Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic FOLR2 (Human) Recombinant delivery of 5-methyltetrahydrofolate to the interior of (Q01) cells. This protein has a 68% and 79% with the FOLR1 and FOLR3 , Catalog Number: H00002350-Q01 respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other Regulation Status: For research use only (RUO) tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid Product Description: Human FOLR2 partial ORF ( arthritis patients. Multiple transcript variants that encode NP_000794.1, 36 a.a. - 128 a.a.) recombinant protein the same protein have been found for this . with GST-tag at N-terminal. [provided by RefSeq]

Sequence: HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKD TSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNL GPWIQQVNQTWRKERFLDVPL

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 35.97

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 2350

Gene Symbol: FOLR2

Gene Alias: BETA-HFR, FBP/PL-1, FR-BETA, FR-P3

Gene Summary: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these exist in a cluster on 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate

Page 1/1

Powered by TCPDF (www.tcpdf.org)