Mundaring Environmental Art W www.pilbaracreativeforum.com.au Project. To Sept 28 Antipodean Encounters: Western Sept 21 to 22 The Pilbara Creative & Cultural Forum Australian Artists and Taiwanese Culture. Also, Tea – delivered by FORM in partnership with the Pilbara Ware. Sept 21 to Nov 4 Instrumental: The distinct Development Commission brings expert speakers and pleasures of tools. creative practitioners together in an event that will explore the Pilbara’s cultural and creative capacity to Nyisztor Studio help inform region-wide cultural strategy. This two-day 391 Canning Highway, Melville 6156. forum is for creative practitioners, change makers, T 0414-459-503. E [email protected] legislators and anyone interested in the capacity of W www.nyisztorstudio.com.au Multiple exhibition the arts to influence our economic and social systems venues. Artist studios. across Australia. Port Hedland Courthouse Gallery Regional 16 Edgar Street, Port Hedland T (08) 9173-1064. E [email protected] Bunbury Regional Art Gallery W www.form.net.au/project/port-hedland-courthouse- gallery H Mon-Fri 9.00 to 4.30, Sat 9.00 to 3.00. 64 Wittenoom Street, Bunbury 6230. T (08) 9792-7323. E [email protected] W www.brag.org.au H Daily 10.00 to 4.00. To Sept 9 Beyond Image – Contemporary Abstract Works from the City Of Bunbury Collection. To Sept 16 Jiaxing China Art Collection. To Sept 30 Left After Dark VI. Sept 1 to Oct 28 Gera Woltjer: Crossing3. 172 Western Australia Northern Territory 173 Godinymayin Yijard Rivers Museum and Art Gallery of the Arts andCultural Centre Northern Territory (MAGNT) Stuart Highway, Katherine East 0850. 19 Conacher Street, The Gardens, Darwin 0820. T (08) 8972 3751. E [email protected] T (08) 8999 8264. E [email protected] W www.gyracc.org.au H Tues-Fri 10.00 to 5.00, W www.magnt.net.au Free entry. H Daily 10.00 Sat 10.00 to 3.00. to 5.00. To Nov 11, 35th Telstra NATSIAA. The National Aboriginal & Torres Strait Islander Art Awards (NATSIAA) is Australia’s longest running and most prestigious Indigenous art award. To Feb 17, 2019 Out of the Dark: From the MAGNT Collection Darwin natural science specimens, history and culture objects and artworks from MAGNT’s nationally and Charles Darwin University internationally significant collections. To March 3, 2019 Midawarr | Harvest: Mulkun Wirrpanda and Art Gallery John Wolseley a unique printmaking collaboration Ground Floor, Building Orange 12, Casuarina between two of Australia’s most distinguished senior Campus, Darwin 0909. T (08) 8946 6621. artists, andisatouring exhibition developedbythe E [email protected] W cdu.edu.au/artgallery National Museum of Australia in partnership with H Wed Fri 10.00 to 4.00, Sat 10.00 to 2.00. Mulkun WirrpandaandJohn Wolseley. To May 17, Visit our website for programs and events. 2020 Unruly Days: Territory Life 1911-1921 richly To Oct 6 Salon des Refusés. illustrates the challenges of life in the Territory in the early 1900’s. Through Sept Feeling For Pattern: 50 Years of Tiwi Pottery highlights the evolution, style and direction of Tiwi pottery over 50 years. Peter Mungkuri, Ngura (Country), 2018, ink and synthetic polymer paint on linen, 243 x 198cm 2018 Telstra General Painting Award Winner, 35th Telstra NATSIAA Courtesy the artist and Museum & Art Gallery of the Northern Territory 174 Northern Territory Northern Centre for 4.00. Tactile Arts is a not-for-profit, member based, community arts organisation supporting artists and Contemporary Art (NCCA) artisans throughout the Top End of Australia. Vimy Lane, Parap 0820. T (08) 8981-5368. Sept 21 to Oct 7 Joyful by Isabel Lopes. W nccart.com.au H Mon-Fri 10.00 to 4.00, Sat 10.00 to 2.00, or by appt. Closed public hols. The Northern Centre for Contemporary Art delivers leading local, national and international contemporary art to Darwin. Sept 14 to Oct 13 Office Works – the Alice Springs central theme of the exhibition involves working with office-place stationary including paper, tape and other Araluen Arts Centre materials usually employed for business purposes. Larapinta Drive, Alice Springs 0870. The exhibition comprises of seven artists – Christian T E Bök, Bill Davies, Stuart Gluth, Christian Clare (08) 8951-1122. [email protected] W araluenartscentre.nt.gov.au H Daily 10.00 to 4.00. Robertson, Koulla Roussos, Don Whyte and Kaye Sept 6 to Oct 21 (opening Thurs Sept 6, 5.30pm) Strange who will showcase their collective responses Desert Mob 2018. Presented by Araluen Arts Centre to working with office materials. and Desart. Desert Mob 2017 exhibition opening Photograph: Lisa Hatz Courtesy Araluen Arts Centre Artback NT Arts Development and Touring 67 Bath Street, Alice Springs 0871. T (08) 8953-5941. W www.artbacknt.com.au Artback NT is the Northern Territory’s arts development and touring agency. The visual arts Kaye Strange, Rubber-Band DVD, 2011, rubber bands and CD program works with individuals, groups and arts- Case/s, multiple panels, 19 x 13.5cm per panel based organisations to present and tour dynamic and Courtesy the artist and Northern Centre for Contemporary Art exciting visual arts exhibitions nationally and within the Northern Territory with a focus on the development Outstation Gallery and promotion of Northern Territory artists. 8 Parap Place, Parap, Darwin 0820. T (08) 8981-4822. W www.outstation.com.au Watch This Space ARI Outstation Gallery works directly with art centres in 8 Gap Road, Alice Springs 0870. T (08) 8952-1949. the presentation and promotion of Indigenous art from E [email protected] W www.wts.org.au H Wed- the Tiwi Islands, Arnhem Land, the Western Desert, Fri 12.00 to 5.00, *Sat 10.00 to 2.00 *during the Kimberley and Central and South Australia. exhibitions. Showcasing local, interstate and Sept 1 to 30 Tjala Arts. international emerging and established artists. To Sept 8 Building Walls by Zoya Godoroja- Tactile Arts – Contemporary Prieckaerts. Sept 12 to 30 (opening Fri Sept 14, Craft Studios and Gallery 6pm) Young Female Artists of Alice Springs by Kiki Albury and Latoya Miller and more. 19 Conacher Street (located in the grounds of the Museum and Art Gallery of NT), Fannie Bay 0810. T (08) 8981-6616. E [email protected] W www.tactilearts.org.au H Tues-Sun 10.00 to Northern Territory 175 Queensland 176 Contemporary Art Awards Brisbane Exhibitions T 0407-739-871. E [email protected] Andrew Baker Art Dealer W www.contemporaryartawards.com H Mon-Sat 26 Brookes Street, Bowen Hills 4006. T (07) 3252- 10.00 to 5.00. Sept 1 to 29 Evocative by Susannah 2292, 0412-990-356. E [email protected] Paterson. W www.andrew-baker.com H Wed-Sat 10.00 to 5.00, or by appt. Paintings, photographs, prints and sculptures by leading contemporary Australian, Edwina Corlette Gallery Melanesian and Polynesian artists, including: Lincoln 2/555 Brunswick Street, New Farm 4005. Austin, Leonard Brown, Michael Cook, Karla T (07) 3358-6555. E [email protected] Dickens, Ruki Famé (PNG), Fiona Foley, Simon W www.edwinacorlette.com Director: Edwina Corlette. Gende (PNG), Taloi Havini (Bougainville), Dennis H Tues-Sat 10.00 to 5.00, or by appt. Sept 18 to Oct Nona (Torres Strait), Ömie Artists (PNG), Michel 20 Tidelines by Julian Meagher. Tuffery (New Zealand/Polynesia), Katarina Vesterberg and William Yang. Sept 19 to Oct 20 Apophoria (The FireWorks Gallery way of negation) by Leonard Brown. 9/31 Thompson Street, Bowen Hills 4006. T (07) 3216-1250. E [email protected] W www.fireworksgallery.com.au H Tues-Fri 10.00 to 6.00, Sat 10.00 to 5.00. Sept 22 to Nov 3 Punch the Clock a group exhibition. Graydon Gallery 29 Merthyr Road, New Farm 4005. T 0418-740-467. E [email protected] W www.graydongallery.com.au A contemporary gallery available for short term hire to individual artists/craftsmen or groups to showcase a wide variety of works – painting, sculpture, ceramics, jewellery, woodcraft, bespoke furniture and fashion. Bookings for 2019 are now being taken, call Cath Nicholson: 0418-740-467, or email. Jan Manton Art Contemporary Australian Leonard Brown, Untitled, 2018 + International Art Courtesy the artist and Andrew Baker Art Dealer 1/93 Fortescue Street, Spring Hill 4000. T (07) 3831-3060, 0419-657-768. E [email protected] W www.janmantonart.com Director: Jan Manton. H Wed-Fri by appt, Sat 10.00 to 4.00 no appt required. Jan Manton Art has a changing program of leading and emerging contemporary artists. Sept 5 to 29 Agency: Rare Offerings from the Museum of Spent Time by Stephen Hart. 138 Main Street, Montville 4560 07 5442 9211 [email protected] www.montvilleartgallery.com.au Daily 10.00 to 5.00 Todd Whisson, Mary River, Kenilworth, oil on canvas, framed size 93 x 183cm Queensland 177 Jan Murphy Gallery Petrie Terrace Gallery 486 Brunswick Street, Fortitude Valley 4006. home of the RQAS T (07) 3254-1855. Unit 3, 162 Petrie Terrace, Brisbane 4000. E [email protected] T (07) 3367-1977. E [email protected] W www.janmurphygallery.com.au W www.rqas.com.au An artist-run not-for-profit Director: Jan Murphy. H Tues-Sat 10.00 to 5.00 or organisation that supports emerging and established by appt. To Sept 15 Linde Ivimey. Sept 18 to Oct 6 artists running open and members exhibitions and John Nicholson. workshops. Private gallery hire, corporate and event hire available. Mitchell Fine Art 86 Arthur Street, Fortitude Valley 4006. T (07) 3254- Philip Bacon Galleries 2297. E [email protected] 2 Arthur Street, Fortitude Valley 4006. T (07) 3358- W www.mitchellfineartgallery.com H Mon-Fri 10.00 3555. E [email protected] to 5.30, Sat 10.00 to 5.00. To Sept 15 Amanda W www.philipbacongalleries.com.au H Tues-Sat Penrose Hart. Sept 19 to Oct 13 George Gittoes. 10.00 to 5.00. Philip Bacon Galleries is the largest Also, Patrick Tjungurrayi. and most established dealing gallery in Brisbane. We have a large selection of important 19th century, 20th century and contemporary paintings and sculptures in stock. Aug 28 to Sept 22 Tim Storrier. Sept 25 to Oct 20 Vera Moller. Queensland Art Gallery | Gallery of Modern Art Stanley Place, Cultural Precinct, South Bank Brisbane 4101. T (07) 3840-7303 F 3844-8865. W www.qagoma.qld.gov.au Free entry, unless otherwise stated. H Daily 10.00 to 5.00. QAG: to Oct 7 Tony Albert: Visible. To Oct 28 Australian Glass and Ceramic. To Nov 4 Amata women’s paintings. Ongoing Australian Art Collection. GOMA: to Sept 23 The Long Story. GOMA Children’s Art Centre: to Oct 7 Tony Albert: We Can Be Heroes. George Gittoes, Hidden Love, 2017-18, oil on canvas, 153 x 122cm Courtesy the artist and Mitchell Fine Art Museum of Brisbane Level 3, Brisbane City Hall, Adelaide and Ann streets, King George Square, Brisbane 4000. T (07) 3339-0800. E [email protected] W www.museumofbrisbane.com.au Free entry. H Daily 10.00 to 5.00, Fri 10.00 to 7.00. To Oct 14 BRISTOPIA. To Oct 28, 100% Brisbane. Also, Life in Irons. Nov 3 to Jan 28, 2019 Dress Code. Nov 23 to April 22, 2019 The Designers’s Guide: Easton Pearson Archive. Tony Albert, Girramay/Yidinji/Kuku Yalanji peoples Australia QLD/ NSW, Ceremony, 2016, from ‘Mid Century Modern’ series, pigment print on paper, 100 x 100cm Collection the artist Courtesy the artist, Sullivan+Strumpf, Sydney, and Queensland Art Gallery | Gallery of Modern Art 178 Queensland QUT Art Museum 2 George Street, QUT Gardens Point Campus (next to Gold Coast the City Botanic Gardens), Brisbane 4000. T (07) 3138-5370. E [email protected] W www.artmuseum.qut.edu.au Free entry. Anthea Polson Art H Tues-Fri 10.00 to 5.00, Sat-Sun 12.00 to 4.00. Shop 120 Marina Mirage, 74 Seaworld Drive, Main Visit website for programs and events. Sept 8 to Nov Beach 4217. T (07) 5561-1166. 4 The Churchie National Emerging Art Prize. E [email protected] W www.antheapolsonart.com.au Director: Anthea Redland Art Gallery Polson. H Daily 10.00 to 6.00. Sept 22 to Oct 6 Capalaba reflections from the rabbit hole by Veronica Cay. Capalaba Place, Noeleen Street, Capalaba 4157. T (07) 3829-8899. E [email protected] Gallery at HOTA W artgallery.redland.qld.gov.au Free admission. Home of the Arts H Mon-Wed, Fri 8.30 to 5.00, Thurs 8.30 to 7.30, Home of the Arts, 135 Bundall Road, Surfers Paradise Sat 9.00 to 4.00. To Oct 9 My Father’s an Artist. 4217. T (07) 5588-4067. E [email protected] W www.hota.com.au Free entry. H Mon-Sun 10.00 to Redland Art Gallery 5.00. To Sept 9 A World View: The Tim Fairfax Gift. Sept 14 to Oct 14 ENERGIES 2018 – profiles artwork Cleveland from senior secondary schools across the Gold Coast. Cnr Middle and Bloomfield streets, Cleveland 4163. T (07) 3829-8899. E [email protected] W artgallery.redland.qld.gov.au Free admission. Lorraine Pilgrim Gallery H Mon-Fri 9.00 to 4.00, Sun 9.00 to 2.00. Studio 87, 87 Ridgeway Avenue, Southport 4215. Sept 2 to Oct 14 Redland Art Awards 2018. T (07) 5532-7170, 0418-767-495. E [email protected] W www.lorrainepilgrim.com H Mon-Fri 10.00 to Suzanne O’Connell Gallery 5.00, weekends by appt. 93 James Street, New Farm 4005. T (07) 3358-5811, 0400-920-022 F 3358-5813. E [email protected] W www.suzanneoconnellgallery.com Member of ACGA. H Wed-Sat 11.00 to 4.00, or Sunshine by appt. Specialising in contemporary Australian Indigenous art. Representing leading Aboriginal Coast artists; works include paintings, fibre and wood carvings. Sept 1 to Oct 6 Ode To Nora Wompi. Montville Art Gallery University of Queensland 138 Main Street, Montville 4560. Art Museum T (07) 5442-9211. E [email protected] W www.montvilleartgallery.com.au H Daily 10.00 to James and Mary Emelia Mayne Centre (Building 11), 5.00. See ad page 177. University Drive, The University of Queensland, St Lucia 4067. T (07) 3365-3046. E [email protected] Noosa Regional Gallery W www.artmuseum.uq.edu.au H Mon-Sat 10.00 to Ground floor, 9 Pelican Street (PO Box 141), 4.00, Wed 10.00 to 8.00, closed Sun and public Riverside, Tewantin 4565. T (07) 5329-6145. hols. To Nov 11 Defying Empire – bringing together E [email protected] works by 30 contemporary Aboriginal and Torres W www.noosaregionalgallery.com H Tue-Fri 10.00 to Strait Islander artists from across the country, Defying 4.00, Sat-Sun 10.00 to 3.00 closed Mon, public hols Empire: 3rd National Indigenous Art Triennial and during exhibition changeovers. Sept 6 to Oct 14 commemorates the 50th anniversary of the 1967 As far as the eye can see – an exhibition of works by Referendum that recognised Aboriginal people as prominent Australian printmakers investigating their Australians for the first time. To Nov 25 Shirley local landscapes. Macnamara: Layered threads. ‘A landscape of spinifex rings’ is how this acclaimed senior Indigenous Yandina Historic House artist from north-west Queensland describes the 3 Pioneer Road, Yandina 4561. T (07) 5472-7181. suspended woven work that forms the centrepiece of E [email protected] her exhibition. W www.yandinahistorichouse.com.au Art Gallery Co-ordinator: Fiona Groom [email protected]. H Daily 9.30 to 2.30. Gallery, craft shop, local history, local art and artists. Queensland 179 Bundaberg Regional Galleries South East 1 Barolin Street, Bundaberg 4670. T (07) 4130-4750. E [email protected] W www.bundabergregionalgalleries.com.au Region H Mon-Fri 10.00 to 5.00, Sat-Sun and public hols 9.00 to 1.00. To Oct 7 Happy Birthday Play School: Davson Gallery Celebrating 50 Years – National Museum of Australia. Also, Dreamscape by Maki Horanai. Lockyer Valley Cultural Centre, 34 Lake Apex Drive, Gatton 4343. T 0416-026-426. E [email protected] W www.davsonarts.com Cairns Art Gallery H Mon-Fri 9.00 to 5.00, Sat 9.00 to 12.00, or by Cnr Abbott and Shields streets, Cairns 4870. appt. Art by Sharon Davson. See ad page 181. T (07) 4046-4800. E [email protected] Toowoomba Regional W www.cairnsartgallery.com.au H Mon-Fri 9.00 to 5.00, Sat 10.00 to 5.00, Sun 10.00 to 2.00. To Art Gallery Sept 9 Mara: Indigenous Design, Politics And Food 531 Ruthven Street, Toowoomba 4350. Culture. To Sept 23 Continental Drift: Black / Blak T (07) 4688-6652 F 4688-6895. E [email protected] Art From South Africa And North Australia. To Oct 7 W www.tr.qld.gov.au/trag Free admission. Olaf & Kerstens: Erwin Olaf and Hendrick Kerstens. H Tues-Sat 10.00 to 4.00, Sun 1.00 to 4.00, closed Mon and public hols. To Oct 21 Madam Life Gab Titui Cultural Centre Incarnate: Portraits from the Lindsay Collection. Sept 1 to Oct 28 Toowoomba Biennial Emerging Cnr Blackall Street and Victoria Parade, Thursday Artist Award & Exhibition. Island 4875. T (07) 4069-0888. E [email protected] W www.gabtitui.com.au H Mon-Fri 9.00 to 4.30, Sat 10.00 to 3.00. To Sept 8 Indigenous Art Award 2018 – showcasing new works by artists throughout the Torres Strait and Northern Peninsula area of Australia. KickArts Contemporary Arts 96 Abbott Street, Cairns 4870. T (07) 4050-9496. E [email protected] W www.kickarts.org.au H Mon-Sat 10.00 to 5.00. KickArts is regional Queensland’s leading contemporary visual arts organisation and presents a program of local, national and international artists. Kickarts is closing for renovations in Sept 2018, with an expected reopening of April 2019, and during this time will operate an interim program including a shop front, from the Kate Stewart, Over the waterfall, 2015, oil on canvas, 20.5 x 25.5cm School of Arts building at 93-105 Lake Street, Cairns. Toowoomba Regional Art Gallery – Toowoomba City Collection 2159 Acquired from 2016 Toowoomba Biennial Emerging Artist Award and Exhibition Courtesy the artist and Toowoomba Regional Art Gallery Western Far North District Dogwood Crossing, Miles Artspace Mackay 81 Murilla Street, Miles 4415. T (07) 4628-5330. Civic Precinct, cnr Gordon and Macalister Streets, E [email protected] Mackay 4740. T (07) 4961-9722. W www.dogwoodcrossing.com Free entry. E [email protected] H Mon-Fri 9.00 to 5.00, Sat 10.00 to 2.00, closed W www.artspacemackay.com.au Free admission. Sun. Sept 14 to Nov 6 John Mullins Memorial Art H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 3.00. Gallery: Voyages Botanical – an exhibition of solar To Oct 28 Familiar distance: Clara Adolphs. plate engravings by Christine Johnson. Curved Wall: Aug 29 to Sept 23 Goggomobil D’art. Thirteen Years in Review – an exhibition of paintings Aug 31 to Nov 25 On yer bike. and drawings by Kerryn Rabone. 180 Queensland Artist Index 182 Aarli Koorie Heritage Trust MEL Bodenham, Bridget Coffs Harbour Regional NSW Cooke, Mela Montalto Sculpture Prize VIC Abdullah, Abdul Hugo Michell Gallery SA Boddy, Adrian Justin Art House MEL Copp, Emily Gaffa Gallery SYD Abdullah, Abdul-Rahman Newcastle Art Gallery NSW Bök, Christian NCCA NT Cordero, Jason Colville Gallery TAS Abumeis, Moh Heritage Hill MEL Booth, David Hugo Michell Gallery SA Corompt, Martine Latrobe Regional VIC Ackland, Margaret Flinders Lane Gallery MEL Borland, Polly NGV Ian Potter Centre MEL Costa, Tony Art Atrium SYD Adcock, Matthew BlackCat Gallery MEL Borland, Polly Sullivan+Strumpf SYD Cottrell, Chris RMIT Gallery MEL Adolphs, Clara Artspace Mackay QLD Borries, Friederich von RMIT Gallery MEL Couts, Maryanne Australian Galleries MEL Adorned BLINDSIDE MEL Boserio, Ryan SOMA Gallery MEL Couzens, Vicki ACCA MEL Adorned Mosman Art Gallery SYD Boston, Paul Niagara Galleries MEL Cowie, B. Jane Canberra Glassworks ACT Ahmad, Jen Westend Art Space MEL Bot, G. W. Noosa Regional QLD Cox, Beverley Town Hall Gallery MEL Ahn, Sung Hee Headland Park SYD Boulter, Michaye Art House Gallery SYD Cox, Philip Museum of Sydney SYD Aitchison, Ruby Alternating Current MEL Bounpraseuth, Mechelle MAMA NSW Crick, Tex Wollongong Art Gallery NSW Aitken, Antonia Noosa Regional QLD Bowen, Dean Montalto Sculpture Prize VIC Croft, Brenda L CCAS - Gorman Arts ACT Albert, Tony QAG/GOMA QLD Bowers, Tania Blue Mountains City NSW Croft, Brenda L. Niagara Galleries MEL Albury, Kiki Watch This Space NT Boyd, Kevin Whitehorse Art Space MEL crowEST, Sarah Ararat Gallery TAMA VIC Alderton, Lynne Geelong Library VIC Boylan, Jessie Bendigo AG VIC Crumpler, Jade George Paton Gallery MEL Ali, Khadim Mosman Art Gallery SYD Bradbeer, Marcelle George Paton Gallery MEL Cubby, David Western Sydney SYD Alkira Box Hill Community Arts MEL Bradley, Ry David Gallery 9 SYD Cullen, Adam Cullen MEL Allen, Haydn Alternating Current MEL Brain, Tega Plimsoll Gallery TAS Cunningham, Geoff Hawthorn Studio MEL Altman, David Annandale Galleries SYD Braithwaite, Joanna Martin Browne SYD Curchod, Henry STACKS Projects SYD Alwast, Peter ANU Drill Hall Gallery ACT Brand Me Baby George Paton Gallery MEL Cuthbertson, Mark Montalto Sculpture Prize VIC Amanatiadis, Helen Articulate Project Space SYD Brassington, Pat Ten Cubed MEL Dahkil, Sameer Casula Powerhouse SYD Amiet, Jo Cambridge Studio MEL Breathe Earth Collective RMIT Gallery MEL Dain, Michelle Le AIRspace Projects SYD Amin, Heba Counihan Gallery MEL Breheny, Vivienne Firestation Print Studio MEL Davenport, Jo Flinders Lane Gallery MEL Amor, Rick Aust. Print Workshop MEL Brennan, Angela Niagara Galleries MEL Davey, Philip Whitehorse Art Space MEL Amor, Rick Niagara Galleries MEL Brereton, Kurt Jervis Bay NSW Davidson, Pat Manning Regional NSW Ampleyeva, Anna Walker Street Gallery MEL Bridgeman, Eric Andrew Baker Art Dealer QLD Davies, Bill NCCA NT Amsel, Galia Sabbia Gallery SYD Bridgewater, Robert Niagara Galleries MEL Davies, Gerwyn Art Gallery of Ballarat VIC Ananda, Roy Hugo Michell Gallery SA Bridie, Rosemary Town Hall Gallery MEL Davies, Heather Red Gallery MEL Anderson, Amie George Paton Gallery MEL Briggs, Sue Moores Building WA Davies, Sylvia Ceramic Break NSW Anderson, Kim Art Gallery of Ballarat VIC Briscoe, Kate Art Atrium SYD Davies, Tjingapa Fremantle Arts Centre WA Andrew, Brook Aust. Print Workshop MEL Bromhead, Matt Sheffer Gallery SYD Davis, Jan Noosa Regional QLD Andrew, Brook Hugo Michell Gallery SA Brook, Peter Tacit Galleries MEL Davis, Penelope Queen Victoria Museum TAS Andrew, Brook Ten Cubed MEL Brooke, Julie MAY SPACE SYD Davson, Sharon Davson Gallery QLD Andrews, Daisy Fremantle Arts Centre WA Brown, Jane Grace Cossington Smith SYD Daw, Kate Sarah Scout MEL Andrews, Leonie CCAS - Manuka ACT Brown, Leonard Andrew Baker Art Dealer QLD Deacon, Rosie Bega Valley Regional NSW Andrews, Susan STACKS Projects SYD Buchanan, Susan Queen Victoria Museum TAS Dean, Christine Sullivan+Strumpf SYD Anwar, Avan RMIT Project Space MEL Buckland, Tom Red Gallery MEL Dean, Iain SOMA Gallery MEL Anwar, Avan Yarra Sculpture Gallery MEL Burke, Timothy Watt Space NSW DeBoos, Janet Sabbia Gallery SYD Anwar, Rushdi 4A Centre SYD Burns, Ian Plimsoll Gallery TAS Deirmendijan, Gary Adelaide Central Gallery SA Arango, Maria Camila Quintero RMIT Project Space MEL Burrowes, Joshua Red Gallery MEL Delphin, Travey Sawtooth ARI TAS Arbus, Diane Art Gallery of SA SA Burrows, Terry Bathurst Regional NSW deMontignie, Leon MAMA NSW Archer, Susan Nicholas Thompson MEL Burruwal, Bob Alcaston Gallery MEL Dennis, Samantha Sawtooth ARI TAS Arcier, Virginie Faivre d Walker Street Gallery MEL Burstall, Jade George Paton Gallery MEL deVille, Julia Linden New Art MEL Armstrong, Stephen Collingwood Gallery MEL Butler, Angela AIRspace Projects SYD Dickason, Tracy Mu Studio Gallery SYD Armstrong, Warren Casula Powerhouse SYD Butler, Kieran ANCA ACT Dickens, Karla Andrew Baker Art Dealer QLD Armstrong, Warren fortyfivedownstairs MEL Butterworth, Deanne Sarah Scout MEL Dickens, Karla Newcastle Art Gallery NSW Arnold, Raymond Noosa Regional QLD Cahill, Anthony AIRspace Projects SYD Dilger, Carmel Handmark Gallery TAS Artsnorth Group Kapunda Community SA Cai, Ri Ying Red Gallery MEL Dillon, Beth UNSW Galleries SYD Atkinson, Felix Tinning Street MEL Callen, Fran Adelaide Central Gallery SA Dillon, Damian Adelaide Central Gallery SA Austin, Lincoln Andrew Baker Art Dealer QLD Cameron, Faridah Art Gallery of Ballarat VIC Do Campo, Fernando Newcastle Art Gallery NSW Autio, Narelle Hugo Michell Gallery SA Campbell, Jon Hugo Michell Gallery SA Dobbie, Xanthe La Trobe Art Institute VIC Avery, Gemma Westend Art Space MEL Capobianco, Jason Defiance Gallery SYD Dober, Mark Gaffa Gallery SYD Avila, Marynes Montalto Sculpture Prize VIC Cardinet, Carolyn Yering Station MEL Dodd, James Hugo Michell Gallery SA Aydemir, Cigdem Mosman Art Gallery SYD Cardoso, Maria Fernanda Siteworks NSW Doig, Adrienne Martin Browne SYD B. Plummer, Katy Sullivan+Strumpf SYD Carment, Tom Museum of Sydney SYD Done, Ken Ken Done SYD Bainbridge, Catherine fortyfivedownstairs MEL Carroll, Ben Montalto Sculpture Prize VIC Dono, Heri Aust. Print Workshop MEL Baker, Alec ACCA MEL Carroll, Pepai Jangala Sabbia Gallery SYD Douglas, Alicia Gaffa Gallery SYD Baker, Nina Nishi Gallery ACT Casey, Karen BLINDSIDE MEL Douglas-Byrnes, Genevieve George Paton Gallery MEL Balarinji Designs Koorie Heritage Trust MEL Castleden, Susanna Noosa Regional QLD Dowling, Julie Lawrence Wilson WA Baldessin, George NGV Ian Potter Centre MEL Cawthorn, Michelle Westend Art Space MEL Dowling, Julie Niagara Galleries MEL Ball, Cathy Articulate Project Space SYD Cay, Veronica Anthea Polson Art QLD Drake-Brockman, Geoffrey Mundaring Arts Centre WA Bannon, Cheryle Space2b Artspace MEL Chandler, Fiona Sydney Road Gallery SYD Draper, Kevin Mundaring Arts Centre WA Barcham, John Incinerator Gallery MEL Chang, Annette Yarra Sculpture Gallery MEL Drendel, Graeme Beaver Galleries ACT Bardolia, Melanie Cambridge Studio MEL Chapman, Amelia Red Gallery MEL Driessen, Ralf Montalto Sculpture Prize VIC Barkley, Glenn Niagara Galleries MEL Chen, Emily Yuting Alternating Current MEL Drummond, Rozalind Bundoora Homestead MEL Barlin, Kelly Gallery 139 NSW Chircop, Louisa Westend Art Space MEL Dunstan, Clare Eltham Library MEL Barnett, Elizabeth Modern Times MEL Cho, Eun Ju Salamanca Arts Centre TAS Duquemin, Judith Yellow Dot Art Gallery SYD Barry, Archie BLINDSIDE MEL Chocka, Bindi Cole Town Hall Gallery MEL Dureau, Susie Suki & Hugh Gallery NSW Barton, Arkie Koorie Heritage Trust MEL Christmann, Gunter Niagara Galleries MEL Dwyer, Mikala Roslyn Oxley9 Gallery SYD Basseghi, Sofi Bundoora Homestead MEL Christofides, Marianna Counihan Gallery MEL Dynan, Amy Stanley Street Gallery SYD Bastin, Zoë BLINDSIDE MEL Christophersen, Tom Stanley Street Gallery SYD Eager, Helen Utopia Art Sydney SYD Bate, Donald Hawthorn Studio MEL Chromatopia Tacit Galleries MEL Earl, Helen Coffs Harbour Regional NSW Bates, Holly BLINDSIDE MEL Ciccarone, Julie Niagara Galleries MEL Eastwood, David UNSW Galleries SYD Bates, Kanytjuri Fremantle Arts Centre WA Ciemitis, Isabel Moores Building WA Eaton, Janenne CCAS - Gorman Arts ACT Batt, Terry Niagara Galleries MEL Ciemitis, Julian Moores Building WA Eaton, Tony ANCA ACT Batuner, Yula Walker Street Gallery MEL Ciemitis, Peteris Moores Building WA Eden, Ebony Wollongong Art Gallery NSW Beckhouse, Janet Art House Gallery SYD Cironis, Olga Mundaring Arts Centre WA Edgar, Julie Tacit Galleries MEL Beer, Emma Gaffa Gallery SYD Clarke, Maree Koorie Heritage Trust MEL Edge, Martin Robin Gibson Gallery SYD Belfrage, Clare JamFactory SA Clarke, Maree Town Hall Gallery MEL Edwards, Tim Sabbia Gallery SYD Bellemo, Aldo Quadrant Gallery MEL Clements, Benita ACCA MEL Elenberg, Joel Museum of Sydney SYD Benglis, Lynda ANU Drill Hall Gallery ACT Cleveland, Barbara Sullivan+Strumpf SYD Elkin, Ros Gallery 139 NSW Bennett, Elesa Gaffa Gallery SYD Clyne, Melinda Gaffa Gallery SYD Elliott, Neil Geraldton Regional WA Bennetts, Barbara Mildura Arts Centre VIC Coates, Alison Defiance Gallery SYD Elliott, Stuart Mundaring Arts Centre WA Benson, Liam BLINDSIDE MEL Cochrane, Jessica Wollongong Art Gallery NSW Elson, Sarah Mundaring Arts Centre WA Benwell, Stephen Niagara Galleries MEL Cogan, Justine Gallery 139 NSW Emily, Beth Sawtooth ARI TAS Berling, Robyne Ceramic Break NSW Collerson, Nick Liverpool Street Gallery SYD Erk, Didem Counihan Gallery MEL Berner, Peter Project Gallery 90 SYD Collier, Dale Newcastle Art Gallery NSW Esots, Selga Moores Building WA Berry, Vanessa Articulate Project Space SYD Collier, Faye Manning Regional NSW Esson, Merran Casula Powerhouse SYD Beudel, Saskia ANCA ACT Collins, David Stanley Street Gallery SYD Evans, Janelle AIRspace Projects SYD Bevan, Tony Niagara Galleries MEL Collins, Jane Gallery 139 NSW Everton, Samantha Art House Gallery SYD Beynon, Kate Artspace at Realm MEL Combes, Janine Queen Victoria Museum TAS Fabok, Ivor Defiance Gallery SYD Bilu, Asher Art Gallery of Ballarat VIC Connor, Paul Art Atrium SYD Fahey, Dawne Western Sydney SYD Biondi, Giordano George Paton Gallery MEL Constantin, Akka Ballenger Strathnairn Arts ACT Fairbairn, David Casula Powerhouse SYD Biviano, Fabrizio Art House Gallery SYD Cook, Helle Latrobe Regional VIC Fairbairn, David Coffs Harbour Regional NSW Black, Karen Sullivan+Strumpf SYD Cook, Marie Warrnambool Art Gallery VIC Famé, Ruki Andrew Baker Art Dealer QLD Blackwell, James Blue Mountains City NSW Cook, Michael Andrew Baker Art Dealer QLD Farley, Jackson Stanley Street Gallery SYD Blu, Ohni Sullivan+Strumpf SYD Cook, Michael Western Plains Centre NSW Farquhar, Chelsea FELTspace SA Blundell, Joe Hawthorn Studio MEL Cook, Timothy Vivien Anderson Gallery MEL Featherston, Grant Heide Museum MEL Boardman, Amber Kudos Gallery SYD Cooke, Carol Strathnairn Arts ACT Featherston, Mary Heide Museum MEL Artist Index 183 Featherstone, Johanna Cross Art SYD Hart, John CCAS - Manuka ACT Kentridge, William Art Gallery of NSW SYD Fell, Fiona Watters Gallery SYD Hart, Sarah SOMA Gallery MEL Kenway, Mia Sawtooth ARI TAS Ferran, Anne Mornington Peninsula MEL Hart, Stephen Jan Manton Art QLD Kerr, Mel Tacit Galleries MEL Field, Sam Despard Gallery TAS Harvey, Geoff Robin Gibson Gallery SYD Kerstens, Hendrick Cairns Art Gallery QLD Fielding, Robert ACCA MEL Haselton, Louise Adelaide Central Gallery SA Khassaf, Jalal Casula Powerhouse SYD Fight for Self Collective Adelaide Central Gallery SA Hattam, Katherine Art House Gallery SYD Khazam, Bram Town Hall Gallery MEL Firth, Dianne ANCA ACT Haus of Dizzy Koorie Heritage Trust MEL Khazam, Gaby Town Hall Gallery MEL Fitzmaurice, John Montalto Sculpture Prize VIC Havini, Taloi Andrew Baker Art Dealer QLD Khounpasert, Sone Walker Street Gallery MEL Flanagan, Julia Westend Art Space MEL Hayes, Shaun Stanley Street Gallery SYD Kidd, Natasha ANU Drill Hall Gallery ACT Flanagan, Patricia Articulate Project Space SYD Hayne, Katie ANCA ACT Kim, Myunghee Tacit Galleries MEL Fleming, Tony Strathnairn Arts ACT Haynes, Jodie BLINDSIDE MEL King, Louiseann Art Gallery of Ballarat VIC Florance, Caren ANCA ACT Haythornthwaite, Sophie Fellia Melas Gallery SYD King, Martin Noosa Regional QLD Floyd, Emily Aust. Print Workshop MEL Healy, Richard SOMA Gallery MEL King, Maureen Firestation Print Studio MEL Floyd, Emily Australian Tapestry MEL Hearman, Louise Roslyn Oxley9 Gallery SYD Kingsford-Smith, Ian ARO SYD Foley, Fiona Andrew Baker Art Dealer QLD Hearnes, Emma Maffra Exhibition Space VIC Kingston, Peter Museum of Sydney SYD Foley, Fiona Niagara Galleries MEL Heed, Maria Walker Street Gallery MEL Kinnane, Aaron Art House Gallery SYD Fourie, Lou BLINDSIDE MEL Heer, Rolf de Anne & Gordon Samstag SA Kirk, Eloise Sawtooth ARI TAS Fox, Belinda Art House Gallery SYD Heiss, Leah Warrnambool Art Gallery VIC Kjar, Barbie Australian Galleries MEL Fran Jungle’s Art Studio SA Heng, Euan Niagara Galleries MEL Klavins, Bernadette Adelaide Central Gallery SA Franzke, David Sarah Scout MEL Henshall, Phil Phil Henshall Studio VIC Klee, Louis George Paton Gallery MEL Fraser, Leah Art House Gallery SYD Herzich, Paul Koorie Heritage Trust MEL Klose, Anastasia Hugo Michell Gallery SA Fraser, Simone Sabbia Gallery SYD Hespe, Caitlin Articulate Project Space SYD Kneebone, Sue Hugo Michell Gallery SA Freer, Gabrielle Gaffa Gallery SYD Hetherington, Paul ANCA ACT Kngwarreye, Kudditji Kate Owen Gallery SYD French, Brenden Scott Sabbia Gallery SYD Hey, Chloe Gallery 139 NSW Kollath, Edith RMIT Gallery MEL French, Will Hugo Michell Gallery SA Hickey, Dale Niagara Galleries MEL Kombumerri, Dillon Koorie Heritage Trust MEL Freney, Zoe Adelaide Central Gallery SA Hicks, Petrina Monash Gallery of Art MEL Kramer, Marion Thienny Lee Gallery SYD Furlonger, Joe Defiance Gallery SYD Higgins, Jess CCAS - Gorman Arts ACT Kuo, Graham Art Atrium SYD Gabori, Sally Alcaston Gallery MEL Hill, Justin Australian Tapestry MEL Kutschbach, Michael Adelaide Central Gallery SA Gallo, Rebecca Articulate Project Space SYD Hill, Peter Mundaring Arts Centre WA Kyle, Dan Defiance Gallery SYD Gamble, Michaela Western Sydney SYD Hinkley, Rhian Sarah Scout MEL Lamb, Joanna Sullivan+Strumpf SYD Gamblen, Dawn Mundaring Arts Centre WA Hodgkinson, Anthony STACKS Projects SYD Lamb, Tracey Incinerator Gallery MEL Gamblen, Phil Mundaring Arts Centre WA Hogan, Sean La Trobe Art Institute VIC Lambert, Kenneth Craig Articulate Project Space SYD Gambotto, Joanna Thienny Lee Gallery SYD Holding, Judy Montalto Sculpture Prize VIC Land, Pat Manning Regional NSW Garcia, Caroline La Trobe Art Institute VIC Holmes, Louise Nolan on Lovel Gallery NSW Landau, Sigalit Counihan Gallery MEL Gardiner, Peter Gippsland Art Gallery VIC Home, Dean Art House Gallery SYD Lane, Bill Tacit Galleries MEL Garifalakis, Tony Hugo Michell Gallery SA Hone-Saunders, Isabella BLINDSIDE MEL Lane, Francoise Koorie Heritage Trust MEL Garland, Lisa Despard Gallery TAS Honey, Tammy Sawtooth ARI TAS Lane, Suzanne Ceramic Break NSW Gatt, Jeff Handmark Gallery TAS Honeywil, John Michael Reid SYD Lang, Alice Hugo Michell Gallery SA Geddis, Aleph Coffs Harbour Regional NSW Hopkins, Colin Coffs Harbour Regional NSW Larter, Richard Niagara Galleries MEL Geidans, Indra Moores Building WA Hopmeier, Paul Defiance Gallery SYD Larwill, David Larwill Studio MEL Geli, Enric Ruiz RMIT Gallery MEL Horanai, Maki Bundaberg Regional QLD Lazauskas, Rita Gecko Studio Gallery VIC Gende, Simon Andrew Baker Art Dealer QLD Horne, Anna BLINDSIDE MEL Leahy, Jennifer Blue Mountains City NSW Gentile, Ann-Maree Eltham Library MEL Horowitz-Duldig, Slawa Duldig Studio MEL Leary, Jacob Plimsoll Gallery TAS George, Martin Montalto Sculpture Prize VIC Hout, Ronnie van Buxton Contemporary MEL LeCerf, Carly Southern Buoy Studios VIC George, Phillip Art Gallery of Ballarat VIC Hoyle, Nicola Eltham Library MEL Lee, Grace Lillian Koorie Heritage Trust MEL Georgiou, Christine Steps Gallery MEL Hseih, Teresa BLINDSIDE MEL Lee, Lindy Newcastle Art Gallery NSW Geursen, Rieteka Gallery 139 NSW Hubble, Tessa Yering Station MEL Lee, Lindy Sullivan+Strumpf SYD Gevers, Stefan Suki & Hugh Gallery NSW Humphries, Chris Tinning Street MEL Lee, Marcus Koorie Heritage Trust MEL Ghostpatrol Hugo Michell Gallery SA Hunt, Alana 4A Centre SYD Lefebvre, Heidi Red Gallery MEL Giannini, Eli Queen Victoria Museum TAS Hunter, Robert Annette Larkin Fine Art SYD Lehman, Chelsea Adelaide Central Gallery SA Gibbs, Bronwen Mildura Arts Centre VIC Hyman-Boneu, Marie-Do Walker Street Gallery MEL Lehmann, Chelsea UNSW Galleries SYD Gibbs, Christine Tacit Galleries MEL Hyunji, Kim SOMA Gallery MEL Leone, Caterina Westend Art Space MEL Giblett, Melinda Gaffa Gallery SYD Injalak Arts Koorie Heritage Trust MEL Leung, Pamela Factory 49 SYD Gibson, Ross ANCA ACT Inkamala, Beth Alcaston Gallery MEL Lewer, Richard Hugo Michell Gallery SA Gilimbaa Designs Koorie Heritage Trust MEL Iqbal, Mehwish Mosman Art Gallery SYD Lezaic, Katrina Gaffa Gallery SYD Gilson, Marlene Art Gallery of Ballarat VIC Ireland, Janette Ascot Theatre Gallery SA Lim, Jihyun Walker Street Gallery MEL Giraud, Fabien Mona TAS Irving, Tony Fellia Melas Gallery SYD Lim, Jimmy Casula Powerhouse SYD Gittoes, George Mitchell Fine Art QLD Ives, Nicholas SOMA Gallery MEL Lincoln, Kevin Defiance Gallery SYD Glover, Richard Grace Cossington Smith SYD Ivimey, Linde Jan Murphy Gallery QLD Lincoln, Kevin Gippsland Art Gallery VIC Gluth, Stuart NCCA NT Jaanz, Lynn Lynn Jaanz Art Gallery MEL Lincoln, Kevin Niagara Galleries MEL Glynn, Anna Margaret Whitlam SYD Jabar, Bassam Casula Powerhouse SYD Ling, Song Niagara Galleries MEL Go, Junko Handmark Gallery TAS Jacks, Robert Museum of Sydney SYD Linhart, Erin Red Gallery MEL Go-Sam, Carroll Koorie Heritage Trust MEL Jackson, Roy Defiance Gallery SYD Lionel, Yurpiya Sabbia Gallery SYD Godoroja-Prieckaerts, Zoya Watch This Space NT James, Jane Colville Gallery TAS Little Wonder RMIT Gallery MEL Godwin, Peter Defiance Gallery SYD James, Merlin ANU Drill Hall Gallery ACT Ljubicic, Alesandro Michael Reid SYD Gofton, Erika SOMA Gallery MEL James, Stu Australian Galleries MEL Lober, Angela Blue Mountains City NSW Gossage, Star Niagara Galleries MEL Jamie, Harrison Alternating Current MEL Lock, Christian Greenaway Gallery SA Gough, Jennifer Cambridge Studio MEL Janzen, Ona Blue Mountains City NSW Loft, Jenny Stephen McLaughlan MEL Gower, Elizabeth Geelong Gallery VIC Jarvie, Nicola Project Gallery 90 SYD Logue, Joanna Scott Livesey Galleries MEL Grabner, Michelle Niagara Galleries MEL Jasevski, Vera George Paton Gallery MEL Loneragan, Harriet Gaffa Gallery SYD Graham, Jody Articulate Project Space SYD Jasper, Michael ANCA ACT Lopes, Isabel Tactile Arts NT Greenaway, Jefa Koorie Heritage Trust MEL Jass, Rudi Montalto Sculpture Prize VIC Low, Janelle Bundoora Homestead MEL Grieve, Patrick Bett Gallery Hobart TAS Javan, Katayoun Bundoora Homestead MEL Luccio, Marco fortyfivedownstairs MEL Groen, Geoffrey de Annandale Galleries SYD Jensz, David Art Gallery of Ballarat VIC Lumley, Peta Gallery 139 NSW Grogan, Lucas Hugo Michell Gallery SA Joannou, Pollyxenia AIRspace Projects SYD Lush, Jane STACKS Projects SYD Groom, Amala CCAS - Gorman Arts ACT John-Messenger, Natasha RMIT Gallery MEL Luxton, Janet Australian Galleries SYD Guerrilla Girls NGV International MEL Johnson, Christine Dogwood Crossing QLD Lynch, Carly Lawrence Wilson WA Guichard, Frederique Walker Street Gallery MEL Johnson, Philippa Sheffer Gallery SYD Lyons, Camie Scott Livesey Galleries MEL Gullifer, Myfanwy King Street Gallery SYD Johnson, Pia Bundoora Homestead MEL MacDonald, Travis Niagara Galleries MEL Gumana, Malaluba Niagara Galleries MEL Jolley, Gary Noosa Regional QLD Macleod, Euan Niagara Galleries MEL Haider, Rubaba Niagara Galleries MEL Jones, Dianne Niagara Galleries MEL Macleod, Euan Watters Gallery SYD Hali, Clara Defiance Gallery SYD Jones, Jonathan ACCA MEL Macnamara, Shirley Uni QLD Art Museum QLD Hamilton, Jeffrey m2 Gallery SYD Jones, Locust Noosa Regional QLD Macpherson, Robert Annette Larkin Fine Art SYD Hamilton, Jim Montalto Sculpture Prize VIC Jones, Melissa Sarah Scout MEL Madigan, Pat Moores Building WA Hammond, Kirrily Beaver Galleries ACT Joseph, Jennifer Niagara Galleries MEL Magee, Morganna Bundoora Homestead MEL Handel, Jan STACKS Projects SYD Joshi, Sweety Walker Street Gallery MEL Magree, Shane Montalto Sculpture Prize VIC Hannan, Mervyn Bijou Gallery VIC Jumaadi King Street Gallery SYD Maher, Lucy Gallery 139 NSW Hanrahan, Barbara Burra Regional SA Jumaadi William Mora Galleries MEL Mahoney, Mitch BLINDSIDE MEL Harding, Matthew Montalto Sculpture Prize VIC Just, Kate Hugo Michell Gallery SA Mahoney, Molly BLINDSIDE MEL Harding, Nicholas Olsen Gallery SYD Kahan, Dena Gallerysmith MEL Makas, Joanne STACKS Projects SYD Hardy, Leah Gaffa Gallery SYD Kain, Kirtika Adelaide Central Gallery SA Makin, Jeff Central Goldfields VIC Hardy, Sarah Eltham Library MEL Kanagasundaram, Varuni Yering Station MEL Makonnen, Gennet Cambridge Studio MEL Harley, Judith Town Hall Gallery MEL Kanta, Zetta Maroondah Access MEL Maller, Natalya George Paton Gallery MEL Harper, Marion fortyfivedownstairs MEL Karadada, Louis Aust. Print Workshop MEL Malone, Maggie Gecko Studio Gallery VIC Harris, Ray FELTspace SA Kathner, Paul Tacit Galleries MEL Manning, Ross Tableland Regional QLD Harrison, Dr Aunty Eileen Gippsland Art Gallery VIC Keeling, David Niagara Galleries MEL Mara, Jess Adelaide Central Gallery SA Harrison, Misha Wollongong Art Gallery NSW Keene, Daniel fortyfivedownstairs MEL Mariani, Ashley La Trobe Art Institute VIC Harsono, Fx Sullivan+Strumpf SYD Kelly, Nicole Westend Art Space MEL Mark, India Wollongong Art Gallery NSW Hart, Amanda Penrose Mitchell Fine Art QLD Kendall, Yvonne Niagara Galleries MEL Marsh, Judy Articulate Project Space SYD Hart, Bill Plimsoll Gallery TAS Kentridge, William Annandale Galleries SYD Martinez, Judith Noosa Regional QLD 184 Artist Index Martorell, Dylan La Trobe Art Institute VIC O’Brien, Danielle Warrnambool Art Gallery VIC Rauschenberg, Robert ANU Drill Hall Gallery ACT Marynowsky, Tara Incinerator Art Space SYD O’Brien, Gregory Watters Gallery SYD Rayes, Leila El Sullivan+Strumpf SYD Mason, Kiata Westend Art Space MEL O’Brien, Liz Gallery 139 NSW Reber, Rosemarie Cambridge Studio MEL Mathieson, Sheena Stephen McLaughlan MEL O’Connor, Derek Watters Gallery SYD Reddaway, Nico George Paton Gallery MEL Maudsley, Helen Niagara Galleries MEL O’Doherty, Chris Aust. Print Workshop MEL Ren, Zhen Shan Bowral Art Gallery NSW Mawurndjul, John MCA SYD O’Doherty, Peter Manly Art Gallery SYD Rendall, Steven Niagara Galleries MEL Mazalevskis, Gabrielle Moores Building WA O’Donnell, Catherine Casula Powerhouse SYD Rewa, Edith Blue Mountains City NSW McCullagh, Helen Southern Buoy Studios VIC O’Shane, Daniel Noosa Regional QLD Reynolds, Genevieve Felix Nicholas Thompson MEL McCulloch, Shannon SOMA Gallery MEL Oates, Denese Casula Powerhouse SYD Reynolds, Molly Anne & Gordon Samstag SA McDonald, Rafaella Chapter House Lane MEL Oates, Denese Incinerator Art Space SYD Rhode, Kate Incinerator Art Space SYD McDonald, Wendy Southern Buoy Studios VIC Odlum, Nadia STACKS Projects SYD Rice, Mollie Articulate Project Space SYD McGill, Clyde Noosa Regional QLD Ohnesorge, Nana Hugo Michell Gallery SA Rice, Tess Geelong Library VIC McGregor, Laith Aust. Print Workshop MEL Okamura, Yuria La Trobe Art Institute VIC Rice, Trudy Carlisle Street Arts Space MEL McHaffie, Rob Gallery @ Bayside Arts MEL Olaf, Erwin Cairns Art Gallery QLD Richardson, Elvis Hugo Michell Gallery SA McHarrie, Angela Mundaring Arts Centre WA Ollis, Bernard Griffith Regional Gallery NSW Richardson, Mary-Jean Adelaide Central Gallery SA McInerney, Julia ACE Open SA Olsen, John Olsen MEL Richardson-Hyde, Dawna Mildura Arts Centre VIC McIntosh, Ruth Tacit Galleries MEL Olsen, John Olsen Gallery SYD Richter, Gerhard Lake Macquarie City NSW McKay, Kevin MAY SPACE SYD Ömie Artists Andrew Baker Art Dealer QLD Ritz, Eitan George Paton Gallery MEL McKenna, Noel Niagara Galleries MEL Ormella, Raquel ANU Drill Hall Gallery ACT Rix, Jimmy Montalto Sculpture Prize VIC McKenzie, Alexander Hazelhurst Regional SYD Orr, Jill Town Hall Gallery MEL Robbins, Cameron RMIT Gallery MEL McKenzie, Queenie Fremantle Arts Centre WA Ozolins, Anita Moores Building WA Roberts-Goodwin, Lynne Grace Cossington Smith SYD McKinnon, Annie Casula Powerhouse SYD Palmer, Jack George Paton Gallery MEL Robertson, Christian Clare NCCA NT McLaren, Justine M16 Artspace ACT Paolozzi, Eduardo Lake Macquarie City NSW Robinson, William S.H. Ervin Gallery SYD McLean, Mary Fremantle Arts Centre WA Papanikolakis, Elena Mosman Art Gallery SYD Roche, Carol Gaffa Gallery SYD McLennan, Liz Falkner Gallery VIC Papapetrou, Polixeni Town Hall Gallery MEL Rodden, Bronwyn Nexus Community NSW McMillan, Boyd GalleryONEEFineArts NSW Parekowhai, Michael Roslyn Oxley9 Gallery SYD Rogers, Barbara BAROMETER Gallery SYD McNeill, Jan Falkner Gallery VIC Parham, Judy Ascot Theatre Gallery SA Rogers, Catherine BAROMETER Gallery SYD Meagher, Julian Edwina Corlette Gallery QLD Park, Parallel La Trobe Art Institute VIC Rollond, Tania Coffs Harbour Regional NSW Medici, eX de Sullivan+Strumpf SYD Parker, Astra Montalto Sculpture Prize VIC Rose, Jacqueline Cross Art SYD Meijers, Mish Bett Gallery Hobart TAS Parker, Sandra Sarah Scout MEL Rosen, Jody Thienny Lee Gallery SYD Meilak, Sean Niagara Galleries MEL Parker-Smith, Janet Noosa Regional QLD Rosenblatt, Norman Town Hall Gallery MEL Mein, Annemieke Gippsland Art Gallery VIC Parks, Ti ANU Drill Hall Gallery ACT Rosengrave, Dexter Salamanca Arts Centre TAS Meller, Fiona Gaffa Gallery SYD Parr, Martin Niagara Galleries MEL Rosin, Natalie Coffs Harbour Regional NSW Mellor, Danie Tolarno Galleries MEL Parrett, James Montalto Sculpture Prize VIC Rossler, Liane Annette Larkin Fine Art SYD Mesiti, Angelica Geraldton Regional WA Parsonage, Olivia Gallery 139 NSW Rothschild, Eva ACCA MEL Mestrom, Sanné Sullivan+Strumpf SYD Pass, Edith Blue Mountains City NSW Roussos, Koulla NCCA NT MI Arts Koorie Heritage Trust MEL Paterson, Julie Noosa Regional QLD Rozitis, Ileana Moores Building WA Middlebrook, David Art Atrium SYD Paterson, Susannah Cont. Art Awards QLD Rubin, Victor Fox Galleries MEL Miles, Gary Bradley Hall VIC Paton, Steaphan Gippsland Art Gallery VIC Russell, John Art Gallery of NSW SYD Millar, Judy Sullivan+Strumpf SYD Paxton, Sally Fellia Melas Gallery SYD Russell, Stewart Sarah Scout MEL Miller, Jade Gallery 139 NSW Pearceova, Jana Manning Regional NSW Ruthi, Andreas Niagara Galleries MEL Miller, Latoya Watch This Space NT Peart, John Watters Gallery SYD Ryan, Natalie Linden New Art MEL Miller, Lydia Gallery 139 NSW Pelan, Robyn Queen Victoria Museum TAS Sabsabi, Khaled PICA WA Mills, Karen Alcaston Gallery MEL Pemapsorn, JP BlackCat Gallery MEL Sadauskas, Faustus Montalto Sculpture Prize VIC Mincham, Jeffery Sabbia Gallery SYD Pensini, Lori Gallerysmith MEL Salier, Kath Gaffa Gallery SYD Mitchell, Elizabeth Gaffa Gallery SYD Pepper, Denise Mundaring Arts Centre WA Sampi, Winnie Southern Buoy Studios VIC Mitchell, Jenni Bijou Gallery VIC Perez, Sophie Southern Buoy Studios VIC Sandford, Michael George Paton Gallery MEL Moffatt, Tracey Art Gallery of SA SA Perkins, Thea Sullivan+Strumpf SYD Sandrussi, Emily Artereal Gallery SYD Moffatt, Tracey Grafton Regional NSW Peter & Molly Lawrence Wilson WA Sankey, Olga Noosa Regional QLD Molinari, Michelle Gippsland Art Gallery VIC Peters, Sean Gaffa Gallery SYD Santiago, Marikit Mosman Art Gallery SYD Moller, Vera Philip Bacon Galleries QLD Petersen, Phred RMIT Gallery MEL Santoro, Nick Wollongong Art Gallery NSW Mombassa, Reg Aust. Print Workshop MEL Petersfield, Micheila Despard Gallery TAS Sargent, Derek Hugo Michell Gallery SA Mombassa, Reg Manly Art Gallery SYD Petyarre, Gloria Kate Owen Gallery SYD Sarkissian, Hrair Counihan Gallery MEL Monagle, Sharon Cambridge Studio MEL Philippe-Janon, Nadège Plimsoll Gallery TAS Sawant, Sanjay Walker Street Gallery MEL Monks, Nicole Koorie Heritage Trust MEL Philjames Hugo Michell Gallery SA Sayers, Phil Red Gallery MEL Montigne, Gwenaelle Walker Street Gallery MEL Phillips, Jungle Jungle’s Art Studio SA Scarce, Yhonnie ACCA MEL Moon, Robin Gaffa Gallery SYD Phillips, Justy Salamanca Arts Centre TAS Scarce, Yhonnie Newcastle Art Gallery NSW Moon, Timothy Gaffa Gallery SYD Phillips, Perdita Lawrence Wilson WA Schlicht, Rollin Museum of Sydney SYD Morawetz, Sara Articulate Project Space SYD Pica, Amalia PICA WA Schneider, Ilona Queen Victoria Museum TAS Mosley, Toni Gaffa Gallery SYD Picasso, Pablo NGA ACT Schreiber, Libby Eltham Library MEL Moule, Judy-Ann Articulate Project Space SYD Piccinini, Patricia Town Hall Gallery MEL Scotece, Enrico Western Sydney SYD Mptyane, Harry Dixon Niagara Galleries MEL Pickering, Linda Tacit Galleries MEL Scovill, Ole Walker Street Gallery MEL Mueller, Helen Noosa Regional QLD Pip & Pop Art Gallery of Ballarat VIC Secombe, Ted MAS Gallery MEL Mullens, Andy Bundoora Homestead MEL Pitel, Victoria Lismore Regional NSW Seiffert, Linda Incinerator Art Space SYD Munden, Paul ANCA ACT Pittock, Kenny Hugo Michell Gallery SA Senbergs, Jan Aust. Print Workshop MEL Mungatopi, Maryanne Aust. Print Workshop MEL Pleiades, Wolfgang Alternating Current MEL Senbergs, Jan Niagara Galleries MEL Mungkuri, Peter ACCA MEL Plowman, Bev Tacit Galleries MEL Seton, Alex Sullivan+Strumpf SYD Murphy, Clara RMIT Project Space MEL Plowman, Nicholas SOMA Gallery MEL Seymour, Margaret Articulate Project Space SYD Murray, Kendal Art House Gallery SYD Pola, Toby Hugo Michell Gallery SA Seymour, Nobby Langford 120 MEL Musgrove, Betty Bundoora Homestead MEL Polke, Sigmar Lake Macquarie City NSW Shalekoff, Sharron Mildura Arts Centre VIC Myburgh, Marlize Maroondah Access MEL Pollak, Ana Defiance Gallery SYD Sharp, Wendy Griffith Regional Gallery NSW Nagy, Eugene Von Tacit Galleries MEL Polo, Tom Hugo Michell Gallery SA Sharpe, Wendy King Street Gallery SYD Namatjira, Vincent ACCA MEL Pompey, Jimmy ACCA MEL Shead, Garry Museum of Sydney SYD Nampitjinpa, Alice Noosa Regional QLD Poon, Anton Red Gallery MEL Sheard, Charlie MAY SPACE SYD Namunjdja, Samuel Niagara Galleries MEL Potgieter, Mandi Gate 6 Gallery MEL Shen, Senye Yarra Sculpture Gallery MEL Nanshe, Barbara Gallery 139 NSW Potter, Jacob ANU Drill Hall Gallery ACT Shinfield, Gary Noosa Regional QLD Napangardi, Dorothy Noosa Regional QLD Pound, Patrick Plimsoll Gallery TAS Shumack, Kaye Gaffa Gallery SYD Neale, Maisie Gallery 139 NSW Pound, Patrick STATION MEL Simms, Michael Stanley Street Gallery SYD Nedela, Janis Moores Building WA Powditch, Peter Defiance Gallery SYD Sims, Jason Art Gallery of Ballarat VIC Nell Town Hall Gallery MEL Prado, Paula do AIRspace Projects SYD Skalar, Siegmund RMIT Project Space MEL Nelson, Elizabeth Gaffa Gallery SYD Pratt, Louis Incinerator Art Space SYD Skipper, Pijaju Peter Aust. Print Workshop MEL Nelson, Ilona Town Hall Gallery MEL Preece, Glen Artarmon Galleries SYD Skrolys, Linda Moores Building WA Nettleton, Julie Blue Mountains City NSW Proctor, Bill Art at Linden Gate MEL Skye-lark, Lolita Moores Building WA Newcombe, Paul Brightspace MEL Protick, Sarker 4A Centre SYD Slater, Liz Grafton Regional NSW NG, Dawn Sullivan+Strumpf SYD Puglielli, Emidio Stephen McLaughlan MEL Sloan, Paul Hugo Michell Gallery SA Ngale, Polly Kate Owen Gallery SYD Pullar, Harry Gecko Studio Gallery VIC Smith, Dean Alcaston Gallery MEL Nguyen, Hoa Walker Street Gallery MEL Pumani, Betty Kuntiwa Alcaston Gallery MEL Smith, Joshua Australian Design Centre SYD Nguyen, Van Walker Street Gallery MEL Pwerle, Angelina Niagara Galleries MEL Smith, Talia Bundoora Homestead MEL Nicholls, Mike Montalto Sculpture Prize VIC Qinwu, Hu Niagara Galleries MEL Smolska, Marianne Walker Street Gallery MEL Nicholson, John Jan Murphy Gallery QLD Quilty, Andy SOMA Gallery MEL Snowball, Arryn Nicholas Thompson MEL Nolan, Rose ANU Drill Hall Gallery ACT Quinn, Saxon Tacit Galleries MEL Solh, Mounira Al Counihan Gallery MEL Nolan, Sidney Art Gallery of WA WA Quinteros, Samuel Incinerator Art Space SYD Soliman, Phil George Paton Gallery MEL Nona, Dennis Andrew Baker Art Dealer QLD Qureshi, Nusra Latif Artspace at Realm MEL Sollier, Maya George Paton Gallery MEL Norman, Aunty Irene Artspace at Realm MEL Rabling, John Tacit Galleries MEL Soper, Kath Manning Regional NSW Northwood, Paige Wollongong Art Gallery NSW Rabone, Kerryn Dogwood Crossing QLD Sorensen, Kurt Grace Cossington Smith SYD Norton, Adam Incinerator Art Space SYD Rahm, Philippe RMIT Gallery MEL Souza, Keg de Mosman Art Gallery SYD Norton, Kevin Defiance Gallery SYD Rainer-Adamson, Bjoern Heathcote Museum WA Sparkes, Dave Grafton Regional NSW Nuske, Sophia Hugo Michell Gallery SA Rainer-Adamson, Bjoern Lawrence Wilson WA Sparkes, Pierra Van La Trobe Art Institute VIC Nyadbi, Lena Niagara Galleries MEL Raudzins, Ema Moores Building WA Spedding, Jacqueline Blue Mountains City NSW O’Brien, Catherine Walker Street Gallery MEL Raudzins, Maris Moores Building WA Spicer, Rod Artarmon Galleries SYD Artist Index 185 Spiller, Winsome Red Gallery MEL Tome, Matthew Lock Up NSW Westwood, Hadley Manning Regional NSW Spoehr, Richard Stella Downer Fine Art SYD Tomkins, Andrew Art Atrium SYD Whiskey, Kaylene ACCA MEL Spokes, Kerry Gecko Studio Gallery VIC Topolcsanyi, Ilona Coffs Harbour Regional NSW Whisson, Ken Niagara Galleries MEL Spremberg, Alex Lawrence Wilson WA Tosca, Floria Flinders Street Gallery SYD White, John ANCA ACT Spurrier, Stephen Langford 120 MEL Toukan, Oraib Counihan Gallery MEL White, Max Lawrence Factory 49 SYD Staff, Rose George Paton Gallery MEL Transsolar RMIT Gallery MEL Whiteley, Brett Brett Whiteley Studio SYD Steinberg, Yvonne Thienny Lee Gallery SYD Trevethan, Merryn Fox Galleries MEL Whiteley, Brett Museum of Sydney SYD Stevens, Kate CCAS - Gorman Arts ACT Trulsson, Ulrica Coffs Harbour Regional NSW Whiteley, Brett NGV Ian Potter Centre MEL Steyerl, Hito NGV Ian Potter Centre MEL Truman, Catherine Mornington Peninsula MEL Whitten, Jennifer SOMA Gallery MEL Stockdale, Jacqui Newcastle Art Gallery NSW Tsivopolous, Stefanos Counihan Gallery MEL Whyte, Don NCCA NT Storrier, Tim Museum of Sydney SYD Tubbs, Marian Adelaide Central Gallery SA Wiebke, Karl ANU Drill Hall Gallery ACT Storrier, Tim Philip Bacon Galleries QLD Tucker, Albert Heide Museum MEL Wigley, Christabel Montalto Sculpture Prize VIC Story, Holly Fremantle Arts Centre WA Tucker, Jessie Willow Bundoora Homestead MEL Wijaya, Agus Incinerator Art Space SYD Strange, Di STACKS Projects SYD Tuffery, Michel Andrew Baker Art Dealer QLD Willcocks, Jo Gaffa Gallery SYD Strange, Kaye NCCA NT Tunks, Bruce M16 Artspace ACT Williams, Marshall Soho Waterloo SYD Strange, Shane ANCA ACT Turner-Carroll, Shan Artspace at Realm MEL Williams, Susannah Casula Powerhouse SYD Street, Mervyn Aust. Print Workshop MEL Turner-Carroll, Shan Newcastle Art Gallery NSW Williams, Susannah fortyfivedownstairs MEL Streeton, Arthur Whitehorse Art Space MEL Tuttle, Chris Gecko Studio Gallery VIC Wills, Laura Adelaide Central Gallery SA Stringer, Richard Carlisle Street Arts Space MEL Tuttle, Richard ANU Drill Hall Gallery ACT Wilson, Freedom Noosa Regional QLD Stuart, Rebekah Art at St Francis MEL Uhlmann, Nicholas Montalto Sculpture Prize VIC Wilson’s, Freedom Blue Mountains City NSW Stubbs, Sarah Queen Victoria Museum TAS UK Frederick ANCA ACT Wiltshire, Christine Articulate Project Space SYD Sukumaran, Myuran Bendigo AG VIC Ulmana, Liva Moores Building WA Wimberley, Zan Artereal Gallery SYD Summerfield, Rochelle Noosa Regional QLD Unsworth, Ken NGV Ian Potter Centre MEL Windberg, Tony Mundaring Arts Centre WA Summers, Peter Tacit Galleries MEL Upfield, Gary BlackCat Gallery MEL Winkler, Konrad Chapman & Bailey MEL Sunbury Art Society Gee Lee-Wik Doleen MEL Uranishi, Kenji Coffs Harbour Regional NSW Winkler, Ros Chapman & Bailey MEL Swalwell, Derek Modern Times MEL Usmiani, Lucia Despard Gallery TAS Wirrpanda, Mulkun Museum & Art Gallery NT NT Sylvester, Darren Monash Gallery of Art MEL Valamanesh, Hossein Adelaide Central Gallery SA Wlodarczak, Gosia Town Hall Gallery MEL T’Jolle, Sven STATION MEL Varney, Abigail Nishi Gallery ACT Wokkijabber Casula Powerhouse SYD Tabacco, Wilma Town Hall Gallery MEL Vatanajyankur, Kawita Alcaston Gallery MEL Wolseley, John Museum & Art Gallery NT NT Tan, Kynan UNSW Galleries SYD Venables, Prue Stella Downer Fine Art SYD Woltjer, Gera Bunbury Regional WA Tang, Cyrus Town Hall Gallery MEL Vesterberg, Katarina Andrew Baker Art Dealer QLD Wompi, Nora Suzanne O’connell QLD Tango, Hiromi Sullivan+Strumpf SYD Vongpoothorn, Savanhdary Niagara Galleries MEL Wong, Min Hugo Michell Gallery SA Tawale, Salote Mosman Art Gallery SYD Waldron, Ian Montalto Sculpture Prize VIC Wood, David Carlisle Street Arts Space MEL Taweel, Shireen Mosman Art Gallery SYD Walker, Deborah Carlisle Street Arts Space MEL Wood, David Montalto Sculpture Prize VIC Taweel, Shirween Casula Powerhouse SYD Walker, Emma Art House Gallery SYD Wood, Heidi Arts Academy VIC Taylor, Chris Yering Station MEL Wallace-Braddock, Jana Moores Building WA Wood, Isabelle Westend Art Space MEL Taylor, Jess Adelaide Central Gallery SA Walsh, Brenda Tacit Galleries MEL Wood, Roger Gaffa Gallery SYD Taylor, Nathan Bett Gallery Hobart TAS Walsh, Margaret Burra Regional SA Woodward, Laura Plimsoll Gallery TAS Taylor, Neil Niagara Galleries MEL Walsh, Natasha Casula Powerhouse SYD Woodward, Margaret Salamanca Arts Centre TAS Taylor, Sharon Gallery 139 NSW Walsh, Tricky Plimsoll Gallery TAS Woolfe, Lisa STACKS Projects SYD Teer, Dave Defiance Gallery SYD Wanambi, Wolpa Niagara Galleries MEL Wright, Helen Niagara Galleries MEL Thackway, Clare Westend Art Space MEL Wanambi, Wukun Niagara Galleries MEL Wyman, Jemima Sullivan+Strumpf SYD Thamo, Kati Fremantle Arts Centre WA Waples-Crowe, Peter ACCA MEL Xun, Sun MCA SYD The 69 Collective BlackCat Gallery MEL Warburton, Toni Adelaide Central Gallery SA Yaltangki, Tiger ACCA MEL The Numina Sisters Art Gallery of Ballarat VIC Ward, Peter Tacit Galleries MEL Yaltangki, Tiger Alcaston Gallery MEL Thomas, Melissa Bolin Bolin Gallery MEL Warren, Em Gallery 139 NSW Yang, William Andrew Baker Art Dealer QLD Thompson, Carlene Alcaston Gallery MEL Warren, Kerrie Pilgrim Creek Studios VIC Yankkarr, Paji Honeychild Fremantle Arts Centre WA Thompson, Christian Monash Gallery of Art MEL Waters, David Montalto Sculpture Prize VIC Yarinkura, Lena Alcaston Gallery MEL Thompson, Derek Jungarrayi Sabbia Gallery SYD Waters, Sera Hugo Michell Gallery SA Yeldham, Joshua Art House Gallery SYD Thomson, Ann Defiance Gallery SYD Watkins, Simon RMIT Gallery MEL Yokoyama, Kayo Gallery 139 NSW Thwaite, Penny Lock Up NSW Watson, Charlotte Bundoora Homestead MEL Yore, Paul Hugo Michell Gallery SA Tiatia, Angela Bundoora Homestead MEL Watson, Claire Anna MAY SPACE SYD Young, Carolyn Goulburn Regional NSW Tiatia, Angela Sullivan+Strumpf SYD Watson, Diana Frances Keevil Gallery SYD Young, John Owe Collingwood Gallery MEL Tighe, Martin Gallerysmith MEL Watson, Judy Noosa Regional QLD Young, Lyn-Al Koorie Heritage Trust MEL Tillers, Imants Annette Larkin Fine Art SYD Watson, Sian Red Gallery MEL Young, Nick Fellia Melas Gallery SYD Tillers, Imants Arc One MEL Waup, Lisa ACCA MEL Young, Yaritji Alcaston Gallery MEL Tilson, Joe Lake Macquarie City NSW Webb, Jen ANCA ACT Youssef, Justine BLINDSIDE MEL Tinpalit, Pimpisa Alternating Current MEL Wedd, Gerry ACE Open SA Youssef, Justine Sullivan+Strumpf SYD Tinpalit, Pimpisa Yarra Sculpture Gallery MEL Wedd, Gerry Hugo Michell Gallery SA Yuncken, James fortyfivedownstairs MEL Tippett, Monique Mundaring Arts Centre WA Weir, Barbara Kate Owen Gallery SYD Zabel, Madisyn M16 Artspace ACT Tippett, Pam Australian Galleries SYD Welch, Andrew Gaffa Gallery SYD Zanko, Chris Wollongong Art Gallery NSW Tipping, Richard Latrobe Regional VIC Wellm, Irene Tacit Galleries MEL Zavala-Baeza, Marcelo Articulate Project Space SYD Tiravanija, Rirkrit NGV International MEL Werther, Frank Town Hall Gallery MEL Zheng, Lei March Space MEL Tjungurrayi, Patrick Mitchell Fine Art QLD West, Margaret Stanley Street Gallery SYD Zhuoquan, Liu Niagara Galleries MEL Tobin, Chris Noosa Regional QLD Westfold, Katherine Tacit Galleries MEL Zofrea, Salvatore Australian Galleries MEL Todd, Yvonne Fine Arts, Sydney SYD Westmoreland, Bradd Niagara Galleries MEL Zuks, Len Moores Building WA /HYHO %XLOGLQJ $ 3DFLíF +LJKZD\ 6W /HRQDUGV 16: Locked Bag 5555, St Leonards NSW 1590. T 02 9901 6100. Executive Chairman David Gardiner. Managing Director +DPLVK %D\OLVV Circulation Director Caroline Jones. Art Almanac is published by nextmedia Pty Ltd, ACN: 128 805 970 /HYHO %XLOGLQJ $ 3DFLíF +LJKZD\ 6W /HRQDUGV 16: All rights reserved. No part of this magazine may be reproduced, in whole or in part, without the prior permission of the publisher. Printed by SOS Print + Media, distributed in Australia by Gordon & Gotch. ISSN 0313-220x. The publisher will not accept responsibility or any liability for the correctness of information or opinions expressed in the publication. All material submitted is at the owner’s risk and, while every care will be taken nextmedia does not accept liability for loss or damage. Privacy Policy We value the integrity of your personal information. If you provide personal information through your partici- pation in any competitions, surveys or offers featured in this issue of Art Almanac, this will be used to provide the products or services that you have requested and to improve the content of our magazines. Your details may be provided to third parties who assist us in this purpose. In the event of organisations providing prizes or offers to our readers, we may pass your details on to them. From time to time, we may use the information you provide us to inform you of other products, services and events our company has to offer. We may also give your information to other organisations which may use it to inform you about their products, services and events, unless you tell us not to do so. You are welcome to access WKH LQIRUPDWLRQ WKDW ZH KROG DERXW \RX E\ JHWWLQJ LQ WRXFK ZLWK RXU SULYDF\ RIíFHU ZKR FDQ EH FRQWDFWHG DW nextmedia, Locked Bag 5555, St Leonards, NSW 1590. 186 Artist Index BOAA will be the largest showcase of Australian Art ever presented: > 150 artists > 65 curated solo exhibitions > Lakeside Sculpture Walk > Performance art projects > Outdoor installations BALLARAT 21 Sep - 6 Nov 2018 > BOAA Music Tickets from $25 (2 day pass) : www.boaa.net.au/tickets