FOLR2 (Human) Recombinant Protein (Q01)

Total Page：16

File Type：pdf, Size：1020Kb

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic FOLR2 (Human) Recombinant delivery of 5-methyltetrahydrofolate to the interior of Protein (Q01) cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, Catalog Number: H00002350-Q01 respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other Regulation Status: For research use only (RUO) tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid Product Description: Human FOLR2 partial ORF ( arthritis patients. Multiple transcript variants that encode NP_000794.1, 36 a.a. - 128 a.a.) recombinant protein the same protein have been found for this gene. with GST-tag at N-terminal. [provided by RefSeq] Sequence: HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKD TSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNL GPWIQQVNQTWRKERFLDVPL Host: Wheat Germ (in vitro) Theoretical MW (kDa): 35.97 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 2350 Gene Symbol: FOLR2 Gene Alias: BETA-HFR, FBP/PL-1, FR-BETA, FR-P3 Gene Summary: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Anti-FOLR2 Purified Cat
EXBIO Praha, a.s. • Nad Safinou II 341 • 252 50 Vestec • Czech Republic [email protected] • [email protected] • [email protected] • www.exbio.cz Technical Data Sheet Product Anti-FOLR2 Purified Cat. Number/Size 11-696-C025 0.025 mg 11-696-C100 0.1 mg For Research Use Only. Not for use in diagnostic or therapeutic procedures. Antigen FOLR2 Clone EM-35 Format Purified Reactivity Human Negative species Mouse Application FC (QC tested), IP, WB, ICC Application details Western blotting: Non-reducing conditions. Flow cytometry: Recommended dilution: 1-4 µg/ml Isotype Mouse IgG1 Specificity The mouse monoclonal antibody EM-35 recognizes an extracellular epitope on FOLR2, a 30-40 kDa cell surface protein serving as a receptor for folic acid. Other names Folate receptor beta, FBP, FR-P3, FR-BETA, BETA-HFR, FBP/PL-1 Immunogen BW5147alpha,beta- cells Entrez Gene ID 2350 Gene name FOLR2 NCBI Full Gene Name folate receptor beta UniProt ID P14207 Concentration 1 mg/ml Preparation Purified by protein-A affinity chromatography Formulation Phosphate buffered saline (PBS) solution with 15 mM sodium azide Storage and handling Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label. Images and References www.exbio.cz The product is intended For Research Use Only. Diagnostic or therapeutic applications are strictly forbidden. Products shall not be used for resale or transfer to third parties either as a stand-alone product or as a manufacture component of another product without written consent of EXBIO Praha, a.s. EXBIO Praha, a.s.
[Show full text]
Anti-FOLR2 Antibody (ARG41860)
Product datasheet [email protected] ARG41860 Package: 100 μl anti-FOLR2 antibody Store at: -20°C Summary Product Description Mouse Monoclonal antibody recognizes FOLR2 Tested Reactivity Hu Tested Application WB Host Mouse Clonality Monoclonal Clone 1905CT501.41.76 Isotype IgG2b, kappa Target Name FOLR2 Antigen Species Human Immunogen Recombiant protein of Human FOLR2. Conjugation Un-conjugated Alternate Names Folate receptor 2; BETA-HFR; FBP; Folate receptor beta; Folate receptor, fetal/placental; FBP/PL-1; FR- beta; FR-P3; Placental folate-binding protein; FR-BETA Application Instructions Application table Application Dilution WB 1:1000 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control Human placenta Calculated Mw 29 kDa Observed Size ~ 33 kDa Properties Form Liquid Purification Purification with Protein G. Buffer PBS and 0.09% (W/V) Sodium azide. Preservative 0.09% (W/V) Sodium azide Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/2 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol FOLR2 Gene Full Name folate receptor 2 (fetal) Background The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11.
[Show full text]
Folic Acid and Its Receptors Jacqueline Spreadbury Governors State University
Governors State University OPUS Open Portal to University Scholarship All Capstone Projects Student Capstone Projects Spring 2013 Folic Acid and Its Receptors Jacqueline Spreadbury Governors State University Follow this and additional works at: http://opus.govst.edu/capstones Part of the Analytical Chemistry Commons Recommended Citation Spreadbury, Jacqueline, "Folic Acid and Its Receptors" (2013). All Capstone Projects. 8. http://opus.govst.edu/capstones/8 For more information about the academic degree, extended learning, and certificate programs of Governors State University, go to http://www.govst.edu/Academics/Degree_Programs_and_Certifications/ Visit the Governors State Analytical Chemistry Department This Project Summary is brought to you for free and open access by the Student Capstone Projects at OPUS Open Portal to University Scholarship. It has been accepted for inclusion in All Capstone Projects by an authorized administrator of OPUS Open Portal to University Scholarship. For more information, please contact [email protected]. Jacqueline Spreadbury Graduate Literary Review Project Spring Semester 2013 Folic Acid and its Receptors Overview of Folic Acid Folic acid, also known as folate or vitamin B9, is essential for various functions in the human body and life as we know it. Folate is the compound that occurs naturally in food, and folic acid is the synthetic form of this vitamin (1). Chemically speaking, folic acid has the hydrogen (H+) attached to the compound whereas folate is the conjugate, having lost the hydrogen (H+) (1). In the discussion below, folic acid and folate will be used interchangeably. The human body requires about 400 micrograms of folic acid daily, but cannot create folic acid on its own; instead the human diet must take in folate on a daily basis (2).
[Show full text]
Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands That Promote Axonal Growth
Research Article: New Research Development Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands that Promote Axonal Growth Jeremy S. Toma,1 Konstantina Karamboulas,1,ª Matthew J. Carr,1,2,ª Adelaida Kolaj,1,3 Scott A. Yuzwa,1 Neemat Mahmud,1,3 Mekayla A. Storer,1 David R. Kaplan,1,2,4 and Freda D. Miller1,2,3,4 https://doi.org/10.1523/ENEURO.0066-20.2020 1Program in Neurosciences and Mental Health, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada, 2Institute of Medical Sciences University of Toronto, Toronto, Ontario M5G 1A8, Canada, 3Department of Physiology, University of Toronto, Toronto, Ontario M5G 1A8, Canada, and 4Department of Molecular Genetics, University of Toronto, Toronto, Ontario M5G 1A8, Canada Abstract Peripheral nerves provide a supportive growth environment for developing and regenerating axons and are es- sential for maintenance and repair of many non-neural tissues. This capacity has largely been ascribed to paracrine factors secreted by nerve-resident Schwann cells. Here, we used single-cell transcriptional profiling to identify ligands made by different injured rodent nerve cell types and have combined this with cell-surface mass spectrometry to computationally model potential paracrine interactions with peripheral neurons. These analyses show that peripheral nerves make many ligands predicted to act on peripheral and CNS neurons, in- cluding known and previously uncharacterized ligands. While Schwann cells are an important ligand source within injured nerves, more than half of the predicted ligands are made by nerve-resident mesenchymal cells, including the endoneurial cells most closely associated with peripheral axons. At least three of these mesen- chymal ligands, ANGPT1, CCL11, and VEGFC, promote growth when locally applied on sympathetic axons.
[Show full text]
Transcriptional Profile of Human Anti-Inflamatory Macrophages Under Homeostatic, Activating and Pathological Conditions
UNIVERSIDAD COMPLUTENSE DE MADRID FACULTAD DE CIENCIAS QUÍMICAS Departamento de Bioquímica y Biología Molecular I TESIS DOCTORAL Transcriptional profile of human anti-inflamatory macrophages under homeostatic, activating and pathological conditions Perfil transcripcional de macrófagos antiinflamatorios humanos en condiciones de homeostasis, activación y patológicas MEMORIA PARA OPTAR AL GRADO DE DOCTOR PRESENTADA POR Víctor Delgado Cuevas Directores María Marta Escribese Alonso Ángel Luís Corbí López Madrid, 2017 © Víctor Delgado Cuevas, 2016 Universidad Complutense de Madrid Facultad de Ciencias Químicas Dpto. de Bioquímica y Biología Molecular I TRANSCRIPTIONAL PROFILE OF HUMAN ANTI-INFLAMMATORY MACROPHAGES UNDER HOMEOSTATIC, ACTIVATING AND PATHOLOGICAL CONDITIONS Perfil transcripcional de macrófagos antiinflamatorios humanos en condiciones de homeostasis, activación y patológicas. Víctor Delgado Cuevas Tesis Doctoral Madrid 2016 Universidad Complutense de Madrid Facultad de Ciencias Químicas Dpto. de Bioquímica y Biología Molecular I TRANSCRIPTIONAL PROFILE OF HUMAN ANTI-INFLAMMATORY MACROPHAGES UNDER HOMEOSTATIC, ACTIVATING AND PATHOLOGICAL CONDITIONS Perfil transcripcional de macrófagos antiinflamatorios humanos en condiciones de homeostasis, activación y patológicas. Este trabajo ha sido realizado por Víctor Delgado Cuevas para optar al grado de Doctor en el Centro de Investigaciones Biológicas de Madrid (CSIC), bajo la dirección de la Dra. María Marta Escribese Alonso y el Dr. Ángel Luís Corbí López Fdo. Dra. María Marta Escribese
[Show full text]
FOLR2 Mouse Monoclonal Antibody [Clone ID: OTI5B1] Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA808018 FOLR2 Mouse Monoclonal Antibody [Clone ID: OTI5B1] Product data: Product Type: Primary Antibodies Clone Name: OTI5B1 Applications: IHC, WB Recommended Dilution: WB 1:200, IHC 1:150 Reactivity: Human Host: Mouse Isotype: IgG2a Clonality: Monoclonal Immunogen: Human recombinant protein fragment corresponding to amino acids 20-221 of human FOLR2(NP_000794) produced in E.coli. Formulation: PBS (PH 7.3) containing 1% BSA, 50% glycerol and 0.02% sodium azide. Concentration: 1 mg/ml Purification: Purified from mouse ascites fluids or tissue culture supernatant by affinity chromatography (protein A/G) Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 29.1 kDa Gene Name: folate receptor beta Database Link: NP_000794 Entrez Gene 2350 Human P14207 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 FOLR2 Mouse Monoclonal Antibody [Clone ID: OTI5B1] – TA808018 Background: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5- methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively.
[Show full text]
Single-Cell Transcriptome Analysis Reveals Mesenchymal Stem Cells In
bioRxiv preprint doi: https://doi.org/10.1101/2021.09.02.458742; this version posted September 3, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Single-cell transcriptome analysis reveals mesenchymal stem cells 2 in cavernous hemangioma 3 Fulong Ji1$, Yong Liu2$, Jinsong Shi3$, Chunxiang Liu1, Siqi Fu1 4 Heng Wang1, Bingbing Ren1, Dong Mi4, Shan Gao2*, Daqing Sun1* 5 1 Department of Paediatric Surgery, Tianjin Medical University General Hospital, Tianjin 300052, P.R. China. 6 China. 7 2 College of Life Sciences, Nankai University, Tianjin, Tianjin 300071, P.R. China; 8 3 National Clinical Research Center of Kidney Disease, Jinling Hospital, Nanjing University School of 9 Medicine, Nanjing, Jiangsu 210016, P.R. China; 10 4 School of Mathematical Sciences, Nankai University, Tianjin, Tianjin 300071, P.R. China; 11 12 13 $ These authors contributed equally to this paper. 14 * Corresponding authors. 15 SG：[email protected] 16 DS：[email protected] 17 bioRxiv preprint doi: https://doi.org/10.1101/2021.09.02.458742; this version posted September 3, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 18 Abstract 19 A cavernous hemangioma, well-known as vascular malformation, is present at birth, grows 20 proportionately with the child, and does not undergo regression.
[Show full text]
INTEGRATIVE SYSTEM BIOLOGY STUDIES on HIGH THROUGHPUT GENOMICS and PROTEOMICS DATASET Madhankumar Sonachalam
INTEGRATIVE SYSTEM BIOLOGY STUDIES ON HIGH THROUGHPUT GENOMICS AND PROTEOMICS DATASET Madhankumar Sonachalam Submitted to the faculty of the Bioinformatics Graduate Program in partial fulfillment of the requirements for the degree Master of Science in Bioinformatics in the School of Informatics Indiana University May 2012 Accepted by the Faculty of Indiana University, in partial fulfillment of the requirements for the degree of Master of Science in Bioinformatics _________________________________ Dr. Jake Yue Chen, Ph.D., Chairperson __________________________________ Dr. Li Shen, Ph.D Master’s Thesis Committee __________________________________ Dr. Yaoqi Zhou, Ph.D ii ©2012 Madhankumar Sonachalam ALL RIGHTS RESERVED iii Dedicated to Amma & Appa iv Acknowledgements This thesis would not exist if not for the support and guidance of many of my friends and family. To each of them I would like to express my gratitude. Furthermore, I would like to explicitly mention a select few, whose help has been invaluable to me. I owe my most sincere gratitude to my research advisor, Dr. Jake Yue Chen, for his motivation, enthusiasm and immense knowledge. His energy, vision, and great efforts had been a constant source of inspiration. I am very grateful to him for the constant support and for playing a major role in honing my writing and presentation skills. Besides my advisor, I would like to thank the rest of my thesis committee Dr.Shen Li and Dr. Yaoqi Zhou for their encouragement and insightful comments. I would also like to extend my thanks to our collaborators Dr. Tim Ratliff and Dr. Shen Li for providing us an excellent dataset to explore various bioinformatics techniques.
[Show full text]
Anti-FOLR2 Antibody [EM-35] (PE) (ARG42341)
Product datasheet [email protected] ARG42341 Package: 50 μg anti-FOLR2 antibody [EM-35] (PE) Store at: 4°C Summary Product Description PE-conjugated Mouse Monoclonal antibody [EM-35] recognizes FOLR2 Tested Reactivity Hu Species Does Not React With Ms Tested Application FACS Specificity The mouse monoclonal antibody EM-35 recognizes an extracellular epitope on FOLR2, a 30-40 kDa cell surface protein serving as a receptor for folic acid. Host Mouse Clonality Monoclonal Clone EM-35 Isotype IgG1 Target Name FOLR2 Species Human Immunogen BW5147 alpha, beta cells. Conjugation PE Alternate Names Folate receptor 2; BETA-HFR; FBP; Folate receptor beta; Folate receptor, fetal/placental; FBP/PL-1; FR- beta; FR-P3; Placental folate-binding protein; FR-BETA Application Instructions Application table Application Dilution FACS 1 - 5 µg/ml Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Properties Form Liquid Purification Purified Buffer PBS and 15 mM Sodium azide. Preservative 15 mM Sodium azide Concentration 0.1 mg/ml Storage instruction Aliquot and store in the dark at 2-8°C. Keep protected from prolonged exposure to light. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/2 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol FOLR2 Gene Full Name folate receptor 2 (fetal) Background The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11.
[Show full text]
FOLR2 Antibody Cat
FOLR2 Antibody Cat. No.: 61-763 FOLR2 Antibody Western blot analysis of lysates from MDA-MB-453 cell line, Western blot analysis of lysate from human placenta human placenta tissue lysate (from left to right), using FOLR2 tissue lysate, using FOLR2 Antibody at 1:1000. Antibody at 1:1000 at each lane. Western blot analysis of lysates from KG-1, MCF-7, Western blot analysis of lysate from human placenta tissue MDA-MB-453 cell line (from left to right), using FOLR2 lysate, using FOLR2 Antibody at 1:1000. Antibody at 1:1000 at each lane. September 28, 2021 1 https://www.prosci-inc.com/folr2-antibody-61-763.html FOLR2 Antibody IHC analysis in formalin fixed and Western blot analysis of lysate from mouse heart tissue lysate, paraffin embedded human spleen followed by using FOLR2 Antibody at 1:1000. peroxidase conjugation of the secondary antibody and DAB staining. Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human, Mouse This FOLR2 antibody is generated from rabbits immunized with a KLH conjugated IMMUNOGEN: synthetic peptide between 18-46 amino acids from the N-terminal region of human FOLR2. TESTED APPLICATIONS: Flow, IHC-P, WB For WB starting dilution is: 1:1000 APPLICATIONS: For IHC-P starting dilution is: 1:10~50 PREDICTED MOLECULAR 29 kDa WEIGHT: Properties This antibody is purified through a protein A column, followed by peptide affinity PURIFICATION: purification. CLONALITY: Polyclonal ISOTYPE: Rabbit Ig CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: Supplied in PBS with 0.09% (W/V) sodium azide. CONCENTRATION: batch dependent Store at 4˚C for three months and -20˚C, stable for up to one year.
[Show full text]
Investigating the Influence of Perinatal Nicotine and Alcohol Exposure On
www.nature.com/scientificreports OPEN Investigating the infuence of perinatal nicotine and alcohol exposure on the genetic profles of dopaminergic neurons in the VTA using miRNA–mRNA analysis Tina Kazemi, Shuyan Huang, Naze G. Avci, Charlotte Mae K. Waits, Yasemin M. Akay & Metin Akay* Nicotine and alcohol are two of the most commonly used and abused recreational drugs, are often used simultaneously, and have been linked to signifcant health hazards. Furthermore, patients diagnosed with dependence on one drug are highly likely to be dependent on the other. Several studies have shown the efects of each drug independently on gene expression within many brain regions, including the ventral tegmental area (VTA). Dopaminergic (DA) neurons of the dopamine reward pathway originate from the VTA, which is believed to be central to the mechanism of addiction and drug reinforcement. Using a well-established rat model for both nicotine and alcohol perinatal exposure, we investigated miRNA and mRNA expression of dopaminergic (DA) neurons of the VTA in rat pups following perinatal alcohol and joint nicotine–alcohol exposure. Microarray analysis was then used to profle the diferential expression of both miRNAs and mRNAs from DA neurons of each treatment group to further explore the altered genes and related biological pathways modulated. Predicted and validated miRNA-gene target pairs were analyzed to further understand the roles of miRNAs within these networks following each treatment, along with their post transcription regulation points afecting gene expression throughout development. This study suggested that glutamatergic synapse and axon guidance pathways were specifcally enriched and many miRNAs and genes were signifcantly altered following alcohol or nicotine–alcohol perinatal exposure when compared to saline control.
[Show full text]
46715389.Pdf
View metadata, citation and similar papers at core.ac.uk brought to you by CORE NIH Public Access provided by DigitalCommons@The Texas Medical Center Author Manuscript Birth Defects Res A Clin Mol Teratol. Author manuscript; available in PMC 2011 March 1. NIH-PA Author ManuscriptPublished NIH-PA Author Manuscript in final edited NIH-PA Author Manuscript form as: Birth Defects Res A Clin Mol Teratol. 2010 August ; 88(8): 689±694. doi:10.1002/bdra.20706. Association of Folate Receptor (FOLR1, FOLR2, FOLR3) and Reduced Folate Carrier (SLC19A1) Genes with Meningomyelocele Michelle R. O’Byrne1, Kit Sing Au1, Alanna C. Morrison2, Jone-Ing Lin2, Jack M. Fletcher3, Kathryn K. Ostermaier4, Gayle H. Tyerman5, Sabine Doebel6, and Hope Northrup1,7,* 1Department of Pediatrics, The University of Texas Medical School at Houston, Houston, Texas 2Human Genetics Center, The University of Texas School of Public Health at Houston, Texas 3Department of Psychology, University of Houston, Houston, Texas 4Texas Children’s Hospital, Houston, Texas 5Shriners Hospital for Children, Los Angeles, California 6The Hospital for Sick Children, University of Toronto, Ontario, Canada 7Shriners Hospital for Children, Houston, Texas Abstract BACKGROUND—Meningomyelocele (MM) results from lack of closure of the neural tube during embryologic development. Periconceptional folic acid supplementation is a modifier of MM risk in humans, leading to an interest in the folate transport genes as potential candidates for association to MM. METHODS—This study used the SNPlex Genotyping (ABI, Foster City, CA) platform to genotype 20 single polymorphic variants across the folate receptor genes (FOLR1, FOLR2, FOLR3) and the folate carrier gene (SLC19A1) to assess their association to MM.
[Show full text]