1979 1399 Winners, Year H (

Total Page:16

File Type:pdf, Size:1020Kb

Load more

WINNERS, YEAR 1979G () 1399 H KFIP Annual Period : 1 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Sayyid Abul Ala’a Al-Mowdoodi Islam Pakistan Islamic Studies Dealing with the Professor Fuat Sezgin Studies Influence of Muslim Scholars Germany on European Civilization Arabic Studies on Contemporary NOT AWARDED Language Arabic Poetry --- and Literature King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1980G () 1400 H KFIP Annual Period : 2 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Sayyid Abul-Hasan Ali Al-Hasani co-winner Islam Al-Nadawi India Service to --- Dr. Muhammad Natsir co-winner Islam Indonesia Islamic Studies on the Hadith of the Dr. Muhammad M. Al-A’azami Studies Prophet Muhammad Saudi Arabia (Peace be upon him) Arabic Studies on Contemporary Professor Ihsan Abbas co-winner Language Arabic Poetry Palestine and Literature Arabic Studies on Contemporary Professor Abd Al-Qadir Al-Qit co-winner Language Arabic Poetry Egypt and Literature King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1981G () 1401 H KFIP Annual Period : 3 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- His Majesty King Khalid Ibn Abd Islam Al-Aziz Al-Saud Saudi Arabia Islamic Studies on the Role of NOT AWARDED Studies Shari’a in the Restoration of --- the Society Arabic Editing Literary Manuscripts Mr. Abd Al-Salam Haroon Language from the Second and Third Egypt and Literature Centuries A.H King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1982G () 1402 H KFIP Annual Period : 4 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Shaikh Abd Al-Aziz Bin Baz Islam Saudi Arabia Islamic Contemporary Economic Professor Muhammad N. Siddiqui Studies Problems from an Islamic India Perspective Arabic Studies on Ancient Arabic Professor Nasir Al-Din Al-Asad Language Literature from the Pre- Jordan and Literature Islamic Era to the End of the First Century A H Midicine Primary Health Care Professor David C. Morley UK King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1983G () 1403 H KFIP Annual Period : 5 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Shaikh Hasanein M. Makhlouf co-winner Islam Egypt Service to --- Prince Tunku Abd Al-Rahman co-winner Islam Malaysia Islamic Studies on the Holy Qur’an Professor Muhammad A. Odaimah Studies Egypt Arabic Studies on Ancient Arabic Professor Ahmad Shawqi Daif Language Literature During the Second Egypt and Literature and Third Centuries A.H. Midicine Malaria Professor Wallace Peters UK Science Physics NOT AWARDED --- King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1984G () 1404 H KFIP Annual Period : 6 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Custodian of the Two Holy Islam Mosques King Fahd Ibn Abd Al- Saudi Arabia Aziz Al-Saud Islamic General Theory in Islamic Shaikh Mustafa A. Al-Zarka’a Studies Jurisprudence Syria Arabic Studies on Arabic Literature Mr. Mahmoud M. Shaker Language During the Fourth Century Egypt and Literature A.H. Midicine Diarrheal Diseases Dr. John S. Fordtran co-winner USA Midicine Diarrheal Diseases Dr. William Greenough III co-winner USA Midicine Diarrheal Diseases Professor Michael Field co-winner USA Science Physics Dr. Gerd Binnig co-winner Germany Science Physics Dr. Heinrich Rohrer co-winner Switzerland King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1985G () 1405 H KFIP Annual Period : 7 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Mr. Abd Rab Al-Rasoul Saiaf Islam Afghanistan Islamic Studies and Editions on the Dr. Muhammad R. Salim co-winner Studies Islamic Doctine Saudi Arabia Islamic Studies and Editions on the Dr. Farouk A. Desouki co-winner Studies Islamic Doctine Egypt Islamic Studies and Editions on the Dr. Mustafa M. Suliman co-winner Studies Islamic Doctine Egypt Arabic Studies on Ancient Arabic NOT AWARDED Language Literary Criticism --- and Literature Midicine Viral Hepatitis Professor R. Palmer Beasley co-winner USA Midicine Viral Hepatitis Professor Mario Rizetto co-winner Italy Science NOT AWARDED --- King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1986G () 1406 H KFIP Annual Period : 8 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Mr. Ahmad H. Deedat co-winner Islam South Africa Service to --- Dr. Roger Garaudy co-winner Islam France Islamic Studies Dealing with Islamic Professor Abd Al-Aziz Al-Duri Studies History Iraq Arabic Studies on Arabic Literature Mr. Muhammad B. Al-Athari Language During the Fifth and Sixth Iraq and Literature Centuries A.H Midicine Diabetes mellitus Dr. Gian Franco Bottazzo co-winner Italy Midicine Diabetes mellitus Professor Albert E. Renold co-winner Switzerland Midicine Diabetes mellitus Professor Lilio Orci co-winner Italy Science Biochemistry Dr. Michael J. Berridge UK King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1987G () 1407 H KFIP Annual Period : 9 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Shaikh Abu Bakr Mahmoud Gumi Islam Nigeria Islamic Principles and Practices of NOT AWARDED Studies International Relations in --- Islam Arabic Literary Studies on Modern NOT AWARDED Language Arabic Prose --- and Literature Midicine Prevention of Blindness Professor Barrie Russel Jones UK Science Mathematics Professor Sir Michael Atiya UK King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1988G () 1408 H KFIP Annual Period : 10 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Dr. Ahmad Domocao Alonto Islam Philippines Islamic Studies Dealing with Islamic Mr. Muhammad Kotb Shathly co-winner Studies Education Egypt Islamic Studies Dealing with Islamic Dr. Miqdad Yalçin co-winner Studies Education Turkey Arabic Studies on Arabic Literature Professor Mahmoud Y. Makki co-winner Language in Andalusia Egypt and Literature Arabic Studies on Arabic Literature Professor Muhammad bin Sharifah co-winner Language in Andalusia Morocco and Literature Midicine Leukemia Professor Janet D. Rawley co-winner USA Midicine Leukemia Professor Melvin F. Greaves co-winner UK Science Biology Professor Ricardo Miledi co-winner UK Science Biology Professor Pierre Chambon co-winner France King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1989G () 1409 H KFIP Annual Period : 11 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Shaikh Muhammad Al-Ghazali Al- Islam Saqqa Egypt Islamic Studies Dealing with the Professor Saleh Ahmad Al-Ali Studies Islamic City Iraq Arabic Studies Dealing with Professor Shaker Al-Fahham co-winner Language Prominent Arab Writers and Syria and Literature Poets till the end of the Third Century A H Arabic Studies Dealing with Professor Yousef A. Khulaif co-winner Language Prominent Arab Writers and Egypt and Literature Poets till the end of the Third Century A H Midicine Infertility Professor Robert G. Edwards co-winner UK Midicine Infertility Professor Luigi Masterioanni co-winner USA Science Physics Professor Theodore W. Hanch co-winner Germany Science Physics Professor Ahmad H. Zewail co-winner USA King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1990G () 1410 H KFIP Annual Period : 12 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- Shaikh Ali At-Tantawi co-winner Islam Saudi Arabia Service to --- Professor Khurshid Ahmad co-winner Islam Pakistan Islamic Financial Dealings in Islamic Professor Al-Seddiq M. Al-Darir co-winner Studies Shari’ya Sudan Islamic Financial Dealings in Islamic Dr. Muhammad O. Shabra co-winner Studies Shari’ya Saudi Arabia Arabic Short Novels Mr. Yahia Haqqi Language Egypt and Literature Midicine Schistosomiasis Professor André Capron co-winner France Midicine Schistosomiasis Professor Anthony Butterworth co-winner UK Science Chemistry Professor Raymond U. Lemieux co-winner Canada Science Chemistry Professor Frank A. Cotton co-winner USA Science Chemistry Professor Mustafa A. Al-Sayyid co-winner USA King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1991G () 1411 H KFIP Annual Period : 13 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- HE. Dr. Abd Allah Umar Nasif Islam Saudi Arabia Islamic Studies Dealing with the NOT AWARDED Studies Spread of Islam into an Area --- Outside the Present Boundaries of the Islamic Arabic Children Literature Mr. Ahmad M. Najeeb co-winner Language Egypt and Literature Arabic Children Literature Mr. Abd Al-Tawwab Yousef co-winner Language Egypt and Literature Arabic Children Literature Mr. Ali Abd Al-Qadir Al-Siqilli co-winner Language Morocco and Literature Midicine Biochemical Aspects of NOT AWARDED Mental Health --- Science Mathematics NOT AWARDED --- King Faisal International Prize, All Rights Reserved © www.kfip.org WINNERS, YEAR 1992G () 1412 H KFIP Annual Period : 14 PRIZE TOPIC WINNER COUNTRY BRANCH Service to --- HE. Dr. Hamed Al-Ghabid Islam Niger Islamic Origins of Research NOT AWARDED Studies Methodologies in --- Contemporary Arabic Translations of Literary and Professor Muhammad M. Badawi co-winner Language Critical Studies into Arabic Egypt and Literature Arabic Translations of Literary and Professor Abd Al-Fattah S. Ayyad co-winner Language Critical Studies into Arabic Egypt and Literature Arabic Translations of Literary and Professor Muhammad Y. Najm co-winner Language Critical Studies into Arabic Lebanon and Literature Midicine Coronary Artery Disease Professor Attillio Maseri Italy Science Biology Professor Sydney Brenner UK King Faisal International Prize,
Recommended publications
  • PRESENTATION of the 1999 KING FAISAL INTERNATIONAL PRIZE WINNERS by PROF. ABD ALLAH S. AL-UTHAIMIN

    PRESENTATION of the 1999 KING FAISAL INTERNATIONAL PRIZE WINNERS by PROF. ABD ALLAH S. AL-UTHAIMIN

    PRESENTATION OF THE 1999 KING FAISAL INTERNATIONAL PRIZE WINNERS by PROF. ABD ALLAH S. AL-UTHAIMIN Secretary-General of King Faisal International Prize In the name of Allah Praise be to Allah and peace and prayers be upon the Prophet Muhammad and his family, companions, and all his followers until Judgement Day Your Royal Highness, Prince Sultan ibn Abdul Aziz, Second Deputy Premier, Minister of Defense and Aviation and Inspector General Your Royal Highnesses, Your Excellencies, Distinguished Guests, Assalamu Alaikum It gives me great pleasure to present the winners of the 1999 King Faisal International Prize for Service to Islam, Islamic Studies, Arabic Literature, Medicine, and Science. The King Faisal International Prize for Service to Islam has been awarded to Mr. Jum'ah Al-Majid Abd Allah of the United Arab Emirates. Mr. Al-Majid is the Founder and President of Jum'ah Al-Majid Center for Culture and Heritage. He was nominated for the Prize by the World Assembly of Muslim Youth. He has been awarded the Prize in recognition of his outstanding philanthropic services, particularly in the field of Islamic education and support of poor families, as exemplified by the following: • Establishment of schools in the UAE which provide free education for 5,500 Muslim students • Establishment of the College of Islamic and Arabic Studies in Dubai which provides free education and financial assistance, as needed, for more than 2,000 graduate and undergraduate students • Provision of financial support for higher overseas studies for Muslim students and building schools in many Islamic countries • Donations to Islamic cultural centres • In addition, Mr.
  • Arabic Language and Literature 1979 - 2018

    Arabic Language and Literature 1979 - 2018

    ARABIC LANGUAGEAND LITERATURE ARABIC LANGUAGE AND LITERATURE 1979 - 2018 ARABIC LANGUAGE AND LITERATURE A Fleeting Glimpse In the name of Allah and praise be unto Him Peace and blessings be upon His Messenger May Allah have mercy on King Faisal He bequeathed a rich humane legacy A great global endeavor An everlasting development enterprise An enlightened guidance He believed that the Ummah advances with knowledge And blossoms by celebrating scholars By appreciating the efforts of achievers In the fields of science and humanities After his passing -May Allah have mercy on his soul- His sons sensed the grand mission They took it upon themselves to embrace the task 6 They established the King Faisal Foundation To serve science and humanity Prince Abdullah Al-Faisal announced The idea of King Faisal Prize They believed in the idea Blessed the move Work started off, serving Islam and Arabic Followed by science and medicine to serve humanity Decades of effort and achievement Getting close to miracles With devotion and dedicated The Prize has been awarded To hundreds of scholars From different parts of the world The Prize has highlighted their works Recognized their achievements Never looking at race or color Nationality or religion This year, here we are Celebrating the Prize›s fortieth anniversary The year of maturity and fulfillment Of an enterprise that has lived on for years Serving humanity, Islam, and Muslims May Allah have mercy on the soul of the leader Al-Faisal The peerless eternal inspirer May Allah save Salman the eminent leader Preserve home of Islam, beacon of guidance.
  • Richard Doll

    Richard Doll

    2825 Obituary: Richard Doll Sir Richard Doll died earlier this year at age 92. The most The studies by Doll are bold and original science. They celebrated epidemiologist of the 20th century, Doll is best represent an important part of the foundation of modern known for his work on smoking and lung cancer, but there was population-based chronic disease research. By the early 1960s, so much more to his career. they constituted adequate evidence for public health action to His father was a general practitioner in London, and it was reduce tobacco smoking; in 1964, the U.S. Surgeon General’s from St. Thomas’s that Doll himself graduated in Medicine in first report on the adverse health consequences of tobacco was 1937. Even as a student, he showed his interest in epidemi- published. Today, they continue to remind us how carefully ologic and statistical tools, publishing on the need for proper crafted observational studies can advance scientific knowledge analysis and statistical testing in population studies of disease. regarding social and health issues that are not amenable to Later, Doll served in the Royal Medical Corps in France and experimentation on human populations. the Middle East throughout the Second World War. He began Asbestos. By the early 1930s, work in the asbestos products his research career at the Middlesex Hospital, studying industry in Britain was known to increase the risk of a occupational factors in the development of peptic ulceration. sometimes fatal nonmalignant pulmonary disease, termed He married Dr. Joan Faulkner around this time, and it was she asbestosis.
  • Global Journal of Human Social Science the Engagement Patters (Such As Listening)

    Global Journal of Human Social Science the Engagement Patters (Such As Listening)

    OnlineISSN:2249-460X PrintISSN:0975-587X DOI:10.17406/GJHSS AnalysisofIslamicSermon PortrayalofRohingyaWomen NabakalebaraofLordJagannath TheRe-EmbodimentoftheDivine VOLUME20ISSUE7VERSION1.0 Global Journal of Human-Social Science: C Sociology & Culture Global Journal of Human-Social Science: C Sociology & Culture Volume 2 0 I ssue 7 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2020. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Global Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU
  • Sir Richard Doll, Epidemiologist – a Personal Reminiscence with a Selected Bibliography

    Sir Richard Doll, Epidemiologist – a Personal Reminiscence with a Selected Bibliography

    British Journal of Cancer (2005) 93, 963 – 966 & 2005 Cancer Research UK All rights reserved 0007 – 0920/05 $30.00 www.bjcancer.com Obituary Sir Richard Doll, epidemiologist – a personal reminiscence with a selected bibliography The death of Richard Doll on 24 July 2005 at the age of 92 after a short illness ended an extraordinarily productive life in science for which he received widespread recognition, including Fellowship of The Royal Society (1966), Knighthood (1971), Companionship of Honour (1996), and many honorary degrees and prizes. He is unique, however, in having seen both universal acceptance of his work demonstrating smoking as the main cause of the most common fatal cancer in the world and the relative success of strategies to reduce the prevalence of the habit. In 1950, 80% of the men in Britain smoked but this has now declined to less than 30%. Richard Doll qualified in medicine at St Thomas’ Hospital in 1937, but his epidemiological career began after service in the Second World War when he worked with Francis Avery Jones at the Central Middlesex Hospital on occupational factors in the aetiology of peptic ulceration. The completeness of Doll’s tracing of previously surveyed men so impressed Tony Bradford Hill that he offered him a post in the MRC Statistical Research Unit to investigate the causes of lung cancer. For the representations of Percy Stocks (Chief Medical Officer to the Registrar General) and Sir Ernest Kennaway had prevailed against the then commonly held view that the marked rise in lung cancer deaths in Britain since 1900 was due only to improved diagnosis.
  • King Faisal Prize 1979-2018

    King Faisal Prize 1979-2018

    1979-2018 4 INTRODUCTION King Faisal International Prize (KFIP) was initiated by the King Faisal Foundation (KFF) inspired by its humanitarian objectives and its commitment to preserve the true Islamic values which King Faisal, may Allah have mercy upon him, stood for. These values and principles, held dearly by the late King Faisal, may Allah rest his soul in peace, are firmly enshrined in the statute of the Prize. Indeed, the KFF established the KFIP as a lofty expression and reflection of late King Faisal’s unstinting support for endeavors slated to alleviate human suffering through the advancement of research and creative human thinking. These are core values which the late King Faisal passionately upheld, besides his respect for knowledge, empathy with scholars, and his appreciative recognition of their contributions to the advancement of nations. He strongly believed that progress of his nation and his countrymen can not be achieved without a resolute acquisition of knowledge that is commensurate with the values and teachings of Islam, as well as an in- depth understanding of human history and a genuine appreciation of the foundations in which the Islamic civilization is grounded, along with the conducive factors that helped this civilization blossom and thrive and positively contribute to universal human civilization. 5 The KFIP is driven by objectives animated by this thorough human perception, emanating from the cradle of the Islamic message, a land to which the hearts of Muslims throughout the world are attached, a land founded on the principles of this message and ruled by its principles. To be sure, these features endow the Prize with a distinct prestige among peer prizes that seek to motivate scientists and thinkers and encourage them to pursue further scientific and intellectual accomplishments that benefit humanity and help foster a better and brighter civilization.
  • Understanding Genetics: DNA, Genes, and Their Real-World Applications Parts I & II Professor David Sadava

    Understanding Genetics: DNA, Genes, and Their Real-World Applications Parts I & II Professor David Sadava

    Understanding Genetics: DNA, Genes, and Their Real-World Applications Parts I & II Professor David Sadava THE TEACHING COMPANY ® Table of Contents Understanding Genetics: DNA, Genes, and Their Real-World Applications Professor Biography..............................................................................................................................................iii Course Scope...........................................................................................................................................................1 Lecture One Our Inheritance...................................................................................................................................2 Lecture Two Mendel and Genes..............................................................................................................................4 Lecture Three Genes and Chromosomes................................................................................................................7 Lecture Four The Search for the Gene—DNA.......................................................................................................9 Lecture Five DNA Structure and Replication.......................................................................................................12 Lecture Six DNA Expression in Proteins..............................................................................................................14 Lecture Seven Genes, Enzymes, and Metabolism.................................................................................................17
  • Article the Effect of Lowering LDL Cholesterol on Vascular

    Article the Effect of Lowering LDL Cholesterol on Vascular

    Article The Effect of Lowering LDL Cholesterol on Vascular Access Patency: Post Hoc Analysis of the Study of Heart and Renal Protection William Herrington, Jonathan Emberson, Natalie Staplin, Lisa Blackwell, Bengt Fellstro¨m, Robert Walker, Adeera Levin, Lai Seong Hooi, Ziad A. Massy, Vladimir Tesar, Christina Reith, Richard Haynes, Colin Baigent, and Martin J. Landray on behalf of the SHARP Investigators Due to the number of contributing authors, Abstract the affiliations are Background and objectives Reducing LDL cholesterol (LDL-C) with statin-based therapy reduces the risk of provided in the major atherosclerotic events among patients with CKD, including dialysis patients, but the effect of lowering Supplemental LDL-C on vascular access patency is unclear. Material. Design, setting, participants, & measurements The Study of Heart and Renal Protection (SHARP) randomized Correspondence: Dr. Martin J. Landray, patients with CKD to 20 mg simvastatin plus 10 mg ezetimibe daily versus matching placebo. This study aimed to Clinical Trial Service explore the effects of treatment on vascular access occlusive events, defined as any access revision procedure, Unit and access thrombosis, removal of an old dialysis access, or formation of new permanent dialysis access. Epidemiological Studies Unit, Nuffield Results Among 2353 SHARP participants who had functioning vascular access at randomization, allocation to Department of Population Health, simvastatin plus ezetimibe resulted in a 13% proportional reduction in vascular access occlusive events (355 Richard Doll Building, [29.7%] for simvastatin/ezetimibe versus 388 [33.5%] for placebo; risk ratio [RR], 0.87; 95% confidence interval Old Road Campus, [95% CI], 0.75 to 1.00; P=0.05).
  • Thesis Submitted in Accordance with the Requirements for the Degree Of

    Thesis Submitted in Accordance with the Requirements for the Degree Of

    Modern Arabic Literary Biography: A study of character portrayal in the works of Egyptian biographers of the first half of the Twentieth Century, with special reference to literary biography BY WAHEED MOHAMED AWAD MOWAFY Thesissubmitted in accordancewith the requirementsfor the degreeof Doctor of Philosophy The University of Leeds The Department of Arabic and Middle Eastern Studies June 1999 I confirm that the work submitt&d is my own and that appropriate credit has been given where referenceshave been made to the work of others ACKNONNILEDGEMENTS During the period of this study I have received support and assistýncefrom a number of people. First I would like to expressmy sincere gratitude and appreciation to my supervisor Dr. A. Shiviiel, who guided me throughout this study with encouragement, patience and support. His generoushelp was always there whenever neededand he undoubtedly easedmy task. I also acknowledgemy indebtednessto the Faculty of Da*ral-ýJlýrn, Cairo University, PP) OW Op 4t or and in particular to Profs. Raja Jabr and al-Tahir Ahmed Makki and Abd al-Sabur 000 SIýZin for inspiring me in my study of Arabic Literature. Next I would like to thank the Egyptian EducationBureau and in particular the Cultural Counsellorsfor their support. I also wish to expressmy gratitudeto Prof Atiyya Amir of Stockholm University, Prof. C Ob 9 Muhammad Abd al-Halim of S. 0. A. S., London University, Prof. lbrlfrim Abd al- C Rahmaonof Ain ShamsUniversity, Dr. Muhammad Slim Makki"and Mr. W. Aziz for 0V their unlimited assistance. 07 Finally, I would like to thank Mr. A. al-Rais for designing the cover of the thesis, Mr.
  • Announcement from the General

    Announcement from the General

    ANNOUNCEMENT FROM THE GENERAL SECRETARIAT OF THE KING FAISAL INTERNATIONAL PRIZE ON THE RESULTS OF THE SELECTION COMMITTEES IN THEIR MEETINGS HELD BETWEEN 11/2/1432H-13/2/1432H CORRESPONDING TO 15/1/2011G-17/1/2011G Riyadh, 17 January 2011 - 13 Safar 1432H, HRH Prince Khalid AI- Faisal, Director of King Faisal Foundation, tonight announced the winners of the King Faisal International Prize. The King Faisal International Prize for Science (Chemistry) for this year 2011 (1432H) has been awarded jointly to: Professor George Whitesides (USA) Harvard University and Professor Richard Zare (USA) Stanford University Professor Whitesides has revolutionized the field of Self Assembly using molecular scale synthesis to control the macroscopic properties of surfaces. This and his work on soft lithography, where he developed practical methods to mold complex patterns on surfaces, are relevant to diverse fields such as molecular electronics, material science and biology. Professor Whitesides has recognized and developed connections between Nano science and biological systems, leading to new paradigms for drug design, which may enable new and inexpensive approaches to bioscience and medical diagnostics. Professor Zare is recognized for his fundamental contribution to the understanding of molecular dynamics and chemical reactions. He developed the extremely sensitive technique of laser induced fluorescence and pioneered its application in many fields ranging from analytical chemistry and molecular biology to astrophysics (composition of interstellar media). The King Faisal International Prize for Medicine (8tem Cell Therapy) for this year 2010 (1432H) has been awarded jointly to: Professor James Alexander Thomson (USA) University of Wisconsin and Professor Shinya Yamanaka (Japan) Kyoto University for their pioneering and seminal stem cell research.
  • The Impact of NMR and MRI

    The Impact of NMR and MRI

    WELLCOME WITNESSES TO TWENTIETH CENTURY MEDICINE _____________________________________________________________________________ MAKING THE HUMAN BODY TRANSPARENT: THE IMPACT OF NUCLEAR MAGNETIC RESONANCE AND MAGNETIC RESONANCE IMAGING _________________________________________________ RESEARCH IN GENERAL PRACTICE __________________________________ DRUGS IN PSYCHIATRIC PRACTICE ______________________ THE MRC COMMON COLD UNIT ____________________________________ WITNESS SEMINAR TRANSCRIPTS EDITED BY: E M TANSEY D A CHRISTIE L A REYNOLDS Volume Two – September 1998 ©The Trustee of the Wellcome Trust, London, 1998 First published by the Wellcome Trust, 1998 Occasional Publication no. 6, 1998 The Wellcome Trust is a registered charity, no. 210183. ISBN 978 186983 539 1 All volumes are freely available online at www.history.qmul.ac.uk/research/modbiomed/wellcome_witnesses/ Please cite as : Tansey E M, Christie D A, Reynolds L A. (eds) (1998) Wellcome Witnesses to Twentieth Century Medicine, vol. 2. London: Wellcome Trust. Key Front cover photographs, L to R from the top: Professor Sir Godfrey Hounsfield, speaking (NMR) Professor Robert Steiner, Professor Sir Martin Wood, Professor Sir Rex Richards (NMR) Dr Alan Broadhurst, Dr David Healy (Psy) Dr James Lovelock, Mrs Betty Porterfield (CCU) Professor Alec Jenner (Psy) Professor David Hannay (GPs) Dr Donna Chaproniere (CCU) Professor Merton Sandler (Psy) Professor George Radda (NMR) Mr Keith (Tom) Thompson (CCU) Back cover photographs, L to R, from the top: Professor Hannah Steinberg, Professor
  • Downloaded From

    Downloaded From

    A Thesis Submitted for the Degree of PhD at the University of Warwick Permanent WRAP URL: http://wrap.warwick.ac.uk/149337 Copyright and reuse: This thesis is made available online and is protected by original copyright. Please scroll down to view the document itself. Please refer to the repository record for this item for information to help you to cite it. Our policy information is available from the repository home page. For more information, please contact the WRAP Team at: [email protected] warwick.ac.uk/lib-publications A Randomized Trial of Neprilysin Inhibition with Sacubitril/valsartan vs Irbesartan in Chronic Kidney Disease by Dr Parminder Kaur Judge Thesis submitted in fulfilment of the requirements for the degree of Doctor of Philosophy (PhD) in Medicine University of Warwick & Medical Research Council Population Health Research Unit, Nuffield Department of Population Health, University of Oxford Submitted June 2020 1 Contents Section Page List of Tables 7 List of Figures 9 Acknowledgements 10 Declarations 12 Inclusion of Published Work 13 Abstract 14 Chapters 1 List of abbreviations 15 2 Introduction 19 3 Natriuretic peptide system and neprilysin 35 2 4 Angiotensin receptor-neprilysin inhibitor (ARNI) 46 Effects on renal function 50 Effects on albuminuria 53 5 Methods 65 Trial organisation 70 Staff training 70 Data management 70 Trial treatments 70 Consent 72 Biological samples 73 Randomized treatment and blinding 76 Blood and urine samples 76 3 Adverse events and compliance with trial treatment 77 Physical measurements