Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic FOLR2 (Human) Recombinant delivery of 5-methyltetrahydrofolate to the interior of Protein (Q01) cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, Catalog Number: H00002350-Q01 respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other Regulation Status: For research use only (RUO) tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid Product Description: Human FOLR2 partial ORF ( arthritis patients. Multiple transcript variants that encode NP_000794.1, 36 a.a. - 128 a.a.) recombinant protein the same protein have been found for this gene. with GST-tag at N-terminal. [provided by RefSeq] Sequence: HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKD TSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNL GPWIQQVNQTWRKERFLDVPL Host: Wheat Germ (in vitro) Theoretical MW (kDa): 35.97 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 2350 Gene Symbol: FOLR2 Gene Alias: BETA-HFR, FBP/PL-1, FR-BETA, FR-P3 Gene Summary: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-