DOCSLIB.ORG

Supplementary Materials: Evaluation of Cytotoxicity and Α-Glucosidase Inhibitory Activity of Amide and Polyamino-Derivatives of Lupane Triterpenoids

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supplementary Materials: Evaluation of Cytotoxicity and Α-Glucosidase Inhibitory Activity of Amide and Polyamino-Derivatives of Lupane Triterpenoids Supplementary Materials: Evaluation of cytotoxicity and α-glucosidase inhibitory activity of amide and polyamino-derivatives of lupane triterpenoids Oxana B. Kazakova1*, Gul'nara V. Giniyatullina1, Akhat G. Mustafin1, Denis A. Babkov2, Elena V. Sokolova2, Alexander A. Spasov2* 1Ufa Institute of Chemistry of the Ufa Federal Research Centre of the Russian Academy of Sciences, 71, pr. Oktyabrya, 450054 Ufa, Russian Federation 2Scientific Center for Innovative Drugs, Volgograd State Medical University, Novorossiyskaya st. 39, Volgograd 400087, Russian Federation Correspondence Prof. Dr. Oxana B. Kazakova Ufa Institute of Chemistry of the Ufa Federal Research Centre of the Russian Academy of Sciences 71 Prospeсt Oktyabrya Ufa, 450054 Russian Federation E-mail: [email protected] Prof. Dr. Alexander A. Spasov Scientific Center for Innovative Drugs of the Volgograd State Medical University 39 Novorossiyskaya st. Volgograd, 400087 Russian Federation E-mail: [email protected] Figure S1. 1H and 13C of compound 2. H NH N H O H O H 2 2 Figure S2. 1H and 13C of compound 4. NH2 O H O H CH3 O O H H3C O H 4 3 Figure S3. Anticancer screening data of compound 2 at single dose assay 4 Figure S4. Anticancer screening data of compound 7 at single dose assay 5 Figure S5. Anticancer screening data of compound 8 at single dose assay 6 Figure S6. Anticancer screening data of compound 9 at single dose assay 7 Figure S7. Anticancer screening data of compound 12 at single dose assay 8 Figure S8. Anticancer screening data of compound 13 at single dose assay 9 Figure S9. Anticancer screening data of compound 14 at single dose assay 10 Figure S10. Anticancer screening data of compound 15 at single dose assay 11 Figure S11. Anticancer screening data of compound 16 at single dose assay 12 Figure S12. Anticancer screening data of compound 17 at single dose assay 13 Figure S13. Anticancer screening data of compound 19 at single dose assay 14 Figure S14. Anticancer screening data of compound 20 at single dose assay 15 Figure S15. Anticancer screening data of compound 22 at single dose assay 16 Figure S16. Anticancer screening data of compound 24 at single dose assay 17 Figure S17. Anticancer screening data of compound 25 at single dose assay 18 Figure S18. Anticancer screening data of compound 26 at single dose assay 19 Figure S19. Anticancer screening data of compound 4 at single dose assay 20 Figure S20. Anticancer screening data of compound 4 at a 5-dose assay 21 Figure S21. Anticancer screening data of compound 5 at single dose assay 22 Figure S22. Anticancer screening data of compound 5 at a 5-dose assay 23 Figure S23. Anticancer screening data of compound 6 at single dose assay 24 Figure S24. Anticancer screening data of compound 6 at a 5-dose assay 25 Figure S25. Anticancer screening data of compound 10 at single dose assay 26 Figure S26. Anticancer screening data of compound 10 at a 5-dose assay 27 Figure S27. Anticancer screening data of compound 11 at single dose assay 28 Figure S28. Anticancer screening data of compound 11 at a 5-dose assay 29 Figure S29. Anticancer screening data of compound 21 at single dose assay 30 Figure S30. Anticancer screening data of compound 21 at a 5-dose assay 31 Table S1. Gene ontology (GO) term enrichment analysis for compound 4 across the NCI-60 panel cell lines based on CellMiner analysis GO Term P value Adjusted Genes P value1 Biological process – – – – Molecular function – – – – 1 P value was calculated using the hypergeometric test and corrected for multiple hypothesis testing (P <0.05) using the Benjamini-Hochberg false discovery rate (FDR) adjustment. 32 Table S2. Gene ontology (GO) term enrichment analysis for compound 5 across the NCI-60 panel cell lines based on CellMiner analysis GO Term P value Adjusted Genes P value Biological process Central nervous 4.3374E-5 3.5581E-2 RPH3A EMX1 CYP26C1 TLX3 GSX1 HP TBR1 LHX5 system development PTF1A Hindbrain 7.1163E-5 3.5581E-2 HP TBR1 LHX5 PTF1A development Brain development 1.5166E-4 4.2809E-2 RPH3A EMX1 GSX1 HP TBR1 LHX5 PTF1A Multicellular 1.8287E-4 4.2809E-2 TDPX2 HP TNFAIP2 OR1I1 CACNA1F BRS3 RPH3A organismal process RS1 PLAU OBP2B MDK PRDX1 LTA4H DRD4 EMX1 PAQR7 GSX1 OR6J1 LIF TBR1 MMP9 EREG SLC6A5 F7 OR13C8 CYP26C1 TLX3 LHX5 SCN4A PTF1A Neuron differentiation 2.6561E-4 4.2809E-2 EMX1 TLX3 GSX1 LIF TBR1 LHX5 CACNA1F PTF1A Removal of 4.0054E-4 4.2809E-2 TDPX2 PRDX1 superoxide radicals Cellular response to 4.0054E-4 4.2809E-2 TDPX2 PRDX1 superoxide Cellular response to 4.0054E-4 4.2809E-2 TDPX2 PRDX1 oxygen radical System development 4.1848E-4 4.2809E-2 EMX1 GSX1 TDPX2 HP LIF TNFAIP2 TBR1 CACNA1F MMP9 EREG RPH3A F7 CYP26C1 TLX3 PLAU MDK PRDX1 LHX5 LTA4H PTF1A Neuron fate 4.4580E-4 4.2809E-2 TLX3 GSX1 PTF1A commitment Natural killer cell 5.1371E-4 4.2809E-2 TDPX2 PRDX1 mediated immunity Natural killer cell 5.1371E-4 4.2809E-2 TDPX2 PRDX1 mediated cytotoxicity Molecular function Thioredoxin 9.7772E-5 2.4736E-2 TDPX2 PRDX1 peroxidase activity 1 P value was calculated using the hypergeometric test and corrected for multiple hypothesis testing (P <0.05) using the Benjamini-Hochberg false discovery rate (FDR) adjustment. 33 Table S3. Gene ontology (GO) term enrichment analysis for compound 6 across the NCI-60 panel cell lines based on CellMiner analysis GO Term P value Adjusted Genes P value Biological process Immune system 7.4114E-8 1.4037E-4 CX3CR1 CD86 FH CXCL9 SELPLG TNFRSF13B NCF4 process WAS IKZF1 ITGAL IL2RG LY9 CORO1A CTSS CD79A IGKC FLVCR1 IL21R CCR7 S1PR4 CCR2 CCL25 CR2 LY86 THEMIS RHOH CYBB DEFA1 HSH2D POLR3A CD8B IFNG BANK1 KLHL6 POU2AF1 PECAM1 CD28 TLR9 HCLS1 TLR7 DTL MS4A1 PVALB Positive regulation of 3.0981E-6 2.9339E-3 CD86 FH CR2 THEMIS MIA3 IKZF1 CORO1A FCER2 immune system CD79A IFNG KLHL6 CD28 TLR9 CD38 CD37 TLR7 process DTL MS4A1 Immune response 6.4668E-6 4.0827E-3 CX3CR1 CD86 FH CXCL9 NCF4 WAS ITGAL IL2RG LY9 CORO1A CTSS IGKC CCR7 S1PR4 CCR2 CCL25 CR2 LY86 CYBB DEFA1 POLR3A CD8B KLHL6 POU2AF1 CD28 TLR9 TLR7 DTL MS4A1 Leukocyte activation 3.8908E-5 1.8423E-2 CX3CR1 CD86 WAS THEMIS RHOH IKZF1 ITGAL CD79A HSH2D CD8B BANK1 IL21R CD28 TLR7 MS4A1 Lymphocyte activation 5.5271E-5 1.8927E-2 CD86 WAS THEMIS RHOH IKZF1 ITGAL CD79A HSH2D CD8B BANK1 IL21R CD28 MS4A1 Regulation of immune 5.9959E-5 1.8927E-2 CD86 FH CR2 SPI1 TNFRSF13B THEMIS MIA3 IKZF1 system process CORO1A FCER2 CD79A CD8B IFNG KLHL6 CD28 TLR9 CD38 CD37 TLR7 DTL MS4A1 Defense response 1.2927E-4 3.4978E-2 CX3CR1 CD86 FH CXCL9 WAS LSP1 ITGAL PLA2G7 CORO1A CYSLTR1 CCR7 CCR3 CCR2 CCL25 CR2 RNASE6 LY86 CYBB KIR3DL2 DEFA1 POLR3A IFNG TLR9 CARD18 TLR7 MS4A1 Regulation of immune 1.6038E-4 3.7970E-2 CD86 FH CR2 THEMIS FCER2 CD79A CD8B IFNG response KLHL6 CD28 CD37 TLR7 DTL MS4A1 Molecular function Cytokine binding 4.4139E-5 2.4850E-2 CX3CR1 IL10RA TNFRSF18 IL3RA IL21R TNFRSF17 CCR7 IL2RG CCR3 CCR2 1 P value was calculated using the hypergeometric test and corrected for multiple hypothesis testing (P <0.05) using the Benjamini-Hochberg false discovery rate (FDR) adjustment. 34 Table S4. Gene ontology (GO) term enrichment analysis for compound 10 across the NCI-60 panel cell lines based on CellMiner analysis GO Term P value Adjusted P Genes value Biological process Chromatin 2.4288E-6 2.4791E-3 FOXA1 KMT2D SMARCD2 KDM3B KMT2B organization HIST2H2AB YEATS4 HIST2H2AC MBTD1 HIRA VPS72 LEO1 HIST1H2AE SUDS3 ATXN7L3 HIST1H3D BPTF HIST1H2AM SETDB1 KMT5C USP21 SETD1B INO80 HIST2H2BE HIST2H2BD HIST3H2A TADA1 TSSK4 HIST2H3D HIST1H2BC Positive regulation of 3.1487E-6 2.4791E-3 FOXA1 KMT2D KMT2B RAC3 steroid hormone receptor signaling pathway Positive regulation of 3.1487E-6 2.4791E-3 FOXA1 KMT2D KMT2B RAC3 estrogen receptor signaling pathway Regulation of estrogen 4.1174E-5 2.2425E-2 FOXA1 KMT2D KMT2B RAC3 receptor signaling pathway Protein-DNA complex 4.7470E-5 2.2425E-2 HIST1H2AM HIST3H2A HIST2H2AB HIST1H2AE assembly HIST2H3D HIST2H2BE HIST1H3D HIST2H2AC HIST2H2BD PIAS1 HIST1H2BC Nucleosome assembly 9.5898E-5 3.7752E-2 HIST1H2AM HIST3H2A HIST2H2AB HIST1H2AE HIST2H3D HIST2H2BE HIST1H3D HIST2H2AC HIST2H2BD HIST1H2BC Chromatin assembly 1.4443E-4 4.8735E-2 HIST1H2AM HIST3H2A HIST2H2AB HIST1H2AE HIST2H3D HIST2H2BE HIST1H3D HIST2H2AC HIST2H2BD HIST1H2BC Molecular function Binding 1.9603E-5 1.0632E-2 TCERG1 ZNF296 EHF IFITM1 IL1RN NUP107 PGAP2 ACSM3 RPL34 PRF1 CALML4 AQP5 NADSYN1 RPL6 CRKL CCAR1 IKZF5 ZFYVE28 FAM110A PNP RUSC1 RASSF5 CHEK2 MYB OGFOD2 TRIM25 STRA13 KIF21B ZNF721 LGALS9 ZNF720 LGALS8 ATXN7L3 FNBP4 IL15RA AQR ENTPD2 NUP210 RSAD2 SYTL1 COG2 ACSL5 PHKA1 SIGIRR CLDN4 SPINT1 PRKAR1B PPA2 PPA1 ZC3H11A TRIM14 TARS2 DNA2 ATF5 ZNF830 HIST2H3D ZSCAN29 CDS1 CRABP2 GIPR SH2D2A PEX11B STXBP2 GATA2 SAMSN1 ACTR3B MTMR7 MBTD1 APOH INPP5D RDH16 CEP72 GSE1 RIMKLA ZBTB7A NTSR1 HIST1H3D ZRANB3 JUP SETDB1 LRBA SETD1B SIAH2 SH2D1B ABCA7 NBEAL2 PTK6 PYCR2 INO80 TRERF1 UBAC1 GADD45G CDAN1 RPL27A CCDC88C MYO5C MKS1 INTS5 REN DUS1L 35 ZNF138 RPS24 ZNF497 RET DHRS13 SERPINA1 HIST2H2AB ICA1 NAT10 HBB SMG7 PCSK6 ZNF48 HIST2H2AC MMP20 DMBX1 COIL GYS2 TRMT112 ENSA RAC3 JAK3 ZNF485 TIGD3 SERPINB3 UPF2 SERPINB4 PARP4 SIRT7 HEXDC CBFA2T3 SRP9 HIST2H2BE F5 HIST2H2BD MED28 FAHD2B VAMP8 CNKSR1 PSMA3 PDIK1L RPUSD2 DMC1 TUT1 ALDOC GLCCI1 RNF166 DCP2 PDZRN4 ZNF592 RPL10 MRPS31 TUBD1 TANK AKAP1 FGD3 HIRA ADRBK1 LEO1 PLAGL2 RPS2 RPL18 REM2 SPDEF GCH1 F12 CARD9 OSM NR1H3 KLHL3 PUS7L GRHL1 C17ORF62 GRHL2 DEF6 BATF MAS1 TMCO6 KRT19 LRG1 NR6A1 HIST3H2A DHRS9 TTC6 IL17F KBTBD7 FOXA1 DGKE TOR2A ZNF692 STEAP4 PRUNE RORC YEATS4 TSEN2 NPEPPS ZFP36 CAPN8 PPIP5K1 EME2 POGZ ZNF207 HIST1H2AE TNFRSF8 ZNF687 HIST1H2AM ZBP1 TLE3 ZBTB39 CISH KMT5C GTF3A ZBTB32 LMTK3
Load more

Recommended publications
  • PRODUCT SPECIFICATION Anti-EIF2B4 Product
    Anti-EIF2B4 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-EIF2B4 Product Number HPA039993 Gene Description eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRE LPESGIQLGTPREKVPAGRSKAELRAER Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended ICC-IF (Immunofluorescence) Applications - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA039993 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • Eif3j Antibody A
    Revision 1 C 0 2 - t eIF3J Antibody a e r o t S Orders: 877-616-CELL (2355) [email protected] Support: 877-678-TECH (8324) 1 6 Web: [email protected] 2 www.cellsignal.com 3 # 3 Trask Lane Danvers Massachusetts 01923 USA For Research Use Only. Not For Use In Diagnostic Procedures. Applications: Reactivity: Sensitivity: MW (kDa): Source: UniProt ID: Entrez-Gene Id: WB, IP H M R Endogenous 35 Rabbit O75822 8669 Product Usage Information (5). eIF3J has been shown to associate with the aminoacyl site and mRNA entry channel of the 40S ribosomal subunit (6). eIF3J has also been shown to have an additional role in Application Dilution the recycling of post-termination complexes (7). 1. Masutani, M. et al. (2007) EMBO J 26, 3373-83. Western Blotting 1:1000 2. Chaudhuri, J. et al. (1999) J Biol Chem 274, 17975-80. Immunoprecipitation 1:50 3. Holz, M.K. et al. (2005) Cell 123, 569-80. 4. Harris, T.E. et al. (2006) EMBO J 25, 1659-68. 5. Fraser, C.S. et al. (2004) J Biol Chem 279, 8946-56. Storage 6. Fraser, C.S. et al. (2007) Mol Cell 26, 811-9. Supplied in 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, 100 µg/ml BSA and 50% 7. Pisarev, A.V. et al. (2007) Cell 131, 286-99. glycerol. Store at –20°C. Do not aliquot the antibody. Specificity / Sensitivity eIF3J Antibody detects endogenous levels of total eIF3J protein. Species Reactivity: Human, Mouse, Rat Source / Purification Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to the sequence of human eIF3J.
    [Show full text]
  • Structural Characterization of the Human Eukaryotic Initiation Factor 3 Protein Complex by Mass Spectrometry*□S
    Supplemental Material can be found at: http://www.mcponline.org/cgi/content/full/M600399-MCP200 /DC1 Research Structural Characterization of the Human Eukaryotic Initiation Factor 3 Protein Complex by Mass Spectrometry*□S Eugen Damoc‡, Christopher S. Fraser§, Min Zhou¶, Hortense Videler¶, Greg L. Mayeurʈ, John W. B. Hersheyʈ, Jennifer A. Doudna§, Carol V. Robinson¶**, and Julie A. Leary‡ ‡‡ Protein synthesis in mammalian cells requires initiation The initiation phase of eukaryotic protein synthesis involves factor eIF3, an ϳ800-kDa protein complex that plays a formation of an 80 S ribosomal complex containing the initi- Downloaded from central role in binding of initiator methionyl-tRNA and ator methionyl-tRNAi bound to the initiation codon in the mRNA to the 40 S ribosomal subunit to form the 48 S mRNA. This is a multistep process promoted by proteins initiation complex. The eIF3 complex also prevents pre- called eukaryotic initiation factors (eIFs).1 Currently at least 12 mature association of the 40 and 60 S ribosomal subunits eIFs, composed of at least 29 distinct subunits, have been and interacts with other initiation factors involved in start identified (1). Mammalian eIF3, the largest initiation factor, is a codon selection. The molecular mechanisms by which multisubunit complex with an apparent molecular mass of www.mcponline.org eIF3 exerts these functions are poorly understood. Since ϳ800 kDa. This protein complex plays an essential role in its initial characterization in the 1970s, the exact size, translation by binding directly to the 40 S ribosomal subunit composition, and post-translational modifications of and promoting formation of the 43 S preinitiation complex ⅐ ⅐ mammalian eIF3 have not been rigorously determined.
    [Show full text]
  • Examination of the Transcription Factors Acting in Bone Marrow
    THESIS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY (PHD) Examination of the transcription factors acting in bone marrow derived macrophages by Gergely Nagy Supervisor: Dr. Endre Barta UNIVERSITY OF DEBRECEN DOCTORAL SCHOOL OF MOLECULAR CELL AND IMMUNE BIOLOGY DEBRECEN, 2016 Table of contents Table of contents ........................................................................................................................ 2 1. Introduction ............................................................................................................................ 5 1.1. Transcriptional regulation ................................................................................................... 5 1.1.1. Transcriptional initiation .................................................................................................. 5 1.1.2. Co-regulators and histone modifications .......................................................................... 8 1.2. Promoter and enhancer sequences guiding transcription factors ...................................... 11 1.2.1. General transcription factors .......................................................................................... 11 1.2.2. The ETS superfamily ..................................................................................................... 17 1.2.3. The AP-1 and CREB proteins ........................................................................................ 20 1.2.4. Other promoter specific transcription factor families ...................................................
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • 4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation
    Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
    [Show full text]
  • Supplemental Materials ZNF281 Enhances Cardiac Reprogramming
    Supplemental Materials ZNF281 enhances cardiac reprogramming by modulating cardiac and inflammatory gene expression Huanyu Zhou, Maria Gabriela Morales, Hisayuki Hashimoto, Matthew E. Dickson, Kunhua Song, Wenduo Ye, Min S. Kim, Hanspeter Niederstrasser, Zhaoning Wang, Beibei Chen, Bruce A. Posner, Rhonda Bassel-Duby and Eric N. Olson Supplemental Table 1; related to Figure 1. Supplemental Table 2; related to Figure 1. Supplemental Table 3; related to the “quantitative mRNA measurement” in Materials and Methods section. Supplemental Table 4; related to the “ChIP-seq, gene ontology and pathway analysis” and “RNA-seq” and gene ontology analysis” in Materials and Methods section. Supplemental Figure S1; related to Figure 1. Supplemental Figure S2; related to Figure 2. Supplemental Figure S3; related to Figure 3. Supplemental Figure S4; related to Figure 4. Supplemental Figure S5; related to Figure 6. Supplemental Table S1. Genes included in human retroviral ORF cDNA library. Gene Gene Gene Gene Gene Gene Gene Gene Symbol Symbol Symbol Symbol Symbol Symbol Symbol Symbol AATF BMP8A CEBPE CTNNB1 ESR2 GDF3 HOXA5 IL17D ADIPOQ BRPF1 CEBPG CUX1 ESRRA GDF6 HOXA6 IL17F ADNP BRPF3 CERS1 CX3CL1 ETS1 GIN1 HOXA7 IL18 AEBP1 BUD31 CERS2 CXCL10 ETS2 GLIS3 HOXB1 IL19 AFF4 C17ORF77 CERS4 CXCL11 ETV3 GMEB1 HOXB13 IL1A AHR C1QTNF4 CFL2 CXCL12 ETV7 GPBP1 HOXB5 IL1B AIMP1 C21ORF66 CHIA CXCL13 FAM3B GPER HOXB6 IL1F3 ALS2CR8 CBFA2T2 CIR1 CXCL14 FAM3D GPI HOXB7 IL1F5 ALX1 CBFA2T3 CITED1 CXCL16 FASLG GREM1 HOXB9 IL1F6 ARGFX CBFB CITED2 CXCL3 FBLN1 GREM2 HOXC4 IL1F7
    [Show full text]
  • Download Download
    Supplementary Figure S1. Results of flow cytometry analysis, performed to estimate CD34 positivity, after immunomagnetic separation in two different experiments. As monoclonal antibody for labeling the sample, the fluorescein isothiocyanate (FITC)- conjugated mouse anti-human CD34 MoAb (Mylteni) was used. Briefly, cell samples were incubated in the presence of the indicated MoAbs, at the proper dilution, in PBS containing 5% FCS and 1% Fc receptor (FcR) blocking reagent (Miltenyi) for 30 min at 4 C. Cells were then washed twice, resuspended with PBS and analyzed by a Coulter Epics XL (Coulter Electronics Inc., Hialeah, FL, USA) flow cytometer. only use Non-commercial 1 Supplementary Table S1. Complete list of the datasets used in this study and their sources. GEO Total samples Geo selected GEO accession of used Platform Reference series in series samples samples GSM142565 GSM142566 GSM142567 GSM142568 GSE6146 HG-U133A 14 8 - GSM142569 GSM142571 GSM142572 GSM142574 GSM51391 GSM51392 GSE2666 HG-U133A 36 4 1 GSM51393 GSM51394 only GSM321583 GSE12803 HG-U133A 20 3 GSM321584 2 GSM321585 use Promyelocytes_1 Promyelocytes_2 Promyelocytes_3 Promyelocytes_4 HG-U133A 8 8 3 GSE64282 Promyelocytes_5 Promyelocytes_6 Promyelocytes_7 Promyelocytes_8 Non-commercial 2 Supplementary Table S2. Chromosomal regions up-regulated in CD34+ samples as identified by the LAP procedure with the two-class statistics coded in the PREDA R package and an FDR threshold of 0.5. Functional enrichment analysis has been performed using DAVID (http://david.abcc.ncifcrf.gov/)
    [Show full text]
  • Proteomics Provides Insights Into the Inhibition of Chinese Hamster V79
    www.nature.com/scientificreports OPEN Proteomics provides insights into the inhibition of Chinese hamster V79 cell proliferation in the deep underground environment Jifeng Liu1,2, Tengfei Ma1,2, Mingzhong Gao3, Yilin Liu4, Jun Liu1, Shichao Wang2, Yike Xie2, Ling Wang2, Juan Cheng2, Shixi Liu1*, Jian Zou1,2*, Jiang Wu2, Weimin Li2 & Heping Xie2,3,5 As resources in the shallow depths of the earth exhausted, people will spend extended periods of time in the deep underground space. However, little is known about the deep underground environment afecting the health of organisms. Hence, we established both deep underground laboratory (DUGL) and above ground laboratory (AGL) to investigate the efect of environmental factors on organisms. Six environmental parameters were monitored in the DUGL and AGL. Growth curves were recorded and tandem mass tag (TMT) proteomics analysis were performed to explore the proliferative ability and diferentially abundant proteins (DAPs) in V79 cells (a cell line widely used in biological study in DUGLs) cultured in the DUGL and AGL. Parallel Reaction Monitoring was conducted to verify the TMT results. γ ray dose rate showed the most detectable diference between the two laboratories, whereby γ ray dose rate was signifcantly lower in the DUGL compared to the AGL. V79 cell proliferation was slower in the DUGL. Quantitative proteomics detected 980 DAPs (absolute fold change ≥ 1.2, p < 0.05) between V79 cells cultured in the DUGL and AGL. Of these, 576 proteins were up-regulated and 404 proteins were down-regulated in V79 cells cultured in the DUGL. KEGG pathway analysis revealed that seven pathways (e.g.
    [Show full text]
  • Yeast Genome Gazetteer P35-65
    gazetteer Metabolism 35 tRNA modification mitochondrial transport amino-acid metabolism other tRNA-transcription activities vesicular transport (Golgi network, etc.) nitrogen and sulphur metabolism mRNA synthesis peroxisomal transport nucleotide metabolism mRNA processing (splicing) vacuolar transport phosphate metabolism mRNA processing (5’-end, 3’-end processing extracellular transport carbohydrate metabolism and mRNA degradation) cellular import lipid, fatty-acid and sterol metabolism other mRNA-transcription activities other intracellular-transport activities biosynthesis of vitamins, cofactors and RNA transport prosthetic groups other transcription activities Cellular organization and biogenesis 54 ionic homeostasis organization and biogenesis of cell wall and Protein synthesis 48 plasma membrane Energy 40 ribosomal proteins organization and biogenesis of glycolysis translation (initiation,elongation and cytoskeleton gluconeogenesis termination) organization and biogenesis of endoplasmic pentose-phosphate pathway translational control reticulum and Golgi tricarboxylic-acid pathway tRNA synthetases organization and biogenesis of chromosome respiration other protein-synthesis activities structure fermentation mitochondrial organization and biogenesis metabolism of energy reserves (glycogen Protein destination 49 peroxisomal organization and biogenesis and trehalose) protein folding and stabilization endosomal organization and biogenesis other energy-generation activities protein targeting, sorting and translocation vacuolar and lysosomal
    [Show full text]
  • 1 AGING Supplementary Table 2
    SUPPLEMENTARY TABLES Supplementary Table 1. Details of the eight domain chains of KIAA0101. Serial IDENTITY MAX IN COMP- INTERFACE ID POSITION RESOLUTION EXPERIMENT TYPE number START STOP SCORE IDENTITY LEX WITH CAVITY A 4D2G_D 52 - 69 52 69 100 100 2.65 Å PCNA X-RAY DIFFRACTION √ B 4D2G_E 52 - 69 52 69 100 100 2.65 Å PCNA X-RAY DIFFRACTION √ C 6EHT_D 52 - 71 52 71 100 100 3.2Å PCNA X-RAY DIFFRACTION √ D 6EHT_E 52 - 71 52 71 100 100 3.2Å PCNA X-RAY DIFFRACTION √ E 6GWS_D 41-72 41 72 100 100 3.2Å PCNA X-RAY DIFFRACTION √ F 6GWS_E 41-72 41 72 100 100 2.9Å PCNA X-RAY DIFFRACTION √ G 6GWS_F 41-72 41 72 100 100 2.9Å PCNA X-RAY DIFFRACTION √ H 6IIW_B 2-11 2 11 100 100 1.699Å UHRF1 X-RAY DIFFRACTION √ www.aging-us.com 1 AGING Supplementary Table 2. Significantly enriched gene ontology (GO) annotations (cellular components) of KIAA0101 in lung adenocarcinoma (LinkedOmics). Leading Description FDR Leading Edge Gene EdgeNum RAD51, SPC25, CCNB1, BIRC5, NCAPG, ZWINT, MAD2L1, SKA3, NUF2, BUB1B, CENPA, SKA1, AURKB, NEK2, CENPW, HJURP, NDC80, CDCA5, NCAPH, BUB1, ZWILCH, CENPK, KIF2C, AURKA, CENPN, TOP2A, CENPM, PLK1, ERCC6L, CDT1, CHEK1, SPAG5, CENPH, condensed 66 0 SPC24, NUP37, BLM, CENPE, BUB3, CDK2, FANCD2, CENPO, CENPF, BRCA1, DSN1, chromosome MKI67, NCAPG2, H2AFX, HMGB2, SUV39H1, CBX3, TUBG1, KNTC1, PPP1CC, SMC2, BANF1, NCAPD2, SKA2, NUP107, BRCA2, NUP85, ITGB3BP, SYCE2, TOPBP1, DMC1, SMC4, INCENP. RAD51, OIP5, CDK1, SPC25, CCNB1, BIRC5, NCAPG, ZWINT, MAD2L1, SKA3, NUF2, BUB1B, CENPA, SKA1, AURKB, NEK2, ESCO2, CENPW, HJURP, TTK, NDC80, CDCA5, BUB1, ZWILCH, CENPK, KIF2C, AURKA, DSCC1, CENPN, CDCA8, CENPM, PLK1, MCM6, ERCC6L, CDT1, HELLS, CHEK1, SPAG5, CENPH, PCNA, SPC24, CENPI, NUP37, FEN1, chromosomal 94 0 CENPL, BLM, KIF18A, CENPE, MCM4, BUB3, SUV39H2, MCM2, CDK2, PIF1, DNA2, region CENPO, CENPF, CHEK2, DSN1, H2AFX, MCM7, SUV39H1, MTBP, CBX3, RECQL4, KNTC1, PPP1CC, CENPP, CENPQ, PTGES3, NCAPD2, DYNLL1, SKA2, HAT1, NUP107, MCM5, MCM3, MSH2, BRCA2, NUP85, SSB, ITGB3BP, DMC1, INCENP, THOC3, XPO1, APEX1, XRCC5, KIF22, DCLRE1A, SEH1L, XRCC3, NSMCE2, RAD21.
    [Show full text]
  • Mouse Population-Guided Resequencing Reveals That Variants in CD44 Contribute to Acetaminophen-Induced Liver Injury in Humans
    Downloaded from genome.cshlp.org on October 2, 2021 - Published by Cold Spring Harbor Laboratory Press Letter Mouse population-guided resequencing reveals that variants in CD44 contribute to acetaminophen-induced liver injury in humans Alison H. Harrill,1,2,12 Paul B. Watkins,3,12 Stephen Su,6 Pamela K. Ross,2 David E. Harbourt,5 Ioannis M. Stylianou,7 Gary A. Boorman,8 Mark W. Russo,3 Richard S. Sackler,9 Stephen C. Harris,11 Philip C. Smith,5 Raymond Tennant,8 Molly Bogue,7 Kenneth Paigen,7 Christopher Harris,9,10 Tanupriya Contractor,9 Timothy Wiltshire,5 Ivan Rusyn,1,2,14 and David W. Threadgill1,4,13,14,15 1Curriculum in Toxicology, University of North Carolina, Chapel Hill, North Carolina 27599, USA; 2Department of Environmental Sciences and Engineering, University of North Carolina, Chapel Hill, North Carolina 27599, USA; 3Division of Gastroenterology and Hepatology, University of North Carolina, Chapel Hill, North Carolina 27599, USA; 4Department of Genetics, University of North Carolina, Chapel Hill, North Carolina 27599, USA; 5School of Pharmacy, University of North Carolina, Chapel Hill, North Carolina 27599, USA; 6Department of Mouse Genetics, Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, USA; 7The Jackson Laboratory, Bar Harbor, Maine 04609, USA; 8National Institute of Environmental Health Sciences, Research Triangle Park, North Carolina 27709, USA; 9Verto Institute Research Laboratories, New Brunswick, New Jersey 08903, USA; 10Cancer Institute of New Jersey, New Brunswick, New Jersey 08903, USA; 11Purdue Pharma L.P., Stamford, Connecticut 06901, USA; 12Hamner-UNC Center for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, North Carolina 27709, USA; 13Department of Genetics, North Carolina State University, Raleigh, North Carolina 27695, USA Interindividual variability in response to chemicals and drugs is a common regulatory concern.
    [Show full text]