DOCSLIB.ORG

Download Download

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Download Download Supplementary Figure S1. Results of flow cytometry analysis, performed to estimate CD34 positivity, after immunomagnetic separation in two different experiments. As monoclonal antibody for labeling the sample, the fluorescein isothiocyanate (FITC)- conjugated mouse anti-human CD34 MoAb (Mylteni) was used. Briefly, cell samples were incubated in the presence of the indicated MoAbs, at the proper dilution, in PBS containing 5% FCS and 1% Fc receptor (FcR) blocking reagent (Miltenyi) for 30 min at 4 C. Cells were then washed twice, resuspended with PBS and analyzed by a Coulter Epics XL (Coulter Electronics Inc., Hialeah, FL, USA) flow cytometer. only use Non-commercial 1 Supplementary Table S1. Complete list of the datasets used in this study and their sources. GEO Total samples Geo selected GEO accession of used Platform Reference series in series samples samples GSM142565 GSM142566 GSM142567 GSM142568 GSE6146 HG-U133A 14 8 - GSM142569 GSM142571 GSM142572 GSM142574 GSM51391 GSM51392 GSE2666 HG-U133A 36 4 1 GSM51393 GSM51394 only GSM321583 GSE12803 HG-U133A 20 3 GSM321584 2 GSM321585 use Promyelocytes_1 Promyelocytes_2 Promyelocytes_3 Promyelocytes_4 HG-U133A 8 8 3 GSE64282 Promyelocytes_5 Promyelocytes_6 Promyelocytes_7 Promyelocytes_8 Non-commercial 2 Supplementary Table S2. Chromosomal regions up-regulated in CD34+ samples as identified by the LAP procedure with the two-class statistics coded in the PREDA R package and an FDR threshold of 0.5. Functional enrichment analysis has been performed using DAVID (http://david.abcc.ncifcrf.gov/) and Gene Ontology (GO) Biological Process annotations have been considered statistically significant if the p- value of the Fisher Exact test was ≤ 0.001 (Benjamini correction). Chromosome Start End Genes Enriched GO categories FSHR; NRXN1; GPR75; PSME4; ACYP2; 49285481 58427447 RPL23AP32; SPTBN1; RTN4; MTIF2; CCDC88A; EFEMP1; VRK2; FANCL ASNSD1; OSGEPL1; PMS1; MSTN; HIBCH; 2 --- INPP1; MFSD6; NAB1; GLS; STAT1; STAT4; 190530840 198842016 MYO1B; OBFC2A; SDPR; DNAH7; STK17B; GTF3C3; PGAP1; SF3B1; COQ10B; HSPE1; PHOCN; PLCL1 ALCAM; CBLB; BBX; CD47; IFT57; HHLA2; 105190728 108173692 MYH15 SENP2; TRA2B; ETV5; DGKG; TBCCD1; AHSG; FETUB; HRG; KNG1; EIF4A2; RFC4; ADIPOQ; ST6GAL1; RPL39L; MASP1; RTP4; SST; BCL6; LPP; TP63; LEPREL1; CLDN1; 3 --- CLDN16; IL1RAP; FGF12; MGC2889; 185326457 197679885 HRASLS; OPA1; HES1; CPN2; LRRC15; GP5; ATP13A3; LSG1; ACAP2; PPP1R2; APOD; only MUC4; TNK2; TFRC; PCYT1A; UBXN7; PAK2; SENP5; NCBP2; PIGZ; MFI2; DLG1; BDH1; KIAA0226; IQCG; RPL35A PCDH7; ARAP2; C4orf19; PTTG2; TBC1D1; FLJ13197; KLF3; TLR1; TLR6; FAM114A1; use TMEM156; WDR19; RFC1; LIAS; UGDH; UBE2K; PDS5A; RHOH; CHRNA9; RBM47; 4 30935230 48640848 --- APBB2; UCHL1; LIMCH1; PHOX2B; TMEM33; SLC30A9; ATP8A1; GUF1; GABRA2; GABRA4; GABRB1; COMMD8; ATP10D; CORIN; CNGA1; TXK; TEC; FRYL E2F3; CDKAL1; CD24; SOX4; PRL; MRS2; GPLD1; ALDH5A1; KIAA0319; TDP2; DNA packaging; nucleosome ACOT13; C6orf62; GMNN; FAM65B; assembly; chromatin assembly; CMAHP; LRRC16A; SCGN; SLC17A4; protein-DNA complex assembly; SLC17A1; SLC17A3; SLC17A2; TRIM38; nucleosome organization; HIST1H1A; HIST1H3A; HIST1H4A; chromatin assembly or HIST1H4B; HIST1H3B; HIST1H2AB; disassembly; macromolecular HIST1H2BB; HIST1H3C; HIST1H1C; HFE; complex assembly; 6 20448041 27219950 HIST1H4C; HIST1H1E; HIST1H2BD; macromolecular complex subunit HIST1H2BE; HIST1H4D; HIST1H3D; organization; chromatin HIST1H2BF; HIST1H4E; HIST1H2BG; organization; cellular HIST1H2AE; HIST1H1D; HIST1H4F; macromolecular complex Non-commercialHIST1H4G; HIST1H3F; HIST1H2BH; assembly; cellular HIST1H3G; HIST1H2BI; HIST1H4H; macromolecular complex subunit BTN3A2; BTN2A2; BTN3A1; BTN3A3; organization; chromosome BTN2A1; BTN1A1; HMGN4; ABT1; organization HIST1H2BK; PRSS16 MEOX2; SOSTDC1; ANKMY2; BZW2; TSPAN13; AGR2; AHR; SNX13; PRPS1L1; 15688573 23558029 HDAC9; TWIST1; TWISTNB; ITGB8; SP4; RAPGEF5; STEAP1B; IL6; TOMM7; KLHL7; NUPL2; GPNMB; IGF2BP3; TRA2A LRRN3; DOCK4; ZNF277; IFRD1; 7 --- TMEM168; GPR85; PPP1R3A; MDFIC; TFEC; TES; CAV2; CAV1; MET; CAPZA2; 110748284 123588372 ST7; WNT2; CFTR; NAA38; ANKRD7; KCND2; TSPAN12; ING3; C7orf58; WNT16; PTPRZ1; AASS; CADPS2; TAS2R16; SLC13A1; NDUFA5; WASL; HYAL4; SPAM1 PTPRD; TYRP1; MPDZ; NFIB; CER1; SNAPC3; PSIP1; BNC2; CNTLN; SH3GL2; 9463485 19648021 9 RRAGA; HAUS6; PLIN2; DENND4C; RPS6; --- SLC24A2 101260922 102702866 GABBR2; GALNT12; COL15A1; TGFBR1; 3 SEC61B; NR4A3; STX17 MAP3K8; ZEB1; ARHGAP12; KIF5B; 30736813 35928769 C10orf68; NRP1; PARD3; CUL2; CREM; FZD8 ACSL5; ZDHHC6; TCF7L2; HABP2; NRAP; 10 --- CASP7; DCLRE1A; ADRB1; C10orf118; 114161026 119305506 TDRD1; ABLIM1; ATRNL1; GFRA1; PNLIP; PNLIPRP1; PNLIPRP2; HSPA12A; KIAA1598; SLC18A2; EMX2 PRB4; PRB1; ETV6; BCL2L14; LRP6; MANSC1; CREBL2; GPR19; CDKN1B; APOLD1; DDX47; GPRC5A; GPRC5D; 12 11461691 16731165 HEBP1; HTR7P1; KIAA1467; GSG1; EMP1; --- GRIN2B; ATF7IP; PLBD1; GUCY2C; H2AFJ; WBP11; ART4; MGP; ARHGDIB; PDE6H; PTPRO; EPS8; STRAP; DERA; LMO3 FRS2; CCT2; CNOT2; KCNMB4; PTPRB; PTPRR; TSPAN8; LGR5; ZFC3H1; RAB21; TBC1D15; TRHDE; ATXN7L3B; GLIPR1; KRR1; PHLDA1; NAP1L1; BBS10; OSBPL8; ZDHHC17; CSRP2; NAV3; SYT1; PAWR; 69918845 92536863 PPP1R12A; MYF6; MYF5; LIN7A; ACSS3; PPFIA2; CCDC59; SLC6A15; ALX1; RASSF9; NTS; C12orf29; CEP290; KITLG; DUSP6; GALNT4; ATP2B1; EPYC; KERA; LUM; DCN; BTG1 IGF1R; SYNM; TTC23; MEF2A; ASB7; 15 99350259 101937160 --- ALDH1A3; LRRK1; CHSY1; PCSK6 RIOK3; C18orf8; NPC1; LAMA3; CABYR; only 18 21047942 24438863 OSBPL1A; IMPACT; HRH4; SS18; TAF4B; --- AQP4 NDUFA13; LPAR2; GMIP; ATP13A1; ZNF14; ZNF253; ZNF93; ZNF682; ZNF85; 19633016 23852863 use ZNF430; ZNF493; ZNF43; ZNF208; ZNF257; ZNF91; ZNF675 ZNF667; ZNF471; ZIM2; PEG3; USP29; ZNF264; AURKC; ZNF460; ZNF304; Regulation of transcription, DNA- ZNF548; ZNF749; VN1R1; ZNF419; dependent; regulation of RNA 19 ZNF549; ZNF134; ZNF211; ZNF551; metabolic process; regulation of ZNF154; ZNF671; ZNF586; ZNF552; transcription; transcription 56969732 59091264 ZNF587; ZNF606; ZNF135; ZSCAN18; ZNF329; ZNF274; ZNF544; ZNF8; ZNF132; ZNF324B; ZNF324; ZNF446; SLC27A5; TRIM28; CHMP2A; UBE2M; MZF1; MGC2752 BMP2; HAO1; TMX4; PLCB1; PLCB4; 20 6754827 9668862 --- C20orf103; PAK7 Non-commercial 4 Table S3. Chromosomal regions up-regulated in CD14- samples as identified by the LAP procedure with the two-class statistics coded in the PREDA R package and an FDR threshold of 0.5. Functional enrichment analysis has been performed using DAVID (http://david.abcc.ncifcrf.gov/) and Gene Ontology (GO) Biological Process categories. GO annotations have been considered statistically significant if the p-value of the Fisher Exact test was ≤ 0.001 (Benjamini correction). Chromosome Start End Genes Enriched GO categories KIF3C; HADHA; HADHB; OTOF; KCNK3; C2orf18; CENPA; MAPRE3; TMEM214; AGBL5; EMILIN1; KHK; CGREF1; PREB; SLC5A6; C2orf28; CAD; SLC30A3; UCN; MPV17; GTF3C2; EIF2B4; SNX17; PPM1G; 2 26177449 31777848 --- NRBP1; FNDC4; GCKR; CCDC121; GPN1; SUPT7L; MRPL33; RBKS; BRE; FOSL2; PPP1CB; TRMT61B; WDR43; CLIP4; ALK; YPEL5; LBH; GALNT14; EHD3; XDH; SRD5A2 HPGD; GLRA3; ADAM29; GPM6A; SPCS3; VEGFC; NEIL3; AGA; ODZ3; DCTD; WWC2; 4 175427686 185711982 --- CDKN2AIP; ING2; C4orf41; IRF2; CASP3; MLF1IP; ACSL1 PDGFA; PRKAR1B; HEATR2; SUN1; ADAP1; CYP2W1; GPER; MICALL2; INTS1; MAFK; 548190 2825851 MAD1L1; FTSJ2; NUDT1; EIF3B; CHST12; only LFNG; IQCE; GNA12 7 --- NSUN5; FKBP6; FZD9; BAZ1B; BCL7B; TBL2; MLXIPL; WBSCR22; STX1A; ABHD11; 72719689 74123525 CLDN3; CLDN4; ELN; LIMK1; LAT2; RFC2; CLIP2; GTF2IRD1; GTF2I use MCPH1; ANGPT2; AGPAT5; DEFB1; 8 6382626 9526650 Defense response DEFA6; DEFA4; DEFA5; MFHAS1; TNKS UBAC1; LHX3; DKFZP434A062; CARD9; SNAPC4; SDCCAG3; PMPCA; INPP5E; SEC16A; NOTCH1; EGFL7; AGPAT2; C9orf86; EDF1; TRAF2; C8G; PTGDS; CLIC3; 9 138839021 141058224 --- ABCA2; FUT7; NPDC1; ENTPD2; UAP1L1; MAN1B1; GRIN1; ANAPC2; SSNA1; NDOR1; RNF208; TUBB2C; COBRA1; C9orf167; NELF; EHMT1; CACNA1B; TUBBP5 GHITM; CDHR1; LRIT1; RGR; FAM190B; 85906248 89288720 WAPAL; LDB3; BMPR1A; MMRN2; SNCG; C10orf116; GLUD1; MINPP1 PKD2L1; SCD; WNT8B; SEC31B; NDUFB8; 102069073 102894303 HIF1AN; PAX2; FAM178A; SEMA4G; 10 --- C10orf2; PDZD7; SFXN3; KAZALD1; TLX1 PTPRE; MKI67; MGMT; GLRX3; PPP2R2D; BNIP3; DPYSL4; INPP5A; UTF1; VENTX; 129794743 135346743 Non-commercialADAM8; TUBGCP2; CALY; ECHS1; PAOX; MTG1; CYP2E1 DAGLA; C11orf9; C11orf10; FEN1; FADS1; FADS2; FADS3; RAB3IL1; BEST1; FTH1; INCENP; SCGB1D1; SCGB2A1; SCGB1D2; SCGB2A2; ASRGL1; SCGB1A1; AHNAK; TUT1; MTA2; EML3; ROM1; B3GAT3; GANAB; INTS5; C11orf48; UBXN1; BSCL2; GNG3; HNRNPUL2; POLR2G; TAF6L; TMEM223; NXF1; STX5; WDR74; SLC3A2; SLC22A6; SLC22A8; RARRES3; HRASLS2; PLA2G16; RTN3; C11orf95; MARK2; 11 61481191 68034137 --- NAA40; COX8A; OTUB1; MACROD1; FLRT1; STIP1; DNAJC4; VEGFB; FKBP2; PLCB3; BAD; GPR137; C11orf20; ESRRA; TRMT112; RPS6KA4; SLC22A11; NRXN2; RASGRP2; PYGM; SF1; MAP4K2; MEN1; EHD1; ATG2A; PPP2R5B; ARL2; SNX15; SAC3D1; NAALADL1; ZFPL1; C11orf2; TM7SF2; ZNHIT2; FAU; MRPL49; CAPN1; POLA2; CDC42EP2; DPF2; FRMD8; NEAT1; LTBP3; SSSCA1; FAM89B; EHBP1L1; KCNK7; 5 MAP3K11; SIPA1; RELA; KAT5; OVOL1; MUS81; EFEMP2; CTSW; FIBP; CCDC85B; FOSL1; C11orf68; DRAP1; SART1; BANF1; CST6; SF3B2; PACS1; KLC2; RAB1B; YIF1A; CD248; RIN1; BRMS1; B3GNT1; SLC29A2; MRPL11; DPP3; BBS1; ZDHHC24; ACTN3; CTSF; CCDC87; CCS; RBM14; RBM4; RBM4B; SPTBN2; C11orf80; RCE1; LRFN4; PC; RHOD; KDM2A; ADRBK1; SSH3; POLD4; CLCF1; RAD9A; PPP1CA; RPS6KB2; PTPRCAP; CORO1B; TMEM134; AIP; PITPNM1; CDK2AP2; CABP2; GSTP1; NDUFV1; TBX10; ALDH3B2; ALDH3B1; NDUFS8; TCIRG1; CHKA; SUV420H1; C11orf24 PXN; SIRT4; PLA2G1B; MSI1; TRIAP1; GATC; SRSF9; DYNLL1; RNF10; POP5;
Load more

Recommended publications
  • ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic
    ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic Aberrations in Canine Osteosarcoma and Their Resemblance to the Human Counterpart. (Under the direction of Dr. Matthew Breen). In the last decade the domestic dog has emerged as an ideal biomedical model of complex genetic diseases such as cancers. Cancer in the dog occurs spontaneously and several studies have concluded that human and canine cancers have similar characteristics such as presentation of disease, rate of metastases, genetic dysregulation, and survival rates. Furthermore, in the genomic era the dog genome was found more homologous in sequence conservation to humans than mice, making it a valuable model organism for genetic study in addition to pathophysiological analysis. Osteosarcoma (OS), the most commonly diagnosed malignant bone tumor in humans and dogs, is one such cancer that would benefit from comparative genomic analysis. In humans, OS is a rare cancer diagnosed in fewer than 1,000 people per year in the USA, while in the domestic dog population the annual number of new cases is estimated to far exceed 10,000. This high rate of disease occurrence in dogs provides a unique opportunity to study the genomic imbalances in canine OS and their translational value to human OS as a means to identify important alterations involved in disease etiology. OS in humans is characterized by extremely complex karyotypes which contain both structural changes (translocations and/or rearrangements) and DNA copy number changes. Metaphase and array comparative genomic hybridization (aCGH) has assisted in uncovering the genetic imbalances that are associated with human OS phenotype. In dog OS, previous low-resolution (10-20Mb) aCGH analysis identified a wide range of recurrent copy number aberrations (CNAs), indicative of a similar level of genomic instability to human OS.
    [Show full text]
  • Genetic Susceptibility for Cow's Milk Allergy in Dutch Children
    Henneman et al. Clin Transl Allergy (2016) 6:7 DOI 10.1186/s13601-016-0096-9 Clinical and Translational Allergy RESEARCH Open Access Genetic susceptibility for cow’s milk allergy in Dutch children: the start of the allergic march? Peter Henneman1*†, Nicole C. M. Petrus2†, Andrea Venema1, Femke van Sinderen1, Karin van der Lip1, Raoul C. Hennekam1, Marcel Mannens1† and Aline B. Sprikkelman2† Abstract Background: Cow’s milk allergy (CMA) is the most common allergic disease in infancy. It is not clear, whether infants with CMA have an increased risk of developing other allergic diseases later in life, the so-called “allergic march”. We aimed to detect genetic associations of CMA using reported single nucleotide polymorphisms (SNP) in other allergic diseases and genetic mutations within the filaggrin (FLG) gene. Both to investigate possible causes of CMA, which also suggests an “allergic march”. Methods: Thirty children from the Dutch EuroPrevall birth cohort study with CMA in infancy and twenty-three healthy controls were studied. Six candidate SNPs were selected (minor allele frequency 10–50 % combined with a large effect) based on the literature. Thirteen FLG candidate mutations were selected spread over repeats 1, 3, 4, 5, 6, 7, 9 and 10 respectively. Results: We found two SNP’s, rs17616434 (P 0.002) and rs2069772 (P 0.038), significantly associated with CMA. One is located near the toll like receptor 6 (TLR6)= gene, which functionally= interacts with toll-like receptor 2, and is associated with an increased risk of other allergic diseases. One is located at the Interleukin 2 (IL2) locus. Twelve FLG amplicons were analyzed, but showed no significant enrichment.
    [Show full text]
  • Chapter 7: Monogenic Forms of Diabetes
    CHAPTER 7 MONOGENIC FORMS OF DIABETES Mark A. Sperling, MD, and Abhimanyu Garg, MD Dr. Mark A. Sperling is Emeritus Professor and Chair, University of Pittsburgh, Department of Pediatrics, Children’s Hospital of Pittsburgh of UPMC, Pittsburgh, PA. Dr. Abhimanyu Garg is Professor of Internal Medicine and Chief of the Division of Nutrition and Metabolic Diseases at University of Texas Southwestern Medical Center, Dallas, TX. SUMMARY Types 1 and 2 diabetes have multiple and complex genetic influences that interact with environmental triggers, such as viral infections or nutritional excesses, to result in their respective phenotypes: young, lean, and insulin-dependence for type 1 diabetes patients or older, overweight, and often manageable by lifestyle interventions and oral medications for type 2 diabetes patients. A small subset of patients, comprising ~2%–3% of all those diagnosed with diabetes, may have characteristics of either type 1 or type 2 diabetes but have single gene defects that interfere with insulin production, secretion, or action, resulting in clinical diabetes. These types of diabetes are known as MODY, originally defined as maturity-onset diabetes of youth, and severe early-onset forms, such as neonatal diabetes mellitus (NDM). Defects in genes involved in adipocyte development, differentiation, and death pathways cause lipodystrophy syndromes, which are also associated with insulin resistance and diabetes. Although these syndromes are considered rare, more awareness of these disorders and increased availability of genetic testing in clinical and research laboratories, as well as growing use of next generation, whole genome, or exome sequencing for clinically challenging phenotypes, are resulting in increased recognition. A correct diagnosis of MODY, NDM, or lipodystrophy syndromes has profound implications for treatment, genetic counseling, and prognosis.
    [Show full text]
  • PRODUCT SPECIFICATION Anti-EIF2B4 Product
    Anti-EIF2B4 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-EIF2B4 Product Number HPA039993 Gene Description eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRE LPESGIQLGTPREKVPAGRSKAELRAER Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended ICC-IF (Immunofluorescence) Applications - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA039993 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • Polyclonal Antibody to APC11 / ANAPC11 - Serum
    OriGene Technologies, Inc. OriGene Technologies GmbH 9620 Medical Center Drive, Ste 200 Schillerstr. 5 Rockville, MD 20850 32052 Herford UNITED STATES GERMANY Phone: +1-888-267-4436 Phone: +49-5221-34606-0 Fax: +1-301-340-8606 Fax: +49-5221-34606-11 [email protected] [email protected] R1503 Polyclonal Antibody to APC11 / ANAPC11 - Serum Alternate names: Anaphase-promoting complex subunit 11, Cyclosome subunit 11, HSPC214, Hepatocellular carcinoma-associated RING finger protein Quantity: 0.1 ml Concentration: 85 mg/ml (by Refractometry) Background: APC11 is also known as Anaphase promoting complex subunit 11, APC11, Cyclosome subunit 11, Hepatocellular carcinoma associated RING finger protein, and HSPC214. APC11 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. APC11 may function to recruit the E2 ubiquitin-conjugating enzymes to the complex. APC11 interacts with the cullin domain of ANAPC2 and also interacts with UBE2D2. APC11 shows both a cytoplasmic and nuclear localization. APC11 is expressed at high levels in skeletal muscle and heart; in moderate levels in brain, kidney, and liver; and at low levels in colon, thymus, spleen, small intestine, placenta, lung and peripheral blood leukocyte. APC11 is a member of the RING-type zinc finger family and is auto-ubiquitinylated. Uniprot ID: Q9NYG5 NCBI: NP_001002244.1 GeneID: 51529 Host: Rabbit Immunogen: This APC11 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 76-84 of Human APC11 (C-terminal) coupled to KLH.
    [Show full text]
  • Supplementary Materials: Evaluation of Cytotoxicity and Α-Glucosidase Inhibitory Activity of Amide and Polyamino-Derivatives of Lupane Triterpenoids
    Supplementary Materials: Evaluation of cytotoxicity and α-glucosidase inhibitory activity of amide and polyamino-derivatives of lupane triterpenoids Oxana B. Kazakova1*, Gul'nara V. Giniyatullina1, Akhat G. Mustafin1, Denis A. Babkov2, Elena V. Sokolova2, Alexander A. Spasov2* 1Ufa Institute of Chemistry of the Ufa Federal Research Centre of the Russian Academy of Sciences, 71, pr. Oktyabrya, 450054 Ufa, Russian Federation 2Scientific Center for Innovative Drugs, Volgograd State Medical University, Novorossiyskaya st. 39, Volgograd 400087, Russian Federation Correspondence Prof. Dr. Oxana B. Kazakova Ufa Institute of Chemistry of the Ufa Federal Research Centre of the Russian Academy of Sciences 71 Prospeсt Oktyabrya Ufa, 450054 Russian Federation E-mail: [email protected] Prof. Dr. Alexander A. Spasov Scientific Center for Innovative Drugs of the Volgograd State Medical University 39 Novorossiyskaya st. Volgograd, 400087 Russian Federation E-mail: [email protected] Figure S1. 1H and 13C of compound 2. H NH N H O H O H 2 2 Figure S2. 1H and 13C of compound 4. NH2 O H O H CH3 O O H H3C O H 4 3 Figure S3. Anticancer screening data of compound 2 at single dose assay 4 Figure S4. Anticancer screening data of compound 7 at single dose assay 5 Figure S5. Anticancer screening data of compound 8 at single dose assay 6 Figure S6. Anticancer screening data of compound 9 at single dose assay 7 Figure S7. Anticancer screening data of compound 12 at single dose assay 8 Figure S8. Anticancer screening data of compound 13 at single dose assay 9 Figure S9. Anticancer screening data of compound 14 at single dose assay 10 Figure S10.
    [Show full text]
  • PRODUCT SPECIFICATION Anti-C12orf43
    Anti-C12orf43 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C12orf43 Product Number HPA046148 Gene Description chromosome 12 open reading frame 43 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEF RAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGG REKEESPQPR Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:50 - 1:200 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA046148 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions.
    [Show full text]
  • ZNF354C Is a Transcriptional Repressor That Inhibits Endothelial Angiogenic Sprouting James A
    www.nature.com/scientificreports OPEN ZNF354C is a transcriptional repressor that inhibits endothelial angiogenic sprouting James A. Oo1,3, Barnabas Irmer1, Stefan Günther2, Timothy Warwick1, Katalin Pálf1, Judit Izquierdo Ponce1, Tom Teichmann1, Beatrice Pfüger‑Müller1,3, Ralf Gilsbach1,3, Ralf P. Brandes1,3 & Matthias S. Leisegang1,3* Zinc fnger proteins (ZNF) are a large group of transcription factors with diverse functions. We recently discovered that endothelial cells harbour a specifc mechanism to limit the action of ZNF354C, whose function in endothelial cells is unknown. Given that ZNF354C has so far only been studied in bone and tumour, its function was determined in endothelial cells. ZNF354C is expressed in vascular cells and localises to the nucleus and cytoplasm. Overexpression of ZNF354C in human endothelial cells results in a marked inhibition of endothelial sprouting. RNA‑sequencing of human microvascular endothelial cells with and without overexpression of ZNF354C revealed that the protein is a potent transcriptional repressor. ZNF354C contains an active KRAB domain which mediates this suppression as shown by mutagenesis analysis. ZNF354C interacts with dsDNA, TRIM28 and histones, as observed by proximity ligation and immunoprecipitation. Moreover, chromatin immunoprecipitation revealed that the ZNF binds to specifc endothelial‑relevant target‑gene promoters. ZNF354C suppresses these genes as shown by CRISPR/Cas knockout and RNAi. Inhibition of endothelial sprouting by ZNF354C is dependent on the amino acids DV and MLE of the KRAB domain. These results demonstrate that ZNF354C is a repressive transcription factor which acts through a KRAB domain to inhibit endothelial angiogenic sprouting. Te vascular system is controlled by numerous signaling pathways and growth factors which all contribute to the regulation of gene expression.
    [Show full text]
  • Release Β ATP-Induced IL-1 and Canonical Nicotinic Agonists Inhibit Phosphocholine-Modified Macromolecules
    Phosphocholine-Modified Macromolecules and Canonical Nicotinic Agonists Inhibit ATP-Induced IL-1β Release This information is current as Andreas Hecker, Mira Küllmar, Sigrid Wilker, Katrin of September 24, 2021. Richter, Anna Zakrzewicz, Srebrena Atanasova, Verena Mathes, Thomas Timm, Sabrina Lerner, Jochen Klein, Andreas Kaufmann, Stefan Bauer, Winfried Padberg, Wolfgang Kummer, Sabina Janciauskiene, Martin Fronius, Elke K. H. Schweda, Günter Lochnit and Veronika Grau Downloaded from J Immunol 2015; 195:2325-2334; Prepublished online 22 July 2015; doi: 10.4049/jimmunol.1400974 http://www.jimmunol.org/content/195/5/2325 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2015/07/22/jimmunol.140097 Material 4.DCSupplemental References This article cites 42 articles, 11 of which you can access for free at: http://www.jimmunol.org/content/195/5/2325.full#ref-list-1 by guest on September 24, 2021 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2015 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606.
    [Show full text]
  • Trastuzumab Modulates the Protein Cargo of Extracellular Vesicles Released by ERBB2+ Breast Can‐ Cer Cells
    Supplementary Material: Trastuzumab Modulates the Protein Cargo of Extracellular Vesicles Released by ERBB2+ Breast Can‐ cer Cells Silvia Marconi, Sara Santamaria, Martina Bartolucci, Sara Stigliani, Cinzia Aiello, Maria Cristina Gagliani, Grazia Bellese, Andrea Petretto, Katia Cortese and Patrizio Castagnola Table S1. Antibodies used in the study. Antibody Catalog number Manufacturer Anti‐ALIX sc‐271975 Santa Cruz1 Anti‐CD9 PA5‐85955 Thermofisher Scientific2 Anti‐CD63 sc‐15363 Santa Cruz Anti‐ErbB2 (9G6) sc‐08 Santa Cruz Anti‐GAPDH 14C10 Cell signaling3 Anti‐HSP90 sc‐13119 Santa Cruz 1 Dallas, TX, USA; 2 Waltham, MA, USA; 3 Danvers, MA, USA. Table S2. Differentially regulated proteins by trastuzumab Tz treatment in extracellular vesicles EVs purified from SKBR‐ 3 cells with a statistically significant p‐value resulted from Studentʹs T‐test. The gene symbols coding for proteins downregulated by Tz (and hence upregulated in IgG treated cells) are highlighted in red while proteins upregulated by Tz are highlighted in blue. Official Gene Symbol 1 Gene product (Protein name) ACVR1B Activin A receptor type 1B ANO1 Anoctamin 1 ARFGEF2 ADP Ribosylation Factor Guanine Nucleotide Exchange Factor 2 BTN2A1 Butyrophilin subfamily 2 member A1 CIAPIN1 Cytokine Induced Apoptosis Inhibitor 1 CIT Citron Rho‐Interacting Serine/Threonine Kinase CPPED1 Calcineurin Like Phosphoesterase Domain Containing 1 DNAH7 Dynein Axonemal Heavy Chain 7 EIF3F Eukaryotic translation initiation factor 3 subunit F ESD Esterase D ESYT2 Extended Synaptotagmin 2 F2RL1 F2R Like Trypsin Receptor 1 RIPOR3 RIPOR Family Member 3 FZD6 Frizzled‐6 GAN Gigaxonin GTPBP2 GTP‐binding protein 2 GUCD1 Guanylyl Cyclase Domain Containing 1 HNRNPM Heterogeneous nuclear ribonucleoprotein M LMAN2 Lectin, Mannose Binding 2 LRRC8A Volume‐regulated anion channel subunit LRRC8A NOTCH4 Notch Receptor 4 NT5C2 5ʹ‐Nucleotidase, Cytosolic II PCID2 PCI domain‐containing 2 PDCD5 Programmed cell death 5 PHLDB3 Pleckstrin homology like domain family B member 3 PLAA Phospholipase A2 activating protein Membranes 2021, 11, 199.
    [Show full text]
  • Abstracts from the 9Th Biennial Scientific Meeting of The
    International Journal of Pediatric Endocrinology 2017, 2017(Suppl 1):15 DOI 10.1186/s13633-017-0054-x MEETING ABSTRACTS Open Access Abstracts from the 9th Biennial Scientific Meeting of the Asia Pacific Paediatric Endocrine Society (APPES) and the 50th Annual Meeting of the Japanese Society for Pediatric Endocrinology (JSPE) Tokyo, Japan. 17-20 November 2016 Published: 28 Dec 2017 PS1 Heritable forms of primary bone fragility in children typically lead to Fat fate and disease - from science to global policy a clinical diagnosis of either osteogenesis imperfecta (OI) or juvenile Peter Gluckman osteoporosis (JO). OI is usually caused by dominant mutations affect- Office of Chief Science Advsor to the Prime Minister ing one of the two genes that code for two collagen type I, but a re- International Journal of Pediatric Endocrinology 2017, 2017(Suppl 1):PS1 cessive form of OI is present in 5-10% of individuals with a clinical diagnosis of OI. Most of the involved genes code for proteins that Attempts to deal with the obesity epidemic based solely on adult be- play a role in the processing of collagen type I protein (BMP1, havioural change have been rather disappointing. Indeed the evidence CREB3L1, CRTAP, LEPRE1, P4HB, PPIB, FKBP10, PLOD2, SERPINF1, that biological, developmental and contextual factors are operating SERPINH1, SEC24D, SPARC, from the earliest stages in development and indeed across generations TMEM38B), or interfere with osteoblast function (SP7, WNT1). Specific is compelling. The marked individual differences in the sensitivity to the phenotypes are caused by mutations in SERPINF1 (recessive OI type obesogenic environment need to be understood at both the individual VI), P4HB (Cole-Carpenter syndrome) and SEC24D (‘Cole-Carpenter and population level.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]