DOCSLIB.ORG

Table SI. Phosphorylated Proteins Identified in Rats with Cancer-Induced Bone Pain

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Table SI. Phosphorylated Proteins Identified in Rats with Cancer-Induced Bone Pain Table SI. Phosphorylated proteins identified in rats with cancer-induced bone pain. Accession Description Microtubule-associated protein 1A OS=Rattus norvegicus GN=Map1a PE=1 P34926 SV=1 - [MAP1A_RAT] Microtubule-associated protein 1B OS=Rattus norvegicus GN=Map1b PE=1 F1LRL9 SV=1 - [F1LRL9_RAT] Microtubule-associated protein 1B OS=Rattus norvegicus GN=Map1b PE=1 P15205 SV=2 - [MAP1B_RAT] Neurofilament medium polypeptide OS=Rattus norvegicus GN=Nefm PE=1 G3V7S2 SV=3 - [G3V7S2_RAT] Microtubule associated protein 1A (Fragment) OS=Rattus norvegicus Q63330 GN=Map1a PE=2 SV=1 - [Q63330_RAT] 14-3-3 protein gamma OS=Rattus norvegicus GN=Ywhag PE=1 SV=2 - P61983 [1433G_RAT] Q62745 CD81 antigen OS=Rattus norvegicus GN=Cd81 PE=1 SV=1 - [CD81_RAT] A-kinase anchor protein 12 OS=Rattus norvegicus GN=Akap12 PE=1 SV=1 - Q5QD51 [AKA12_RAT] Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus G3V874 GN=Epb41l3 PE=1 SV=1 - [G3V874_RAT] 60S acidic ribosomal protein P2 OS=Rattus norvegicus GN=Rplp2 PE=1 SV=2 - P02401 [RLA2_RAT] Gap junction gamma-2 protein OS=Rattus norvegicus GN=Gjc2 PE=1 SV=2 - Q80XF7 [CXG2_RAT] Prostaglandin E synthase 3 OS=Rattus norvegicus GN=Ptges3 PE=1 SV=2 - P83868 [TEBP_RAT] Adenosylhomocysteinase 2 OS=Rattus norvegicus GN=Ahcyl1 PE=1 SV=1 - A0A140TAI8 [A0A140TAI8_RAT] Uncharacterized protein OS=Rattus norvegicus PE=4 SV=1 - A0A0G2K4Q1 [A0A0G2K4Q1_RAT] F1LQN3 Reticulon OS=Rattus norvegicus GN=Rtn4 PE=1 SV=1 - [F1LQN3_RAT] Band 4.1-like protein 1 OS=Rattus norvegicus GN=Epb41l1 PE=1 SV=1 - A0A0G2K0F3 [A0A0G2K0F3_RAT] Q5HZA7 Bin1 protein OS=Rattus norvegicus GN=Bin1 PE=1 SV=1 - [Q5HZA7_RAT] Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=1 - F1LRZ7 [F1LRZ7_RAT] Neurofilament light polypeptide OS=Rattus norvegicus GN=Nefl PE=1 SV=3 - P19527 [NFL_RAT] F1M9N9 Ankyrin 2 OS=Rattus norvegicus GN=Ank2 PE=1 SV=3 - [F1M9N9_RAT] Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 - P16884 [NFH_RAT] Microtubule-associated protein OS=Rattus norvegicus GN=Map2 PE=1 SV=1 - A0A0U1RRX4 [A0A0U1RRX4_RAT] D3ZZ99 Alpha-adducin OS=Rattus norvegicus GN=Add1 PE=1 SV=3 - [D3ZZ99_RAT] Heat shock protein HSP 90-beta OS=Rattus norvegicus GN=Hsp90ab1 PE=1 P34058 SV=4 - [HS90B_RAT] Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus F1LNI8 norvegicus GN=Camk2b PE=1 SV=1 - [F1LNI8_RAT] Myelin basic protein OS=Rattus norvegicus GN=Mbp PE=1 SV=3 - P02688 [MBP_RAT] Eukaryotic translation initiation factor 3 subunit B OS=Rattus norvegicus Q4G061 GN=Eif3b PE=1 SV=1 - [EIF3B_RAT] P07936 Neuromodulin OS=Rattus norvegicus GN=Gap43 PE=1 SV=1 - [NEUM_RAT] F8WFS9 Beta-adducin OS=Rattus norvegicus GN=Add2 PE=1 SV=1 - [F8WFS9_RAT] SH3-containing GRB2-like protein 3-interacting protein 1 OS=Rattus norvegicus F1M1Y0 GN=Sgip1 PE=1 SV=3 - [F1M1Y0_RAT] 28 kDa heat- and acid-stable phosphoprotein OS=Rattus norvegicus GN=Pdap1 Q62785 PE=1 SV=1 - [HAP28_RAT] D4A559 Dematin actin-binding protein OS=Rattus norvegicus GN=Dmtn PE=1 SV=1 - [D4A559_RAT] F1MA86 Gephyrin OS=Rattus norvegicus GN=Gphn PE=1 SV=3 - [F1MA86_RAT] Actin, cytoplasmic 1 OS=Rattus norvegicus GN=Actb PE=1 SV=1 - P60711 [ACTB_RAT] Thioredoxin domain containing 1 OS=Rattus norvegicus GN=Tmx1 PE=1 SV=1 Q52KJ9 - [Q52KJ9_RAT] Microtubule-associated protein OS=Rattus norvegicus GN=Mapt PE=1 SV=1 - D4A1Q2 [D4A1Q2_RAT] Serine and arginine repetitive matrix 1 OS=Rattus norvegicus GN=Srrm1 PE=1 B2RYB3 SV=1 - [B2RYB3_RAT] NAC alpha domain-containing OS=Rattus norvegicus GN=Nacad PE=1 SV=2 - F1M6E5 [F1M6E5_RAT] Transcriptional activator protein Pur-beta OS=Rattus norvegicus GN=Purb PE=1 Q68A21 SV=3 - [PURB_RAT] Transcriptional activator protein Pur-beta OS=Rattus norvegicus GN=Purb PE=1 A0A0G2JUX5 SV=1 - [A0A0G2JUX5_RAT] Myosin, heavy polypeptide 10, non-muscle, isoform CRA_b OS=Rattus G3V9Y1 norvegicus GN=Myh10 PE=1 SV=1 - [G3V9Y1_RAT] 60S acidic ribosomal protein P0 OS=Rattus norvegicus GN=Rplp0 PE=1 SV=2 - P19945 [RLA0_RAT] P35565 Calnexin OS=Rattus norvegicus GN=Canx PE=1 SV=1 - [CALX_RAT] Eukaryotic translation initiation factor 4B OS=Rattus norvegicus GN=Eif4b Q5RKG9 PE=1 SV=1 - [Q5RKG9_RAT] Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus P06687 GN=Atp1a3 PE=1 SV=2 - [AT1A3_RAT] Q9JKS6 Protein piccolo OS=Rattus norvegicus GN=Pclo PE=1 SV=1 - [PCLO_RAT] Protein phosphatase inhibitor 2 OS=Rattus norvegicus GN=Ppp1r2 PE=1 SV=1 - A0A0H2UHA0 [A0A0H2UHA0_RAT] D4A8B3 Calcium-transporting ATPase OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=3 - [D4A8B3_RAT] Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 - Q02563 [SV2A_RAT] Sptbn1 protein (Fragment) OS=Rattus norvegicus GN=Sptbn1 PE=2 SV=1 - Q5D002 [Q5D002_RAT] NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus GN=Sirt2 A0A0G2JWM2 PE=1 SV=1 - [A0A0G2JWM2_RAT] F1M3W5 Dmx-like 2 OS=Rattus norvegicus GN=Dmxl2 PE=1 SV=3 - [F1M3W5_RAT] F1LPB9 Rabphilin-3A OS=Rattus norvegicus GN=Rph3a PE=1 SV=1 - [F1LPB9_RAT] Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Rattus A2VD12 norvegicus GN=Pbxip1 PE=1 SV=1 - [PBIP1_RAT] Electrogenic sodium bicarbonate cotransporter 1 OS=Rattus norvegicus Q9JI66 GN=Slc4a4 PE=1 SV=1 - [S4A4_RAT] High mobility group protein HMG-I/HMG-Y OS=Rattus norvegicus GN=Hmga1 Q8K585 PE=1 SV=3 - [HMGA1_RAT] Synapsin-3 OS=Rattus norvegicus GN=Syn3 PE=1 SV=2 - A0A096MIT7 [A0A096MIT7_RAT] 14-3-3 protein epsilon OS=Rattus norvegicus GN=Ywhae PE=1 SV=1 - P62260 [1433E_RAT] Putative uncharacterized protein RGD1307615_predicted OS=Rattus norvegicus D3ZKQ4 GN=Rabl6 PE=1 SV=1 - [D3ZKQ4_RAT] Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Rattus norvegicus Q9JJ19 GN=Slc9a3r1 PE=1 SV=3 - [NHRF1_RAT] Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus P06686 GN=Atp1a2 PE=1 SV=1 - [AT1A2_RAT] RCG25591, isoform CRA_a OS=Rattus norvegicus GN=Stt3b PE=1 SV=1 - B2RYD7 [B2RYD7_RAT] Serine/arginine repetitive matrix 2 OS=Rattus norvegicus GN=Srrm2 PE=1 A0A0G2K2M9 SV=1 - [A0A0G2K2M9_RAT] Protein transport protein Sec31A OS=Rattus norvegicus GN=Sec31a PE=1 SV=1 A0A0G2K0X9 - [A0A0G2K0X9_RAT] Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus P06685 GN=Atp1a1 PE=1 SV=1 - [AT1A1_RAT] Elongation factor 1-delta OS=Rattus norvegicus GN=Eef1d PE=1 SV=2 - Q68FR9 [EF1D_RAT] 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Rattus norvegicus GN=Cnp P13233 PE=1 SV=2 - [CN37_RAT] 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Rattus norvegicus GN=Cnp A0A097BVJ5 PE=2 SV=1 - [A0A097BVJ5_RAT] Tubulin alpha-1A chain OS=Rattus norvegicus GN=Tuba1a PE=1 SV=1 - P68370 [TBA1A_RAT] Q6IN33 Calcipressin-1 OS=Rattus norvegicus GN=Rcan1 PE=2 SV=1 - [RCAN1_RAT] Myristoylated alanine-rich C-kinase substrate OS=Rattus norvegicus F1LMW7 GN=Marcks PE=1 SV=3 - [F1LMW7_RAT] Microtubule-associated protein 4 OS=Rattus norvegicus GN=Map4 PE=1 SV=1 Q5M7W5 - [MAP4_RAT] Hepatoma-derived growth factor-related protein 2 OS=Rattus norvegicus Q925G1 GN=Hdgfrp2 PE=1 SV=2 - [HDGR2_RAT] Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b A0A0H2UHV4 PE=1 SV=1 - [A0A0H2UHV4_RAT] START domain containing 10, isoform CRA_b OS=Rattus norvegicus Q5BJN1 GN=Stard10 PE=1 SV=1 - [Q5BJN1_RAT] Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 F1LRY7 OS=Rattus norvegicus GN=Hcn2 PE=1 SV=3 - [F1LRY7_RAT] Proteasome subunit alpha type-3 OS=Rattus norvegicus GN=Psma3 PE=1 SV=3 P18422 - [PSA3_RAT] Myosin XVIIIa OS=Rattus norvegicus GN=Myo18a PE=1 SV=2 - D3ZFD0 [D3ZFD0_RAT] Q6RJR6 Reticulon-3 OS=Rattus norvegicus GN=Rtn3 PE=1 SV=1 - [RTN3_RAT] A0A096MJN4 Septin 4 OS=Rattus norvegicus GN=Sept4 PE=1 SV=1 - [A0A096MJN4_RAT] Breast carcinoma-amplified sequence 1 homolog (Fragment) OS=Rattus Q3ZB98 norvegicus GN=Bcas1 PE=1 SV=2 - [BCAS1_RAT] Breast carcinoma-amplified sequence 1 homolog OS=Rattus norvegicus A0A0G2K079 GN=Bcas1 PE=1 SV=1 - [A0A0G2K079_RAT] Heterogeneous nuclear ribonucleoprotein L-like OS=Rattus norvegicus D4A3E1 GN=Hnrnpll PE=1 SV=1 - [D4A3E1_RAT] Oxysterol-binding protein OS=Rattus norvegicus GN=Osbp PE=1 SV=2 - D4A9D8 [D4A9D8_RAT] Creatine kinase B-type OS=Rattus norvegicus GN=Ckb PE=1 SV=2 - P07335 [KCRB_RAT] Calcium-dependent secretion activator 1 OS=Rattus norvegicus GN=Cadps PE=1 Q62717 SV=1 - [CAPS1_RAT] G3V7X2 Scg2 protein OS=Rattus norvegicus GN=Scg2 PE=1 SV=2 - [G3V7X2_RAT] Tumor protein D54 OS=Rattus norvegicus GN=Tpd52l2 PE=1 SV=1 - Q6PCT3 [TPD54_RAT] Phosphatidylinositol 4-kinase type 2-alpha OS=Rattus norvegicus GN=Pi4k2a Q99M64 PE=1 SV=1 - [P4K2A_RAT] Uncharacterized protein OS=Rattus norvegicus GN=Hepacam PE=1 SV=2 - D3ZEI4 [D3ZEI4_RAT] F-box only protein 6 OS=Rattus norvegicus GN=Fbxo6 PE=1 SV=1 - Q923V4 [FBX6_RAT] Rap1gap protein (Fragment) OS=Rattus norvegicus GN=Rap1gap PE=2 SV=1 - Q5EB70 [Q5EB70_RAT] Clathrin heavy chain OS=Rattus norvegicus GN=Cltc PE=1 SV=1 - F1M779 [F1M779_RAT] Tight junction protein 2 OS=Rattus norvegicus GN=Tjp2 PE=1 SV=1 - Q3ZB99 [Q3ZB99_RAT] Amphiphysin-like OS=Rattus norvegicus GN=LOC100910792 PE=1 SV=1 - A0A0G2K5Z4 [A0A0G2K5Z4_RAT] Similar to 25 kDa brain-specific protein (P25-alpha) (Predicted), isoform CRA_a D3ZQL7 OS=Rattus norvegicus GN=Tppp PE=1 SV=1 - [D3ZQL7_RAT] Protein NDRG3 OS=Rattus norvegicus GN=Ndrg3 PE=1 SV=3 - D4ACZ5 [D4ACZ5_RAT] Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 - A0A0H2UHF9 [A0A0H2UHF9_RAT] Tripartite motif-containing protein 2 OS=Rattus norvegicus GN=Trim2 PE=1 A0A0G2K2M8 SV=1 - [A0A0G2K2M8_RAT] Glial fibrillary acidic protein OS=Rattus norvegicus GN=Gfap PE=1 SV=2 - P47819 [GFAP_RAT]
Load more

Recommended publications
  • ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic
    ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic Aberrations in Canine Osteosarcoma and Their Resemblance to the Human Counterpart. (Under the direction of Dr. Matthew Breen). In the last decade the domestic dog has emerged as an ideal biomedical model of complex genetic diseases such as cancers. Cancer in the dog occurs spontaneously and several studies have concluded that human and canine cancers have similar characteristics such as presentation of disease, rate of metastases, genetic dysregulation, and survival rates. Furthermore, in the genomic era the dog genome was found more homologous in sequence conservation to humans than mice, making it a valuable model organism for genetic study in addition to pathophysiological analysis. Osteosarcoma (OS), the most commonly diagnosed malignant bone tumor in humans and dogs, is one such cancer that would benefit from comparative genomic analysis. In humans, OS is a rare cancer diagnosed in fewer than 1,000 people per year in the USA, while in the domestic dog population the annual number of new cases is estimated to far exceed 10,000. This high rate of disease occurrence in dogs provides a unique opportunity to study the genomic imbalances in canine OS and their translational value to human OS as a means to identify important alterations involved in disease etiology. OS in humans is characterized by extremely complex karyotypes which contain both structural changes (translocations and/or rearrangements) and DNA copy number changes. Metaphase and array comparative genomic hybridization (aCGH) has assisted in uncovering the genetic imbalances that are associated with human OS phenotype. In dog OS, previous low-resolution (10-20Mb) aCGH analysis identified a wide range of recurrent copy number aberrations (CNAs), indicative of a similar level of genomic instability to human OS.
    [Show full text]
  • 1 1 Alpha-Smooth Muscle Actin (ACTA2) Is Required for Metastatic Potential of Human 1 Lung Adenocarcinoma 2 3 Hye Won Lee*1,2,3
    Author Manuscript Published OnlineFirst on August 30, 2013; DOI: 10.1158/1078-0432.CCR-13-1181 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. 1 1 Alpha-smooth muscle actin (ACTA2) is required for metastatic potential of human 2 lung adenocarcinoma 3 4 Hye Won Lee*1,2,3, Young Mi Park*3,4, Se Jeong Lee1,4,5, Hyun Jung Cho1,2, Duk-Hwan Kim6,7, 5 Jung-Il Lee2, Myung-Soo Kang3, Ho Jun Seol2, Young Mog Shim8, Do-Hyun Nam1,2,3, Hyeon 6 Ho Kim3,4, Kyeung Min Joo1,3,4,5 7 8 Authors’ Affiliations: 9 1Cancer Stem Cell Research Center, 2Department of Neurosurgery, 3Department of Health 10 Sciences and Technology, Samsung Advanced Institute for Health Sciences and 11 Technology (SAIHST), 4Samsung Biomedical Research Institute, 5Department of Anatomy 12 and Cell Biology, 6Department of Molecular Cell Biology, 7Center for Genome Research, 13 8Department of Thoracic Surgery, Samsung Medical Center, Sungkyunkwan University 14 School of Medicine, Seoul, Korea 15 16 *These authors contributed equally to this work. 17 18 Running title: ACTA2 confers metastatic potential on lung adenocarcinoma 19 Keywords: Non-small cell lung adenocarcinoma, alpha-smooth muscle actin, migration, 20 invasion, metastasis 1 Downloaded from clincancerres.aacrjournals.org on September 26, 2021. © 2013 American Association for Cancer Research. Author Manuscript Published OnlineFirst on August 30, 2013; DOI: 10.1158/1078-0432.CCR-13-1181 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. 2 1 Financial support: This study was supported by a grant from the Korea Healthcare 2 Technology R&D Project, Ministry for Health & Welfare Affairs, Republic of Korea (A092255), 3 and the Basic Science Research Program, National Research Foundation of Korea by the 4 Ministry of Education, Science, and Technology (2011-009329 to H.
    [Show full text]
  • Small Cell Ovarian Carcinoma: Genomic Stability and Responsiveness to Therapeutics
    Gamwell et al. Orphanet Journal of Rare Diseases 2013, 8:33 http://www.ojrd.com/content/8/1/33 RESEARCH Open Access Small cell ovarian carcinoma: genomic stability and responsiveness to therapeutics Lisa F Gamwell1,2, Karen Gambaro3, Maria Merziotis2, Colleen Crane2, Suzanna L Arcand4, Valerie Bourada1,2, Christopher Davis2, Jeremy A Squire6, David G Huntsman7,8, Patricia N Tonin3,4,5 and Barbara C Vanderhyden1,2* Abstract Background: The biology of small cell ovarian carcinoma of the hypercalcemic type (SCCOHT), which is a rare and aggressive form of ovarian cancer, is poorly understood. Tumourigenicity, in vitro growth characteristics, genetic and genomic anomalies, and sensitivity to standard and novel chemotherapeutic treatments were investigated in the unique SCCOHT cell line, BIN-67, to provide further insight in the biology of this rare type of ovarian cancer. Method: The tumourigenic potential of BIN-67 cells was determined and the tumours formed in a xenograft model was compared to human SCCOHT. DNA sequencing, spectral karyotyping and high density SNP array analysis was performed. The sensitivity of the BIN-67 cells to standard chemotherapeutic agents and to vesicular stomatitis virus (VSV) and the JX-594 vaccinia virus was tested. Results: BIN-67 cells were capable of forming spheroids in hanging drop cultures. When xenografted into immunodeficient mice, BIN-67 cells developed into tumours that reflected the hypercalcemia and histology of human SCCOHT, notably intense expression of WT-1 and vimentin, and lack of expression of inhibin. Somatic mutations in TP53 and the most common activating mutations in KRAS and BRAF were not found in BIN-67 cells by DNA sequencing.
    [Show full text]
  • PRODUCT SPECIFICATION Anti-C12orf43
    Anti-C12orf43 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C12orf43 Product Number HPA046148 Gene Description chromosome 12 open reading frame 43 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEF RAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGG REKEESPQPR Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:50 - 1:200 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA046148 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions.
    [Show full text]
  • Identification of the Binding Partners for Hspb2 and Cryab Reveals
    Brigham Young University BYU ScholarsArchive Theses and Dissertations 2013-12-12 Identification of the Binding arP tners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non- Redundant Roles for Small Heat Shock Proteins Kelsey Murphey Langston Brigham Young University - Provo Follow this and additional works at: https://scholarsarchive.byu.edu/etd Part of the Microbiology Commons BYU ScholarsArchive Citation Langston, Kelsey Murphey, "Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins" (2013). Theses and Dissertations. 3822. https://scholarsarchive.byu.edu/etd/3822 This Thesis is brought to you for free and open access by BYU ScholarsArchive. It has been accepted for inclusion in Theses and Dissertations by an authorized administrator of BYU ScholarsArchive. For more information, please contact [email protected], [email protected]. Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston A thesis submitted to the faculty of Brigham Young University in partial fulfillment of the requirements for the degree of Master of Science Julianne H. Grose, Chair William R. McCleary Brian Poole Department of Microbiology and Molecular Biology Brigham Young University December 2013 Copyright © 2013 Kelsey Langston All Rights Reserved ABSTRACT Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactors and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston Department of Microbiology and Molecular Biology, BYU Master of Science Small Heat Shock Proteins (sHSP) are molecular chaperones that play protective roles in cell survival and have been shown to possess chaperone activity.
    [Show full text]
  • Table 1 Gene Name Increased Or Decreased in LTD
    Table_1 gene_name increased or decreased in LTD protein_id description keep_supernatant keep_pellet comparison sample hit_annotation_methodpvalue fdr hit hit_annotation 2010300C02RIK increased E9Q3M9 Protein 2010300C02Rik OS=Mus musculus GN=2010300C02Rik PE=1 SV=1 TRUE TRUE NMDA - control pellet fdrtool 0,074667 0,584087 FALSE trend 2310035C23RIK|KIAA1468increased A0A087WSS1|E9QM90|Q148V7|Q148V7-2 Protein 2310035C23Rik OS=Mus musculus GN=2310035C23Rik PE=1 SV=1|Protein 2310035C23Rik OS=Mus musculusTRUE GN=2310035C23Rik PE=1 SV=2|LisH FALSE domain NMDAand HEAT - control repeat-containing protein KIAA1468 supernatant OS=Mus musculus GN=Kiaa1468 fdrtoolPE=1 SV=1|Isoform 0,080056 2 of 0,589077LisH domain FALSEand HEAT trend repeat-containing protein KIAA1468 OS=Mus musculus GN=Kiaa1468 ABR increased E9PUE7|Q5SSL4|Q5SSL4-2|Q5SSL4-3|Q5SSL4-4 Active breakpoint cluster region-related protein OS=Mus musculus GN=Abr PE=1 SV=1|Isoform 2 of Active breakpointTRUE cluster region-related protein TRUE OS=Mus musculus NMDA GN=Abr|Isoform - control 3 of Active breakpoint supernatant cluster region-related protein OS=Mus fdrtool musculus 0,08128 GN=Abr|Isoform 0,592743 4 of Active FALSE breakpoint trend cluster region-related protein OS=Mus musculus GN=Abr ADAM22 increased D3YUP9|Q9R1V6|Q9R1V6-10|Q9R1V6-11|Q9R1V6-12|Q9R1V6-13|Q9R1V6-14|Q9R1V6-15|Q9R1V6-17|Q9R1V6-4|Q9R1V6-5|Q9R1V6-6|Q9R1V6-7|Q9R1V6-8Disintegrin and metalloproteinase domain-containing protein 22 OS=Mus musculus GN=Adam22 PE=1 SV=1|DisintegrinFALSE and metalloproteinase domain-containing TRUE
    [Show full text]
  • Differential Physiological Role of BIN1 Isoforms in Skeletal Muscle Development, Function and Regeneration
    bioRxiv preprint doi: https://doi.org/10.1101/477950; this version posted December 11, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Differential physiological role of BIN1 isoforms in skeletal muscle development, function and regeneration Ivana Prokic1,2,3,4, Belinda Cowling1,2,3,4, Candice Kutchukian5, Christine Kretz1,2,3,4, Hichem Tasfaout1,2,3,4, Josiane Hergueux1,2,3,4, Olivia Wendling1,2,3,4, Arnaud Ferry10, Anne Toussaint1,2,3,4, Christos Gavriilidis1,2,3,4, Vasugi Nattarayan1,2,3,4, Catherine Koch1,2,3,4, Jeanne Lainné6,7, Roy Combe2,3,4,8, Laurent Tiret9, Vincent Jacquemond5, Fanny Pilot-Storck9, Jocelyn Laporte1,2,3,4 1Institut de Génétique et de Biologie Moléculaire et Cellulaire (IGBMC), Illkirch, France 2Centre National de la Recherche Scientifique (CNRS), UMR7104, Illkirch, France 3Institut National de la Santé et de la Recherche Médicale (INSERM), U1258, Illkirch, France 4Université de Strasbourg, Illkirch, France 5Univ Lyon, Université Claude Bernard Lyon 1, CNRS UMR-5310, INSERM U-1217, Institut NeuroMyoGène, 8 avenue Rockefeller, 69373 Lyon, France 6Sorbonne Université, INSERM, Institute of Myology, Centre of Research in Myology, UMRS 974, F- 75013, Paris, France 7Sorbonne Université, Department of Physiology, UPMC Univ Paris 06, Pitié-Salpêtrière Hospital, F- 75013, Paris, France 8CELPHEDIA-PHENOMIN, Institut Clinique de la Souris (ICS), Illkirch, France 9U955 – IMRB, Team 10 - Biology of the neuromuscular system, Inserm, UPEC, Ecole nationale vétérinaire d’Alfort, Maisons-Alfort, 94700, France 10Sorbonne Université, INSERM, Institute of Myology, Centre of Research in Myology, UMRS 794, F- 75013, Paris, France Correspondence to: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/477950; this version posted December 11, 2018.
    [Show full text]
  • Structural Characterization of Polysaccharides from Cordyceps Militaris and Their Hypolipidemic Effects Cite This: RSC Adv.,2018,8,41012 in High Fat Diet Fed Mice†
    RSC Advances View Article Online PAPER View Journal | View Issue Structural characterization of polysaccharides from Cordyceps militaris and their hypolipidemic effects Cite this: RSC Adv.,2018,8,41012 in high fat diet fed mice† Zhen-feng Huang, ‡ Ming-long Zhang,‡ Song Zhang,* Ya-hui Wang and Xue-wen Jiang Cordyceps militaris is a crude dietary therapeutic mushroom with high nutritional and medicinal values. Mushroom-derived polysaccharides have been found to possess antihyperglycemic and antihyperlipidemic activities. This study aimed to partially clarify the structural characterization and comparatively evaluate hypolipidemic potentials of intracellular- (IPCM) and extracellular polysaccharides of C. militaris (EPCM) in high fat diet fed mice. Results indicated that IPCM-2 is a-pyran polysaccharide with an average molecular weight of 32.5 kDa, was mainly composed of mannose, glucose and galactose with mass percentages of 51.94%, 10.54%, and 37.25%, respectively. EPCM-2 is an a-pyran Creative Commons Attribution 3.0 Unported Licence. polysaccharide with an average molecular weight of 20 kDa that is mainly composed of mannose, glucose and galactose with mass percentages of 44.51%, 18.33%, and 35.38%, respectively. In in vivo study, EPCM-1 treatment (100 mg kgÀ1 dÀ1) showed potential effects on improving serum lipid profiles of hyperlipidemic mice, reflected by decreasing serum total cholesterol (TC), triglyceride (TG) and low density lipoprotein-cholesterol (LDL-C) levels by 20.05%, 45.45% and 52.63%, respectively, while IPCM-1 treatment
    [Show full text]
  • Table S1 the Four Gene Sets Derived from Gene Expression Profiles of Escs and Differentiated Cells
    Table S1 The four gene sets derived from gene expression profiles of ESCs and differentiated cells Uniform High Uniform Low ES Up ES Down EntrezID GeneSymbol EntrezID GeneSymbol EntrezID GeneSymbol EntrezID GeneSymbol 269261 Rpl12 11354 Abpa 68239 Krt42 15132 Hbb-bh1 67891 Rpl4 11537 Cfd 26380 Esrrb 15126 Hba-x 55949 Eef1b2 11698 Ambn 73703 Dppa2 15111 Hand2 18148 Npm1 11730 Ang3 67374 Jam2 65255 Asb4 67427 Rps20 11731 Ang2 22702 Zfp42 17292 Mesp1 15481 Hspa8 11807 Apoa2 58865 Tdh 19737 Rgs5 100041686 LOC100041686 11814 Apoc3 26388 Ifi202b 225518 Prdm6 11983 Atpif1 11945 Atp4b 11614 Nr0b1 20378 Frzb 19241 Tmsb4x 12007 Azgp1 76815 Calcoco2 12767 Cxcr4 20116 Rps8 12044 Bcl2a1a 219132 D14Ertd668e 103889 Hoxb2 20103 Rps5 12047 Bcl2a1d 381411 Gm1967 17701 Msx1 14694 Gnb2l1 12049 Bcl2l10 20899 Stra8 23796 Aplnr 19941 Rpl26 12096 Bglap1 78625 1700061G19Rik 12627 Cfc1 12070 Ngfrap1 12097 Bglap2 21816 Tgm1 12622 Cer1 19989 Rpl7 12267 C3ar1 67405 Nts 21385 Tbx2 19896 Rpl10a 12279 C9 435337 EG435337 56720 Tdo2 20044 Rps14 12391 Cav3 545913 Zscan4d 16869 Lhx1 19175 Psmb6 12409 Cbr2 244448 Triml1 22253 Unc5c 22627 Ywhae 12477 Ctla4 69134 2200001I15Rik 14174 Fgf3 19951 Rpl32 12523 Cd84 66065 Hsd17b14 16542 Kdr 66152 1110020P15Rik 12524 Cd86 81879 Tcfcp2l1 15122 Hba-a1 66489 Rpl35 12640 Cga 17907 Mylpf 15414 Hoxb6 15519 Hsp90aa1 12642 Ch25h 26424 Nr5a2 210530 Leprel1 66483 Rpl36al 12655 Chi3l3 83560 Tex14 12338 Capn6 27370 Rps26 12796 Camp 17450 Morc1 20671 Sox17 66576 Uqcrh 12869 Cox8b 79455 Pdcl2 20613 Snai1 22154 Tubb5 12959 Cryba4 231821 Centa1 17897
    [Show full text]
  • Table 2. Significant
    Table 2. Significant (Q < 0.05 and |d | > 0.5) transcripts from the meta-analysis Gene Chr Mb Gene Name Affy ProbeSet cDNA_IDs d HAP/LAP d HAP/LAP d d IS Average d Ztest P values Q-value Symbol ID (study #5) 1 2 STS B2m 2 122 beta-2 microglobulin 1452428_a_at AI848245 1.75334941 4 3.2 4 3.2316485 1.07398E-09 5.69E-08 Man2b1 8 84.4 mannosidase 2, alpha B1 1416340_a_at H4049B01 3.75722111 3.87309653 2.1 1.6 2.84852656 5.32443E-07 1.58E-05 1110032A03Rik 9 50.9 RIKEN cDNA 1110032A03 gene 1417211_a_at H4035E05 4 1.66015788 4 1.7 2.82772795 2.94266E-05 0.000527 NA 9 48.5 --- 1456111_at 3.43701477 1.85785922 4 2 2.8237185 9.97969E-08 3.48E-06 Scn4b 9 45.3 Sodium channel, type IV, beta 1434008_at AI844796 3.79536664 1.63774235 3.3 2.3 2.75319499 1.48057E-08 6.21E-07 polypeptide Gadd45gip1 8 84.1 RIKEN cDNA 2310040G17 gene 1417619_at 4 3.38875643 1.4 2 2.69163229 8.84279E-06 0.0001904 BC056474 15 12.1 Mus musculus cDNA clone 1424117_at H3030A06 3.95752801 2.42838452 1.9 2.2 2.62132809 1.3344E-08 5.66E-07 MGC:67360 IMAGE:6823629, complete cds NA 4 153 guanine nucleotide binding protein, 1454696_at -3.46081884 -4 -1.3 -1.6 -2.6026947 8.58458E-05 0.0012617 beta 1 Gnb1 4 153 guanine nucleotide binding protein, 1417432_a_at H3094D02 -3.13334396 -4 -1.6 -1.7 -2.5946297 1.04542E-05 0.0002202 beta 1 Gadd45gip1 8 84.1 RAD23a homolog (S.
    [Show full text]
  • An Animal Model with a Cardiomyocyte-Specific Deletion of Estrogen Receptor Alpha: Functional, Metabolic, and Differential Netwo
    Washington University School of Medicine Digital Commons@Becker Open Access Publications 2014 An animal model with a cardiomyocyte-specific deletion of estrogen receptor alpha: Functional, metabolic, and differential network analysis Sriram Devanathan Washington University School of Medicine in St. Louis Timothy Whitehead Washington University School of Medicine in St. Louis George G. Schweitzer Washington University School of Medicine in St. Louis Nicole Fettig Washington University School of Medicine in St. Louis Attila Kovacs Washington University School of Medicine in St. Louis See next page for additional authors Follow this and additional works at: https://digitalcommons.wustl.edu/open_access_pubs Recommended Citation Devanathan, Sriram; Whitehead, Timothy; Schweitzer, George G.; Fettig, Nicole; Kovacs, Attila; Korach, Kenneth S.; Finck, Brian N.; and Shoghi, Kooresh I., ,"An animal model with a cardiomyocyte-specific deletion of estrogen receptor alpha: Functional, metabolic, and differential network analysis." PLoS One.9,7. e101900. (2014). https://digitalcommons.wustl.edu/open_access_pubs/3326 This Open Access Publication is brought to you for free and open access by Digital Commons@Becker. It has been accepted for inclusion in Open Access Publications by an authorized administrator of Digital Commons@Becker. For more information, please contact [email protected]. Authors Sriram Devanathan, Timothy Whitehead, George G. Schweitzer, Nicole Fettig, Attila Kovacs, Kenneth S. Korach, Brian N. Finck, and Kooresh I. Shoghi This open access publication is available at Digital Commons@Becker: https://digitalcommons.wustl.edu/open_access_pubs/3326 An Animal Model with a Cardiomyocyte-Specific Deletion of Estrogen Receptor Alpha: Functional, Metabolic, and Differential Network Analysis Sriram Devanathan1, Timothy Whitehead1, George G. Schweitzer2, Nicole Fettig1, Attila Kovacs3, Kenneth S.
    [Show full text]
  • Dual Proteome-Scale Networks Reveal Cell-Specific Remodeling of the Human Interactome
    bioRxiv preprint doi: https://doi.org/10.1101/2020.01.19.905109; this version posted January 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Dual Proteome-scale Networks Reveal Cell-specific Remodeling of the Human Interactome Edward L. Huttlin1*, Raphael J. Bruckner1,3, Jose Navarrete-Perea1, Joe R. Cannon1,4, Kurt Baltier1,5, Fana Gebreab1, Melanie P. Gygi1, Alexandra Thornock1, Gabriela Zarraga1,6, Stanley Tam1,7, John Szpyt1, Alexandra Panov1, Hannah Parzen1,8, Sipei Fu1, Arvene Golbazi1, Eila Maenpaa1, Keegan Stricker1, Sanjukta Guha Thakurta1, Ramin Rad1, Joshua Pan2, David P. Nusinow1, Joao A. Paulo1, Devin K. Schweppe1, Laura Pontano Vaites1, J. Wade Harper1*, Steven P. Gygi1*# 1Department of Cell Biology, Harvard Medical School, Boston, MA, 02115, USA. 2Broad Institute, Cambridge, MA, 02142, USA. 3Present address: ICCB-Longwood Screening Facility, Harvard Medical School, Boston, MA, 02115, USA. 4Present address: Merck, West Point, PA, 19486, USA. 5Present address: IQ Proteomics, Cambridge, MA, 02139, USA. 6Present address: Vor Biopharma, Cambridge, MA, 02142, USA. 7Present address: Rubius Therapeutics, Cambridge, MA, 02139, USA. 8Present address: RPS North America, South Kingstown, RI, 02879, USA. *Correspondence: [email protected] (E.L.H.), [email protected] (J.W.H.), [email protected] (S.P.G.) #Lead Contact: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2020.01.19.905109; this version posted January 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder.
    [Show full text]