Art Almanac July 2018 $6

John Mawurndjul Amanda Marburg Kristian Laemmle-Ruff Koorie Heritage Trust Inc ‘Gnokan Danna Murra Kor-ki’

Discover the romance, drama and beauty of French painting. Coming exclusively to Ballarat from a major collection in regional France Art Almanac July 2018

Subscribe We acknowledge and pay our respect to the many Aboriginal nations across this land, traditional custodians, Elders past and present; in particular the Established in 1974, we are Australia’s longest running monthly art guide and the single print Guringai people of the Eora Nation where Art Almanac destination for artists, galleries and audiences. has been produced.

Art Almanac publishes 11 issues each year. Imparting insight into that which is Visit our website to sign-up for our free weekly eNewsletter. new, foreign or forgotten is a keystone of contemporary art. From John Mawurndjul’s To subscribe go to artalmanac.com.au crosshatched bark paintings visualising or mymagazines.com.au Kuninjku traditions to Kristian Laemmle- Ruff’s photographic dissection of the Woomera Prohibited Area, the stories in these pages cast new light on our world. Jason Phu and John Young Zerunge excavate the fraught history of Burrangong, while Fabien Deadline for August 2018 issue: Giraud and Raphaël Siboni take us to a distant Friday 29 June, 2018. post-earth future, offeringglimpses into the unfamiliar, unknown and unthinkable.

Contact

Editor – Chloe Mandryk [email protected] Assistant Editor – Elli Walsh [email protected] Deputy Editor – Kirsty Mulholland [email protected] Art Director – Paul Saint National Advertising – Laraine Deer [email protected] Digital Editor – Melissa Pesa [email protected] Editorial Assistant – Penny McCulloch [email protected] Cover Editorial Intern – Soo-Min Shim John Mawurndjul, Ngalyod, c.1981, earth Accounts – Penny McCulloch pigments on stringybark (Eucalyptus [email protected] tetrodonta), 120 x 61.5 x 30cm T 02 9901 6398 Berndt Museum Collection, The University F 02 9901 6116 Locked Bag 5555, St Leonards NSW 1590 of Western Australia, Perth art-almanac.com.au © John Mawurndjul/Licensed by Copyright Agency, 2018 Photograph: Berndt Museum Courtesy the artist and Museum of Contemporary Art Australia 5 Art in Australia News and Books – Art Almanac team 25

John Mawurndjul, I am the old and the new – Jeremy Eccles 34 Fabien Giraud and Raphaël Siboni, The Unmanned, Part Two – Roslyn Helper 37 Amanda Marburg – Naomi Riddle 40 Kristian Laemmle-Ruff, Woomera – Melissa Pesa 43 Jason Phu and John Young Zerunge, The Burrangong Affray – Vanessa Low 48 My Monster: The Human Animal Hybrid – Elli Walsh 50

Select exhibition previews – Art Almanac team 56

Art & Industry Artist Opportunities and Awards 65 Submissions and Proposals 69 Internships and Fellowships 69 Studio Spaces 70 Materials 70 Services 72 Consultants and Valuers 74 Member Organisations 75 Training 75 Publications 76

What’s On Gallery Index 75 Melbourne 84 Victoria 114 Sydney 122 New South Wales 146 Australian Capital Territory 154 Tasmania 158 South Australia 162 Western Australia 166 Northern Territory 170 Queensland 173 Artist Index 182

35 Derby Street Collingwood VIC 3066 PETER WEGNER Open 7 days 10am to 6pm T 03 9417 4303 Condolence [email protected] 27 Drawings australiangalleries.com.au 24 July - 12 August 2018 Member Art Galleries Association of Australia A G Image: #5 2015 USTRALIAN ALLERIES pencil and beeswax 30 x 22 cm MELBOURNE

2018 Geelong contemporary art prize Saturday 9 June to Sunday 19 August Showcasing the best of contemporary Australian painting practice, Exhibition sponsors this $30,000 acquisitive award and biennial exhibition features works by Natasha Bieniek, Seth Birchall, Amber Boardman, Andrew Browne, Dimmick Charitable Jon Campbell, Nancy Constandelia, Yvette Coppersmith, Ann Debono, Trust Troy Emery, Emily Ferretti, Patrick Francis, Nyarapayi Giles, Peter Graham, Camille Hannah, Katherine Hattam, Euan Heng, Gregory Hodge, Carissa Karamarko, Madeleine Kelly, Mason Kimber, Anna Kristensen, Darren McDonald, Laith McGregor, Fiona McMonagle, Amanda Marburg, Sam Martin, Tully Moore, Jan Murray, Louise Paramor, Sally Ross, Huseyin Sami, Andrew Taylor, Kate Tucker, Sharon West, Bradd Westmoreland and Alice Wormald.

Geelong Free entry Fiona McMonagle Gallery Open daily 10am–5pm Princess (detail) 2017 Drop-in tours: Sunday oil on linen Little Malop Street between 2pm–4pm Courtesy of the artist and Geelong 3220 Sophie Gannon Gallery, Melbourne, T +61 3 5229 3645 Hugo Michell Gallery, Adelaide geelonggallery.org.au and Olsen Gallery, Sydney DALE COX

Inner Logic 24 July - 12 August 2018

35 Derby Street Collingwood VIC 3066 Open 7 days 10am to 6pm T 03 9417 4303 [email protected] australiangalleries.com.au Member Art Galleries Association of Australia A USTRALIAN G ALLERIES Image: The wonder of you 2018 acrylic on board 120 x 90 cm MELBOURNE

GAB TITUI

Jimmy K. Thaiday, Ares Lu (detail), 2018. Photo: George Serras, National Museum of Australia

Indigenous Art Award 2018

Showcasing new works by artists throughout the Torres Strait and Northern Peninsula Area of Australia

26 July – 8 September 2018 CAROLINE GIBBES 26 July – 18 August 2018 66 McLachlan Avenue Rushcutters Bay NSW 2011 arthousegallery.com.au [email protected]

Art in Australia

24 m:KHQZHDUHRQ&RXQWU\ZHîRXULVKnLVWKHSUHPLVHEHKLQGWKLV\HDUnVm&DLUQV,QGLJHQRXV$UW Fair’ (CIAF) theme: Connection to Country. Curated by CIAF Artistic Director, Janina Harding, and renowned curator and writer, Hetti Perkins, the three-day event celebrates the vibrant Aboriginal and Torres Strait Islander cultures of far North Queensland through art, crafts, performance and fashion, as well as children’s activities, workshops, artist talks and a symposium held primarily at the Cairns Cruise Liner Terminal from 12 to 15 July. m&,$)nODXQFKHVRQ7KXUVGD\ 12 July at 6.30pm with a Welcome to Country by the Gimuy Walubara Yidinji people followed by the announcement of the CIAF Art Awards winners, who will receive a share of $50,000 across six categories.

Ǥ Ǥ

CIAF Fashion Performance WANDAN (future), 2017 Photograph: Blueclick Photography Courtesy Cairns Indigenous Art Fair, Queensland Perth International Film Festival

Revelation Perth International Film Festival began in 1997 in the basement of Perth’s legendary MD]]YHQXHWKH*UHHQZLFK&OXEZLWKRQHSHUVRQWZRSURMHFWRUVDQGíOPV7RGD\LWLQFOXGHV RYHUFRQWHPSRUDU\LQGHSHQGHQWíOPVSUHVHQWHGDWFLQHPDVJDOOHULHVFDIÂVDQGEDUVDFURVV 3HUWK)URPWR-XO\YLVLWRUVFDQHQMR\$XVWUDOLDQDQGZRUOGSUHPLHUHíOPVRIDOOJHQUHV along with art exhibitions, industry discussions, live performances, masterclasses and more. The IHVWLYDOVHHVRYHUZRUNVVXEPLWWHGIRUVHOHFWLRQIURPORFDODQGLQWHUQDWLRQDOíOPPDNHUVZLWK strong experimental and documentary representations.

$QRQSURíWRUJDQLVDWLRQm5HYHODWLRQn maintains an ethical partnership agenda and has a strong social justice program. It uses íOPDVDEDFNGURSIRUZLGHUFRQYHUVDWLRQ DERXWmFLQHPDLGHDVSROLWLFVSHUVRQDOLW\ history, access and equity’.

ϐǤ

Betty – They Say I’m DifferentGLUHFWHGE\3KLO&R[íOPVWLOO Courtesy Native Voice Films Ltd (UK), La Compagnie des Taxi Brousse (FR), Arte France (FR) and Revelation Perth International Film Festival

25 Ryoji Ikeda presents micro / macro Installations by Japanese electronic composer and visual artist, Ryoji Ikeda, will be on show free to the public at Carriageworks in Sydney from 5 to 29 July, 10am to 6pm. Two monumental- sized works created during a residency at Switzerland’s CERN, the European Organisation for Nuclear Research, explore the intersection between art and science. Ikeda draws understanding from, and invites an introspective look at the universe bringing what is beyond our reachable limits into our own experiential sphere. the planck universe [micro] depicts the minute elements RIQDWXUHDPSOLíHGWRKXPDQVFDOHZKLOHDWHQPHWUHKLJKSURMHFWLRQZDOOKRVWLQJthe planck universe [macro] portrays nature scanned from human into cosmological scale. Ikeda presents an elaborate and immersive encounter with the outer limits of the cosmos.

Ǥ Ǥ

Ryoji Ikeda, the planck universe [macro], 2015 Photograph: Martin Wagenhan Courtesy the artist, ZKM Karlsruhe, Germany and Carriageworks, Sydney Tribal Art Fair Cell Block Hall in the grounds of National Art School 1$6 6\GQH\LVWKHYHQXHIRUWKHm7ULEDO$UW Fair’ on Saturday 21 July, from 9am to 5pm. Presented by the Oceanic Art Society (OAS) it will feature a large collection of both traditional and contemporary art and objects, including masks, carvings, bilum bags, pottery, tapa and paintings from Melanesia, Micronesia, Polynesia and Australasia, Asia and Africa. The fair will bring collectors and the public together with society members who are experienced in Oceanic artefacts and artworks. A silent auction will entice visitors with the opportunity to purchase works.

OAS aims to promote, foster and encourage a universal interest and understanding of primitive art and culture from the Oceania region.

ǤǤ

Dance Mask, Malekula Island, Vanuatu, 48 x 45cm German collection, early 20th Century Courtesy Oceanic Art Society, New South Wales 26 Melbourne Art Fair

7KLV\HDUnVm0HOERXUQH$UW)DLUn (MAF) presents a curated selection of works by some of the most exciting established and emerging artists from 40 leading galleries across Australia, New Zealand and Southeast Asia. The Fair will take place from 2 to 5 August in a temporary structure in the Southbank Arts Precinct and alongside the Australian Centre for Contemporary Art (ACCA).

$VWKHîDJVKLSHYHQWRIWKHELHQQLDO m0HOERXUQH$UW:HHNn-XO\WR August – produced by Melbourne Art Foundation – MAF has partnered with over 50 galleries and institutions with a colourful calendar of talks, tours, events and performances celebrating contemporary art and encouraging discourse. Philip Tinari, Director of Beijing’s Ullens Center for Contemporary Art (UCCA), will deliver the Melbourne Art Week Keynote on Tuesday 31 July at Deakin Edge, Federation Square.

0$)nVPDLQVKRZVHFWRUm*DOOHULHVn comprises solo presentations and thematised group shows by contemporary practitioners from a VHOHFWLYHJURXSRIHVWDEOLVKHGJDOOHULHVZKLOHm$FFHQWnLQWURGXFHVWKH$XVWUDODVLDQDUWZRUOGWR HPHUJLQJDUWLVWVRIDQ\DJH$QHZSURSRVDOEDVHGSODWIRUPm7LPHnVKRZFDVHVíYHWLPHEDVHG ZRUNVLQFOXGLQJPRYLQJLPDJHVRXQGDQGSHUIRUPDQFHDUWDFURVVíYH0HOERXUQHORFDWLRQV ([SHULPHQWDODUWLVUHSUHVHQWHGYLD7KH3URMHFW5RRPVrDQRQSURíWSODWIRUPIRUFXWWLQJHGJH art spaces – featuring presentations from the Institute of Modern Art, Brisbane, The Physics Room, Christchurch, Gertrude Contemporary, Melbourne and Blak Dot Gallery, Melbourne. Additionally, the 2018 Melbourne Art Foundation Commission recipient Ronnie van Hout will unveil his ambitious large-scale work at MAF.

The Collector First View and opening night Vernissage will take place on Wednesday 1 August.

Ǥ Ǥ

Hiromi Tango, Lizard Tail (Dawn), a Melbourne Art Week Commission Commissioned by Melbourne Art Foundation and MLC Life Insurance Photograph: Michaela Dutková Courtesy the artist, Sullivan+Strumpf, Sydney and Melbourne Art Foundation, Victoria

27 ǣ My Horizon Edited by Natalie King Thames & Hudson

m0\IDQWDV\LVLQP\VWUDQJHEUDLQnr7UDFH\ Moffatt

Published to accompany her exhibition as the Australian representative at the 2017 m9HQLFH%LHQQDOHnWKLVLVWKHíUVWERRNRQ Tracey Moffatt in ten years. Colour images RI0RIIDWWnVVW\OLVHGSKRWRJUDSKVDQGíOPV across 160 pages accompany essays and interviews by Germano Celant, Adrian Martin, Moira Roth, Susan Bright, Djon Mundine, Alexis Wright, and Romaine Moreton, celebrating one of Australia’s most renowned artists and her unique politico-personal engagement with the language of cinema.

Michael Zavros Manuscript in association with Philip Bacon Galleries and Starkwhite

m=DYURVLVDQDHVWKHWHKHSDLQWVEHDXWLIXO things beautifully.’ – Robert Leonard

7KLVPRQRJUDSKVLPSO\WLWOHGm0LFKDHO Zavros’, showcases the artist’s broad practice – from hyper-realistic paintings, photography DQGVFXOSWXUHWRíOPDQGSHUIRUPDQFHrZLWK over 120 images of still life arrangements, self- portraits, Greek mythology, men’s fashion, and gilded interior design. Essays by Robert Leonard, Laurence Simmons and Chris Saines as well as interviews with the artist by Rhana Devenport and Beatrice Page shed light on the methods and ideas behind Zavros’s ZRUNVXSSRUWHGE\îRDWLQJFLWDWLRQVIURP Sebastian Smee’s comparison of the artist’s paint technique to the obsessive hair brushing in F. Scott Fitzerald’s Tender is the Night, to =DYURVGHVFULELQJKLVZRUNDVmQDUFLVVLVPnDQG OLNHQLQJGHSLFWLRQVRIKLVGDXJKWHUWRmVHOI portraits’.

28 Archie Moore 1970-2018 Edited by Linda Michael and Hilary Dickson

A ϐ concise monograph accompanying the H[KLELWLRQm$UFKLH0RRUHnDW *ULIíWK8QLYHUVLW\$UW0XVHXPZKLFK showcased a newly-commissioned work exploring personal and transgenerational memory. Featuring a preface and essay by &XUDWRU$QJHOD*RGGDUGDm:HOFRPHnE\ Moore, essay by Dr Toni Ross and interview with the artist by Steve Dow, the book charts 0RRUHnVmFRQVWDQWDWWHQWLRQWRWKHMXQFWXUHV between Indigenous and non-Indigenous VXEMHFWLYLW\nDQGKLVIRFXVRQWKHmHPRWLYH and disorienting potential of objects and architectural spaces as markers of place and identity.’ Colour images of the vast multi-room installation visualise the artist’s sensitive engagement with materiality and memory.

Votive

Perimeter Editions $GDP/HHSUHVHQWVm9RWLYHnrDVDQH[SUHVVLRQ DQGHYRFDWLRQRIIDLWKrKLVíUVWPDMRUDUW publication showcasing works from three exhibitions in Toronto, Melbourne and London. From the deep and luminous blues in 7UDQVíJXUDWLRQ (2016) veiling the cover to the vibrant artworks displayed throughout, the book offers a visual journey exploring faith, spirituality and hope. Drawn from personal relationships and historical, mythological and literary references, Lee’s paintings cross the boundaries from the seemingly familiar to new and otherworldly existence.

Accompanied by Dan Rule’s introduction, Jack Willet’s essay and a conversation between the DUWLVWDQG.LP'RUODQGm9RWLYHnGHOLYHUVDQ insightful understanding of Lee’s inspirations, approach and processes of his painterly practice.

29 Image: Natalie Rosin | NSW

BOAA will be the largest showcase

of Australian Art ever presented:

> 150+ artists

> 65 curated solo exhibitions

BALLARAT 21 Sep - 6 Nov 2018 www.boaa.net.au/tickets

ON SITE LABORATORY SERVICES Really Don’t Wanna Go To This Funeral MatthewWare M.33

A limited edition of 100, this book presents photographs byMelbourne artist Matthew :DUH WRJHWKHU ZLWK VFUHHQVKRWV RI mVWUDQJH and sad moments’ from other people’s Snapchats. Colour images coupled with VSRUDGLF WH[W LQFOXGLQJ m:KR FDQ , WDON WRn DQG m:DQQD NLVV P\VHOI ,nP VR SUHWW\n VNHWFKD tragicomic portraitof contemporary Western society, canvassing issues like race, gender, mental health, vanity, loneliness, family and GHDWK 7KH ERRN mVXPV XS ZKDW LW LV WR EH alive these days; in which half the time you’re looking around and trying to take care of sh*t, and the other half you’re staring at your SKRQHnUHîHFWV0D[ 2OLM\QNLQWKHDIWHUZRUG

ǣ Gosia Wlodarczak Longin Sarnecki

D rawing is ǯ often a starting point for an artist, but for Polish-born Gosia Wlodarczak this method of inscription is central to her trans-disciplinary practice. A limited edition RI m'(=()5(//(n PDSV :ORGDUF]DNnV output from 2004 to 2017, which traverses performance, interaction, installation, sound DQG íOP VWDJHG RXWVLGH WKH VWXGLR LQFOXGLQJ D VHULHV EDVHG LQ ORFDO FDIÂV DQG D SDUN EHQFK near the artist’s Melbourne home. Over 100 images and typographic illustrations reveal the ways Wlodarczak engages her body as a vehicle, transferring visual signals from the H\H GLUHFWO\ WR WKH SDSHU 6KH UHîHFWV m, GUDZ my environment as I see it, in real time – tracing and re-tracing the visible. My intention is to record present continuous time to archive my space-time.’

I am the old and the new

Jeremy Eccles

m,DPWKHROGDQGWKHQHZn:KDWDPDUYHOORXVO\ELEOLFDOVWDWHPHQWE\WKH:HVWHUQ$UQKHP/DQG artist, John Mawurndjul. He made it boldly in accepting this year’s male Red Ochre Award at the Sydney Opera House in May, and the once-shaggy bushman – who lives 50 kilometres from the township of Maningrida on his own Milmilngkan outstation, hunting, caring for his Country and SDLQWLQJrKDGDQHZFRQíGHQFHLQKLVKDQGLQSRFNHWVWDQFHQHDWO\WULPPHGKDLUDQGEHDUGLQ response to this important recognition by his peers.

%XWWKHTXRWHLVDOVRWKHWLWOHRIKLVVHFRQGLQVWLWXWLRQDOVRORVKRZrWKHíUVWZDVDW%DVHOnV Museum Tinguely in 2005 – at the Museum of Contemporary Art Australia (MCA). This is co- curated with the Art Gallery of South Australia (AGSA), where it will be staged in October before a slightly reduced version of the 165-work exhibition tours the country until the end of 2020.

The presentation is also co-curated with the artist himself. MCA Curator Clothilde Bullen FRPPHQWVm+HnVMXVWVRFKDULVPDWLFDQGNQHZSUHFLVHO\ZKLFKRIKLVEDELHVZHUHLPSRUWDQWDQG ZKLFKOHVVLPSRUWDQWm7KLVRQHVXFKDJRRGRQHnKHnGDQQRXQFH$QGRXUH[KLELWLRQZLOOEHIXOO\ bilingual, thanks to the heroic efforts of translator Murray Garde.’

m:HnOOEHORRNLQJDW\HDUVRI0DZXUQGMXOnVSUDFWLFHn%XOOHQFRQWLQXHVQRWLQJWKHVKLIWVDFURVV that time. He studied the ancients like Yirawala and Midjawmidjaw, but was taught to paint by his uncle Peter Marralwanga and elder brother Jimmy Njiminjuma. His early works – seen LQWKHODQGPDUNm0DJLFLHQVGHOD7HUUHnH[KLELWLRQLQ3DULVLQrZHUHPDLQO\íJXUDWLYH UHSUHVHQWDWLRQVRIP\WKLFíJXUHVOLNHIHPDOHYawkyawk water-hole spirits or Mawarrmulmul, the VKRRWLQJVWDUVSLULW7KHQKHFDUYHGVFXOSWXUDOíJXUHVDQGlorrkonsDGGLQJWKHíQHVWOLQHV RIFURVVKDWFKLQJIRUWKHíUVWWLPHLQ.XQZLQMNXDUWnm,FKDQJHGWKHODZP\VHOIn0DZXUQGMXO once boasted.

m)LQDOO\nFRQFOXGHV%XOOHQmDVKLVNQRZOHGJHRIFHUHPRQLDOPDWWHUVJUHZKHnVFRQFHQWUDWHG on the Mardayin ceremonies that are the foundation of Kuninjku law and culture. These works appear abstract to us, because he can only show the public aspects of the ceremony.’ But 0DZXUQGMDOSRLQWVRXWWKDWWKHUHDUHmLQVLGHnPDWWHUVWRRIRULQLWLDWHVm7KHdangarrk lights in the water give off a blue colour at night in the waterholes at Mardayin sites. This is Mardayin – the glowing of the lights is the spirit essence of the ceremony. I saw these lights glowing at night. I put the experience in my head and went and collected bark, scraped it down, and then painted the same thing I had seen in cross-hatched form.’

34 Former Art Gallery of New South Wales Curator Hetti Perkins describes Mawurndjal’s SURFHVVDVmDNLQGRIDOFKHP\ The essence of the original is there in the new – which shines DQGJORZVn7KLVLVDPSOLíHGLQ the words of the artist himself: m7KURXJKVRPHVRUWRIPDJLF, am a chemist man myself. I am the Number One chemist man.’ He is also the senior djunkay, or ceremonial manager, for the Mardayin ceremony – which is rarely performed these days. He is keeping it alive through his art.

It’s not all been plain sailing, though, for this great artist. In 1998, his work was rejected DWWKH.ROQ$UW)DLUDVmIRON art’ – which must have made his 2003 victory in Australia’s Clemenger Contemporary Art Prize all the more satisfying. And Melbourne Professor Jon Altman, who has spent much time in Kuninjku Country with Mawurndjul, believes that the DUWLVWKDVmTXLWHFRQVFLRXVO\ scrambled the generations of rock art in his Country to íQGDQDHVWKHWLFWKDWSOHDVHV the Western eye.’ Not that this helped when the Global Financial Crisis cut sales from Indigenous art centres nationally by 50% between 2008 and 2011. And then there was the Intervention, which replaced the management of Maningrida’s Bawinanga

35 Aboriginal Corporation, which owns the Art Centre, with people so inexperienced that funds were denied to it to post paintings out of Arnhem Land. Meanwhile the Community Development Employment Program, which gave art centre and outstation workers a basic LQFRPHZDVmGHPRQLVHGDQGGHPROLVKHGn according to Altman.

Ceasing to have an art income, a dispirited Mawurndjul ceased to paint. This internationally recognised super-star could no longer afford to access his outstation, moved into a Maningrida town camp and looked for a job as a tyre-repairer. In 2015, Mawurndjul DGPLWWHGWKDWKHnGmWDNHQDEUHDNnIURPEDUN SDLQWLQJDQGmLWPD\EHVRPHWLPHEHIRUH,JR back to it.’

Fortunately, he has – winning the 2016 Best Bark in the National Aboriginal and Torres Strait Islander Art Awards (NATSIAA) and completing two major commissions for the MCA and AGSA. Mind you, the now-66 year old Johnny Mawurndjul did tell the Red Ochre audience that his visit to open the MCA show RQ-XO\mPD\EHWKHODVWWLPH,OHDYHP\ Kuninjku Country.’

m,DPWKHROGDQGWKHQHZnZLOOEHWRXULQJ nationally on conclusion at the MCA.

Jeremy Eccles is a specialist arts commentator who has been writing, broadcasting and íOPPDNLQJLQ$XVWUDOLDVLQFHZLWKD special interest in Indigenous culture.

6 July to 23 September, 2018 Sydney

River Whale Shark, 1989, ochre on wood, 19.5 x 233 x 23cm Australian National Maritime Museum collection, Sydney © John Mawurndjul. Licensed by Copyright Agency, 2018

Ancestral spirit beings collecting honeyRFKUHVRQ6WULQJ\EDUN (XFDO\SWXVWHWURGRQWD KDQGVSXQEDUNíEUHVWULQJ[[FP 0XVHXPRI&RQWHPSRUDU\$UW$XVWUDOLDDQG0DQLQJULGD$UWV &XOWXUHZLWKíQDQFLDODVVLVWDQFHIURPWKH$ERULJLQDODQG7RUUHV6WUDLW Islander Board of the Australia Council, 1994 © John Mawurndjul. Licensed by Viscopy, 2017

Milmilngkan, 2008, earth pigments on Stringybark (Eucalyptus tetrodonta), 171 x 71cm Art Gallery of South Australia, Adelaide, Gift of the Santos Community Fund, 2009 © John Mawurndjul. Licensed by Copyright Agency, 2018 Photograph: Saul Steed

Courtesy the artist and Museum of Contemporary Art Australia, Sydney

36 Fabien Giraud and Raphaël Siboni Part Two

Roslyn Helper

Is it possible to tell the story of human cultural evolution in a way that is separate to the interests ofǡ the teller? What happens if we look at ourselves through the lens of history as artefacts, or products of technological evolution, rather than as human? These are the central questions posed E\)UHQFKFROODERUDWLYHGXR)DELHQ*LUDXGDQG5DSKDÄO6LERQLLQWKHLUHSLFIRXU\HDUSURMHFWm7KH Unmanned’.

7KHSURMHFWLVGLYLGHGLQWRWKUHHSDUWVFDOOHGmVHDVRQVnRQO\WKHíUVWRIZKLFKKDVEHHQFRPSOHWHG VRIDU([KLELWHGDWWKH0XVHXPRI2OGDQG1HZ$UW 0RQD IURP)HEUXDU\WKLV\HDUWKLVíUVW VHDVRQFRPSULVHGHLJKWKDXQWLQJíOPVGHSLFWLQJNH\KLVWRULFDO DQGVSHFXODWLYHIXWXUH PRPHQWV each powerfully demonstrating the radical impacts computation has had on our social and political evolution.

3UHVHQWHGLQUHYHUVHFKURQRORJLFDORUGHUWKHíUVWíOPVSHFXODWHVWKHmGHDWKnRI$PHULFDQ computer scientist Ray Kurzweil in the year 2045, which is the year he has famously predicted WKDWWKH6LQJXODULW\ZLOOEHERUQ6KRWHQWLUHO\ZLWKGURQHVLQDOXVKUDLQIRUHVWWKHíOPRYHUîRZV with anticipation as we stand on the threshold of an emerging technological world. Contrastingly, WKHVL[WKíOPLQWKHVHULHVLVVHWFHQWXULHVHDUOLHULQDQGFHQWUHVDURXQGWKHHVFDSHDQG

37 death of a bishop and his court in a forest during the íUVWPDMRURXWEUHDNRIWKH Black Plague, which was said DWWKHWLPHWREHmERUQRIWKH hair in comets’. The return of the comet in 1759 validated the computational prediction of British astronomer and mathematician Edmond Halley.

Mona is hosting the genesis of the project’s second season, WLWOHGm7KH(YHUWHG&DSLWDOn Filmed in June as a live- edited, live-broadcast, 24-hour performance staged within the walls of the museum, the work takes us to the year 7231, an obscure reference to an essay published in the 18th century comparing and contrasting different theological methods for measuring time. Here we are introduced to a community living on a Dyson sphere, a hypothetical megastructure built from the material of dismantled planets (including Earth), that completely surrounds a sun in order to capture and harness its energy. The sun is posited here as the single most valuable commodity, emphasised by its journey towards extinction as it cools. As the work unfolds, members of the community attempt WRUHPHPEHUZKDW(DUWKFRXOGKDYHEHHQ7KHíOPDUFKLYHRIWKHSHUIRUPDQFHLVLQVWDOOHGLQ the museum.

3UHVHQWHGDORQJVLGHWKHíOPLVDVHULHVRIVFXOSWXUHV*LUDXGDQG6LERQLKDYHXVHGFXVWRP EXLOWDUWLíFLDOLQWHOOLJHQFHWHFKQRORJ\WRFDWHJRULVHDFROOHFWLRQRIKLVWRULFDOEODGHVDUFKLYHGE\ anthropologist and archaeologist Augustus Pitt Rivers. The technology taxonomises each blade, WU\LQJWRSUHGLFWLWVSDVWOLIHDQGWRXOWLPDWHO\FRPSXWHWKHXQDWWDLQDEOHIRUPRIWKHíUVWEODGH The proposed designs will be made by craftspeople and exhibited in the museum. Blades are VLJQLíFDQWLQWKHDUWLVWVnZRUNWKHSURORJXHíOPLQ6HDVRQGHSLFWVDEODGHFXWWLQJWKURXJK PHWDOmíOPHGDWWKHVFDOHRIDIROGRIPDWWHUn7KHEODGHLVWKHVWDUWLQJSRLQWDQGUHSUHVHQWVWKH íUVWWHFKQRORJLFDOmWUDXPDnWKDWVHYHUHGKXPDQVIURPRXUHQYLURQPHQW

7RFRPHEDFNWRWKHDUWLVWVnFHQWUDOTXHVWLRQm,VLWSRVVLEOHWRWHOOWKHVWRU\RIKXPDQFXOWXUDO evolution in a way that is separate to the interests of the teller?’ Postcolonial political discourse ZRXOGKDYHXVXWWHUDíUPm1Rn7KLVLVSODLQO\LOOXVWUDWHGLQWKHDUWLVWVnRYHUZKHOPLQJO\:HVWHUQ UHIHUHQFHVWRWKHRORJLFDOVFLHQWLíFDQGQDWXUDOKLVWRU\DQGWKHLUUHVXOWLQJVSHFXODWLRQVRI

38 computation and automation. However, Giraud and Siboni do provide thought-provoking material for considering that a radical retelling of human history might be possible, albeit with other interests or constraints at play, when told by a non-human entity. In fact, it might just be ZKDWZHQHHGWRVHHRXUVHOYHVSURSHUO\IRUWKHíUVWWLPH

Roslyn Helper is an artist, curator and writer based in Sydney.

Until 4 February, 2019 Tasmania

1759 – Mil troi cens quarante huyt The Unmanned Season 1, Episode 6, HD Video, 26 min, 2017

1997 – The Brute Force The Unmanned Season 1, Episode 2, HD Video, 26 min, 2014

39 Naomi Riddle

In Amanda Marburg’s painting Death and the Goose Boy DQRYHUVL]HGJRRVHíJXUHZDONV across rocky terrain, set against a deep blue background. A single beady eye perched atop an angular orange beak stares out at the viewer as two human legs protrude from its neck – supplanting torso and arms. It’s a surreal dreamscape with the feel of a dark Grimm fairy-tale, but there’s something else to be be found in the rendering of this scene. The construction of the anthropomorphic bird is almost cartoonish, with the entire landscape painted in such a way that it feels like it has the consistency of Play-Doh. You’re drawn to the tactility of this uncanny diorama – a strange sense of softness presented in two-dimensional form.

Underlying Marburg’s artistic practice is a process of distancing. Firstly, she sorts through photographs, footage and found objects – stills from movies and archives, or references to the landscape around her home and studio in Melbourne. Such source material is used to fashion a series of brightly coloured three-dimensional plasticine models, which are then photographed DJDLQVWDVWXGLREDFNGURS,QDíQDOPRYHWKHVHLPDJHVDUHSDLQVWDNLQJO\UHFUHDWHGLQRLORQ canvas: sculptural forms distilled in paint.

40 6XFKDOHQJWK\SURFHVVLPSOLHVWKDWWKHíQDOSDLQWLQJH[LVWVDVWKHGRFXPHQWDWLRQRIDFRQFHDOHG durational performance. Each new stage of Marburg’s process creates a temporal gap; it becomes the interpretation of the interpretation of the interpretation, with the initial reference point VOLSSLQJDZD\0DUEXUJLVHQJDJLQJLQDNLQGRIîDWWHQLQJDUHGXFWLRQRUGLVWLOODWLRQRIWKH FRPSOH[LPDJHDQGLWnVLQWKLVDFWRIîDWWHQLQJWKDWWKHSRWHQF\RIDQRWKHUZRUOGO\VFHQHFRPHV to the fore. There’s humour at work here too, a sense of irreverence and play in combining the domestic, infantile feel of plasticine with the revered tradition of oil painting.

For her latest exhibition at Sutton Gallery, Marburg continues to engage with sculpture and painting in a series of works generated from plasticine models. The show references an eclectic group of ideas – dogs, the landscape of Hanging Rock and pictures of the scenes of true crime – but the consistency of Marburg’s process, and the whimsical nature of the compositions, brings these disparate themes together. In this instance, it is the dog that acts as the central unifying image.

Marburg often employs animal imagery, whether that be roosters, geese, crows or mice, and here the dog brings with it multiple symbolic meanings: loyal, hard working, sweet and companionable, but when viewed as a pack, potentially threatening and vicious (think of the

41 PDQ\SROLWLFLDQVZKRUHIHUWRWKHLUPHGLDVSRNHVSHRSOHDVmDWWDFNGRJVn 5HFHQWO\DQXPEHURI artists and writers have drawn on personal relationships with their pet canines to think through LGHDVRIWUDXPDJULHIDQGPHPRU\VXFKDV/DXULH$QGHUVRQnVGRFXPHQWDU\íOPHeart of a Dog DQG(LOHHQ0\OHVnmGRJPHPRLUnAfterglow (2017). Marburg is referencing this particular tradition of repositioning ourselves in the minds of animals, bringing it in line with her own sense of play and wonder to forge a less human-centric vision of the world.

Naomi Riddle is a Sydney-based writer and artist.

Sutton Gallery Until 28 July, 2018 Melbourne

Waterdog I, 2018, oil on board, 26 x 44.5cm

Death and the Goose Boy, 2015, oil on linen, 90 x 125cm

Hans My Hedgehog, 2016, oil on linen, 61 x 82cm

Courtesy the artist and Sutton Gallery, Melbourne

42 Kristian Laemmle-Ruff Woomera

Melissa Pesa

Over the past 70 years, many have heeded the warnings posted along the perimeters of the Woomera Prohibited Area (WPA), the largest and most technologically advanced weapons testing range in the world. However, with restriction comes curiosity. In ‘Woomera’, Kristian Laemmle- 5XIIVKHGVOLJKWRQWKLVTXHVWLRQDEOHDQGKLJKO\FRQíGHQWLDOSODFH

The core of your practice lies in the ‘investigation of contemporary sites of colonialism and militarism in Australia’. What drew you to Woomera? I feel a calling to explore these places partly because of how little they are talked about in mainstream culture. The fact that defence areas are remote, highly secretive and restricted PHDQVWKDWDYRLGH[LVWVDURXQGWKHP,WLVLQWKHVHmRIIOLPLWVnVSDFHVZKHUH,íQGRSSRUWXQLW\ to start a conversation and create awareness. I want my work to be part of a greater dialogue around learning our true history. I think it’s important as a nation to choose understanding over ignorance. Art can help us make this choice. The subtext underlying much of my work is encouraging people to question the role these military facilities have in our society. Who do they really serve? What impact do they continue to have on people and ecology? How could we transform these spaces to support life and future generations rather than the ‘progress’ of military corporations and empire?

What were you hoping to capture, and what was the result? Inside the WPA I found surprising tranquility and beauty: rolling red sand dunes, brilliant salt-lakes mirroring open skies, mobs of emus roaming through Mulga scrub. However, all of

43 44 a sudden, aggressive signs of military occupancy imposed themselves on the land – weapon launching facilities, abandoned satellite dishes, observation towers, storage sheds and bunkers. I was hoping to capture places like this; places that show the secretive ongoing military activity. 7KHUHZDVFHUWDLQO\DQHOHPHQWRIVKRFNDQGIHDULQGLVFRYHULQJVLJQVOLNHm5DGLDWLRQ+D]DUG Ahead’. Given my short window of opportunity to be inside this area I only scratched the surface of what’s really going on.

7KURXJKSXWWLQJm:RRPHUDnWRJHWKHU,KDGWKHRSSRUWXQLW\WRVSHQGWLPHZLWK.RNDWKDDQG other First Nations people around the Woomera area. Hearing stories about the missiles, bombs, radiation fall out and deaths further motivated me to develop and share this work. The exhibition includes an interview with Kokatha elder and activist Aunty Sue Coleman-Haseldine. The title of this sound piece is Munda Yumadoo IligaPHDQLQJmOHDYHWKHODQGDVLWLVn

What preparation and processes were involved? 7KLVERG\RIZRUNUHTXLUHGVLJQLíFDQWUHVHDUFKDQGULVN%HLQJLQDQDFWLYHZHDSRQVWHVWLQJ range I did not want to go there ill prepared. Google Maps made navigation and research of VSHFLíFDUHDVSRVVLEOHDQGWKH'HSDUWPHQWRI'HIHQFHnVZHEVLWHZDVDOVRKHOSIXOLQJDLQLQJYLWDO information on when and where activities would occur. Knowing when certain areas of the WPA had active testing was absolutely critical – only a few weeks after I travelled through the WPA there were reports of a huge explosion at Lake Hart, close to the area where I was camping. I also had to be prepared for the potential consequence of being caught and arrested.

While I had ideas of what to capture before arriving, I needed to remain open-minded to the experience of actually being there. All the imagery for Woomera came together in a matter of three or four days. Having prepared as much as I could, it was now about being present. Days were spent GULYLQJH[SORULQJE\IRRWSKRWRJUDSKLQJDQGFROOHFWLQJZKLOHHYHQLQJVLQYROYHGVHWWLQJXSîDVK and laser lighting on the salt lakes.

What other elements have you included in this series in addition to photography? Laser technology is utilised in weapon systems so I wanted to incorporate laser into my work to suggest the presence of military activity on the land. Photographs of salt lakes captured at night are segmented by a crisscross of red laser lines, which mimic the trajectories of the rockets through the sky and explosions scarring the land. They reference military violence – the colour red V\PEROLVLQJZDUQLQJDQGWKUHDW/DVHUVDUHDOVRSDUWRIWKHH[KLELWLRQGHVLJQFUHDWLQJm;nSDWWHUQV in the gallery space. The black walls behind the works help suggest the secrecy that surrounds Woomera.

There are several signs from the Woomera area included in the exhibition, displaying warnings OLNHm/LYH%RPEV/DVHU+D]DUG%HZDUHnDQGm5RDG&ORVHGr/LYH)LULQJV,Q3URJUHVVn7KHVHVLJQV in combination with the large light-boxes, lasers, bold colour palette and sound recordings of Kokatha people, aim to create an immersive experience. I want the audience to walk into the gallery space and experience the work with a sense of unease and danger.

Araluen Arts Centre ͳ͵ ͳͻǡʹͲͳͺ Northern Territory

Aerial, 2017, digital prints in light-box with red aluminum frame, 110 x 125 x 7cm

Nurrungar, 2017, C-type print in red frame, 85 x 65 x 3cm

Evetts Field I, 2017, C-type print in red frame, 85 x 65 x 3cm

Courtesy the artist and Araluen Arts Centre, Northern Territory

Jason Phu &

Vanessa Low m7KHQDPLQJRIWKHVKRZZDVWKHKDUGHVWSDUWnVD\V$&HQWUHIRU&RQWHPSRUDU\$VLDQ$UW $ Director Mikala Tai. How do you scrutinise one of Australia’s largest racial riots without shutting down conversation? How do you delve into a history so deep, so painful, in a way that is productive and contemporaneous?

m7KH%XUUDQJRQJ$IIUD\nEULQJVWRJHWKHUWZRFRQWUDVWLQJ&KLQHVH$XVWUDOLDQDUWLVWVWKHLU disparate practices shown side by side to create a robust dialogue around history, memory and racism. Over the past 15 months, artists John Young Zerunge and Jason Phu, along with Tai and Curator Micheal Do, have visited Burrangong so many times that they invariably wave to people as they walk down the street. In a humble way, they have taken on the hugeness of Australia’s anti- &KLQHVHKLVWRU\WKURXJKSHUVRQDOFRPPXQLW\FRQVXOWDWLRQH[WHQVLYHíHOGZRUNDQGHPSDWK\

Between 1860-1861, Burrangong, a gold mining town near Young in New South Wales, was the bursting point of racial tensions between Chinese and European miners. Trivial agitation against the Chinese foreigners – at how they dressed, smoked opium, and had different mining practices rIHUPHQWHGLQWRYLROHQFHm5ROOXSUROOXSQR&KLQHVHnGHFODUHGDQRZLQIDPRXVEDQQHU Chinese migrants were subjected to threats, scalpings, beatings and the burning down of their WHQWVFXOPLQDWLQJLQZKDWLVQRZNQRZQDVWKHm/DPELQJ)ODW5LRWVn

And yet – surprisingly – most of us may have never heard of Burrangong. I myself, descended from 19th century Chinese gold miners, had to research it from scratch. Perhaps this is because the area of Lambing Flat was renamed Young following the events, or because the soon-to-follow White Australia Policy sealed the racial hierarchy and barely any Chinese people have lived in the area since.

The desire to review this complex history has been on the agenda of 4A Directors and artists for almost a decade. And despite occurring over 150 years ago, the malice and trauma imbued in this past are uncannily similar to our current polarising discourse around migration, refugees and nationalism. Tai and Do consciously reiterate the need to assess their stake in enlivening this fraught history. Besides enriching Asian Australian cultural literacy at large, they have focused on what this means for the residents in Young – meeting with local historians who have shared their research and knowledge, whilst also consulting historian Dr Karen Schamberger, who wrote her WKHVLVRQWKHDIRUHPHQWLRQHGm5ROOXSnEDQQHU

In April this year, the artists started the project with a Community Offering. Inviting the local Young residents to the Chinese Cemetery and Blackguard Gully (the key location of the Lambing Flat Riots), they burned incense and made peace offerings as a tribute to the sites and the memories they hold. Amongst the landscape pot marked from mining, Young Zerunge covered himself in earth and a blanket, symbolising the need for mourning and comfort. In contrast, Phu EUDLGHGWKHZRUGmTXHXHnLQURSHDQGVHWLWDOLJKWRQWKHVLWHZKHUHDPDQQDPHG-DPHV5REHUWV KDGSURYLGHGVKHOWHUIRUDPXOWLWXGHRIîHHLQJ&KLQHVH

48 It is curious to compare the works by Young Zerunge and Phu in this exhibition, both artists responding to the potent history of Burrangong in their own way. Young Zerunge, a co-founder of 4A, presents an array of 27 history paintings, careful layers of images, documents, and newspaper articles evoking a complex narrative. In contrast, Phu’s works are more candid and experimental – video journals, freehand illustrations, and an Instagram handle @titsmcgee66. In the exhibition, 3KXnVDUWZRUNVRQWKHJURXQGîRRULQYLWH people into the journey of the Burrangong landscape, guiding us through where the Chinese miners would have lived. It’s also evident that the artists have each organically LQîXHQFHGWKHRWKHUnVSUDFWLFHmDPHOGLQJn as Do describes. Young Zerunge, whose career as a painter is well established, has FUHDWHGKLVYHU\íUVWYLGHRDUWZRUNIRUWKLV show. And Phu, picking up some of his mentor’s seriousness, has created two scroll works that hang upstairs.

Whilst the history of the Burrangong Affray is traumatic at its core, it is evident that the project is surrounded by warmth. The artists, paired with Do and Tai, have become a team of friends. 7KH\nYHVSHQWKRXUVRQWKHURDGWRJHWKHUmDORWRIWLPHLQWKHFDUGHEDWLQJZKDWZHnUHJRLQJWR order at the McDonald’s drive through 100kms away,’ Tai reminisces. They’ve even won a meat tray together.

Once the exhibition closes, the next chapter of the project will be a publication and a public PRQXPHQWLQ

Vanessa Low is a Sydney-based writer.

Ͷ Contemporary Asian Art ͳʹǡʹͲͳͺ Sydney

Jason Phu, Untitled (still), 2018, still image from HD video

John Young Zerunge, The Field (still), 2018, still image from looped HD video projected on wall

Courtesy the artists and 4A Centre for Contemporary Asian Art, Sydney

49 ǣ Animal Hybrid Elli Walsh

2XURQWRORJLFDOVWDWXVKDVXQWLOUHFHQWO\EHHQVHFXUHO\mKXPDQn

7KLVWHQRURIWUDQVKXPDQLVPLVH[SORUHGLQm0\0RQVWHUnDQH[KLELWLRQXQSDFNLQJWKHHQGXULQJ fascination with the human-animal hybrid that has long entertained mythology, folklore and íFWLRQ)HDWXULQJZRUNVE\PRUHWKDQORFDODQGLQWHUQDWLRQDODUWLVWVWKHVKRZFRLQFLGHVZLWK the bicentenary of Mary Shelley’s novel Frankenstein, which famously traces the tragic downfall of DVFLHQWLVWZKRUHDQLPDWHVDîHVK\SDWFKZRUNRIERG\SDUWVLQWRDJURWHVTXHEHLQJ1RWKLQJVD\V hybridity like Frankenstein’s monster, whose emergent identity and longing for love derails the Western model of the human self.

6SDQQLQJVRXQGDUWSDLQWLQJGUDZLQJFHUDPLFVFXOSWXUHSKRWRJUDSK\DQGíOPm0\0RQVWHUn LVFXUDWHGE\(YHO\Q7VLWDVDVDQH[SDQVLRQRIKHUGRFWRUDOUHVHDUFKLQWRKRZWKHVFLHQFHíFWLRQ hybrid emblemises our anxiety about the crossovers between animality and humanity. Each of the íYHVSDFHVLQWKH50,7*DOOHU\PLUURUVDGLIIHUHQWFKDSWHURIKHUGLVVHUWDWLRQ$PRQJWKHPDQ\ contemporary works in the show, Kate Clark’s taxidermied half-deer-half-human, Gallant (2016), LQFDUQDWHV)UDQNHQVWHLQLDQDHVWKHWLFVZLWKîHVK\DQGIXUU\IDFLDOVHJPHQWVVWLWFKHGWRJHWKHU like a post-mortem puzzle. Dangling from the ceiling, this bizarre being appears as an apparition from our future, teleported mid-gallop from a dystopian landscape concocted in our minds. When we look into its glistening rubber eyes, we see ourselves looking back from the animal body we deny we inhabit.

In Bharti Kher’s diasec print Chocolate 0XIíQ (2004), a human-horse hybrid ZLWKDPRQVWURXVPXPPLíHGHVTXHIDFH confronts us with uncanny anatomical V\PPHWU\EHWZHHQPDQDQGEHDVWîHVK and fur, hoof and high heel. The absurd SODWHRISLQNPXIíQVDQGmVKDLUGR brings together cultural domesticity and domesticated animal. Meanwhile, Melbourne artist Ronnie van Hout KXPRURXVO\FRQîDWHVVHOIDQGRWKHULQKLV existential photographs Monkey Business, Sculpt d. Dog and Self (2001), where bust portraits of the artist donning chimpanzee and greyhound rubber masks, facing three GLIIHUHQWDQJOHVUHîHFWVWKHIDFHWVRIKXPDQ 50 51 identity. Perhaps the bestial id and civilised superego aren’t as separate as Freud thought.

‘My Monster’ examines the cognitive processes behind why hybrid creatures send our moral compass into a spin. The desire to preserve species divides can be traced back to ancient anthropocentrism through to Renaissance humanism and Judeo- Christian traditions, where man’s GRPLQDQFHZDVGHíQHGE\LWVVHSDUDWLRQ from the animal; operating on a higher plane of existence. Such ‘othering’ practices have persisted to the current GD\rGHVSLWHLQîXHQWLDOVFLHQWLíFFODLPV for continuity between the human and DQLPDOZRUOGVrDQGKDYHMXVWLíHGD range of institutionalised exploitations, leading to new research into issues such as animal consciousness, animal politics, and speciesism. Deborah Klein’s intricate watercolours depicting various insects capped with the hairstyled anterior of women’s heads create a ‘homo-insecta world’ full of glam femme-bugs that uproot species hierarchies in a very pretty way, while Beth Croce’s intaglio print Seeds of an idea (2018) posits a biological proximity between the hearts of man and swine, bringing to mind recent developments in cloning and xenotransplantation (which make pig organs transplanted into humans possible).

Hybrids are harbingers of a future we may not welcome yet are willingly creating through VFLHQWLíFLQWHUYHQWLRQDQGELRORJLFDOPDQXIDFWXULQJ-XVWDV)UDQNHQVWHLQnVFUHDWXUHOLQJHUV RQWKHHGJHRIKXPDQLW\DQGDQLPDOLW\VRWRRDUHZHEHFRPLQJOHVVDQGOHVVGHíQHG$V QHZDZDUHQHVVRIKXPDQKHWHURJHQHLW\DFURVVJHQGHULGHQWLW\DQGSV\FKRORJ\íOOFROOHFWLYH consciousness, perhaps the next ‘spectrum’ to arise is that of our species.

RMIT Gallery Until 18 August, 2018 Melbourne

Deborah Klein, Ladybird Woman, 2014, watercolour, 41.9 x 29.7cm

Kate Clark, Gallant, 2016, fallow deer hide, antlers, clay, foam, thread, pins, rubber eyes, wire, dimensions variable

Barthi Kher, &KRFRODWH0XIíQ from the series ‘Hybrids’, 2004, diasec print, 76.2 x 114.3cm

Courtesy the artists and RMIT Gallery, Melbourne

$20,000 first prize (non-acquisitive)

EMSLA is now in its twelfth year. Entries are invited from Australian painters over the age of eighteen.

Entries close 28 September 2018. Entry form and details are available at www.emsla.com.au

Mitchell Fine Art Until 21 July, 2018 Queensland ǡ Until 31 July, 2018 Melbourne

m:RPHQRI8WRSLDnLVDJURXSH[KLELWLRQE\ Marking a number of Gothic anniversaries – some of Australia’s most recognised female including the bicentenary of Mary Shelley’s Aboriginal artists from the Utopia region in Frankenstein – this exhibition traces Gothicism Central Australia, the traditional land of the from the mid-1800s to the end of the 19th Alyawarre and Anmatyerre people. A collection century. It features artworks from the of paintings in bold style and colours – earthy University’s Special Collections by artists browns, rich pinks, oranges, reds and blues including Henry Fuseli, Salvator Rosa, G.B. – tell women’s stories of Country, food, Piranesi, Francisco Goya, John Martin and traditional practices, law and their complex &KDUOHV0ÂU\RQZKRH[SORUHGGDUNSODFHV social systems. Artists include Emily Kame and psychological states. The show also Kngwarreye, Gloria Petyarre, Minnie Pwerle, includes thematic spaces such as a drawing Kathleen Petyarre, Margaret Loy Pula and room celebrating Gothic literature, and a Polly Ngale. VSDFHGHGLFDWHGWRm*UDYH\DUGSRHWVnDQG mUHVXUUHFWLRQLVWVn

Minnie Pwerle (1915-2006), Bush Melon Seeds, acrylic on linen, 8QNQRZQSKRWRJUDSKHUSKRWRJUDSKRIDQmDSSDULWLRQnPDGHE\ 60 x 60cm sandwiching glass negatives together at the time of printing, Courtesy Mitchell Fine Art, Queensland c. 1870, albumen silver print, 16 x 21.5cm Courtesy Noel Shaw Gallery, University of Melbourne 56 Steve Lopes Impossible Find Until 29 July, 2018 Victoria ͳͲ ͶǡʹͲͳͺ Sydney

Ten artists and collectives have created new Steve Lopes’ paintings are representations works that reimagine historic paintings from RIYLHZHGODQGVFDSHV+LVíJXUHVKRZHYHU Bendigo Art Gallery’s 19th and early 20th are imagined personalities or isolated century Australian and European collection. characters (dis)placed in the composition Encompassing performance, sound, as an afterthought. Drawing on personal íOPSDLQWLQJDQGWH[WLOHVWKHH[KLELWLRQ experiences with people and places from recalibrates history through the lens of his travels, Lopes selects subjects that contemporary culture, challenging the notion WUDQVFHQGERUGHUV,Qm,PSRVVLEOH)LQGnKH of art as historic record and subverting what UHYHDOVDZRUOGRIWUDQVLWRU\íJXUHVWUDYHOOHUV &XUDWRU-HVVLFD%ULGJIRRWWHUPVmWKHOHJDF\RI and storytellers who are searching for the a Euro-Western superiority complex’. The new unknown and unattainable. Moving through and historic artworks are reframed in a series new lands unencumbered, they discover the of installations throughout the gallery. world for themselves and on their own terms – free from modern institutions.

FAMILY FIRST! (Paul Yore & Devon Ackerman), The Birth of a Untitled Figure, 2018, oil on board, 45 x 45cm Nation, 2018, mixed media, 170 x 160cm Courtesy the artist and Stella Downer Fine Art, Sydney Photograph: Ian Hill Courtesy the artists and Bendigo Art Gallery, Victoria 57 Rachel Ellis Ǣ Sustaining Light ǡ

Incinerator Gallery ͷǡʹͲͳͺ Until 29 July, 2018 New South Wales Melbourne

Working mainly in-situ, Rachel Ellis has &XUDWHGE\-HVVLFD&ODUNmVWDQGLQJVWLOO captured the light, colour and topology of the looking back, looking forward’ celebrates NSW Central Tablelands since her move to First Peoples’ identities through temporal Bathurst in 2001. Curated by Julian Woods, perspectives – the present, past and future. m6XVWDLQLQJ/LJKWnEULQJVWRJHWKHUVHOHFWHG works from public and private collections Artists Dean Cross, Amala Groom, Nicole highlighting the artist’s interest in luminism Monks, Brad Harkin, Ashley Perry and and interaction with line, shape and form. Katie West grapple with the complexities of Her paintings and drawings of the region’s navigating culture and sovereign knowledge seasons, landscapes and streetscapes are a through a range of interdisciplinary ideas, mUHVSRQVHWRVRPHWKLQJVHHQDQGIHOWnm,ORYH methods and media. As a result, their the way light can transform what we see,’ works offer alternative viewpoints on the says Ellis. diaspora and plurality of Aboriginality in a contemporary urban context.

Bentinck Psalm, 2017, oil on board, 122 x 177cm Dean Cross, DROPPING THE BULLSHIT (we look like this too), Private Collection 2018, pure pigment archival ink on BFK Rives Photograph: Silversalt Photography Courtesy the artist and Incinerator Gallery, Melbourne Courtesy the artist and Bathurst Regional Art Gallery, New South Wales

58 Joshua Webb Drunk Heart | Cool Eyes

There Is ͳͺ ͳͲǡʹͲͳͺ Until 2 September, 2018 Victoria

Arranged across three series, Solaris, Phantasms In 2016 Brook Andrew embarked on a and Altars, artist Joshua Webb’s new body comprehensive study of the collections of of work comprises abstract sculptures the University of Cambridge Museums and created using a diverse selection of materials, the British Museum, London, as part of the combined with new digital technologies and $XVWUDOLDQ3ULQW:RUNVKRSnVm$QWLSRGHVn traditional building techniques. project. In the resulting suite of eight photolithographs – acquired by Geelong The LED light and plastic structures of Solaris, Gallery in 2017 – Andrew appropriates 18th the minimal polished concrete objects of century satirical prints by British artist James Altars and digitally designed and printed Gillray, which addressed British Imperialism, 3D sculptures of Phantasms commune in SROLWLFVDQGYDULRXVFRQîLFWV+HXVHVWKLV a luminous world of colour, shape and archival material to re-examine ways in IRUPZKHUHVFLHQFHíFWLRQGHVLJQDUWDQG which Indigenous peoples have been architecture come together. (mis)represented.

Left: SOLARIS 6, 2018, Photopolymer resin, polycarbonate, ABS, Bringing up the bodies Without fear or favour, 2016, four-colour aluminium, PMMA, & LED, 140 x 50 x 85cm. Centre: ALTAR 5, photolithograph with collaged photolithograph elements and 2018, polished concrete, blue metal aggregate, steel and urethane hand colour, edition 24/30 glass coat, 78 x 42 x 42cm. Right: SOLARIS 7, 2018, Photopolymer Produced in collaboration with APW Printers Martin King and resin, polycarbonate, ABS, aluminium, PMMA and LED, 140 x 50 Simon White at Australian Print Workshop, Melbourne and x 85cm Geelong Gallery, Victoria Courtesy the artist and There Is, Western Australia Courtesy the artist, Geelong Gallery, Victoria and Tolarno Galleries, Melbourne 59 ǣ ǡ ǡ Standing Rock documentation Until 22 July, 2018 ͷ ǡ ʹͲͳͺ New South Wales Queensland

Christo and Jeanne-Claude’s Wrapped Coast In 2016, Standing Rock protesters began their LV WKH RQVHW RI mLQ VLWH SURFHVV íJKWDJDLQVWWKH'DNRWD$FFHVV3LSHOLQHD performance, documentation’, an exhibition 1,172-mile underground channel built to juxtaposing Australian experimental art transport crude oil from North Dakota to an practice from the 1960s and 1970s with more oil tank farm in Illinois. recent documented interventions that explore related environmental, political, or artistic Photojournalist Angus Mordant was there. concerns. Now, his photographic documentation presents a powerful visual narration of the $UWLVWV LQFOXGH 'DYH +XOOíVK %DLOH\ ,DQ %XUQ tensions and violence of that time, as well Tim Burns, Christo and Jeanne-Claude, Nici as the rich culture of the First Peoples of Cumpston, Bonita Ely, Anne Ferran, Shaun North America, as they gathered with their Gladwell, Claire Healy and Sean Cordeiro, supporters to protect Sioux land and water Tim Johnson, Rosemary Laing, Robert from environmental threat. Macpherson, Clive Murray-White, Glen O’Malley, Mike Parr, Tim Silver, Darren Siwes and James Tylor.

James Tylor, Unresettling (Stone Tidal Fish Trap), 2016, from the Oceti Sakown Camp, North Dakota, USA, Wednesday, December 7th, VHULHV m8QUHVHWWOLQJ +DXQWLQJV n HGLWLRQ KDQGFRORXUHG 2016, archival pigment print, 51 x 34cm digital print on paper, 41 x 41cm Courtesy the artist, Dominik Mersch Gallery, Sydney and Lismore Photograph: Carl Warner Regional Gallery, New South Wales Collection of the University of Queensland, purchased 2017 Courtesy the artist, Vivien Anderson Gallery, Melbourne and University of Queensland Art Museum, Queensland 60 Andjana Pachkova Die Sehnsucht Until 29 July, 2018 Stanley Street Gallery Tasmania ͳͺ ͳͳǡʹͲͳͺ Sydney

7KH*HUPDQWHUPm'LH6HKQVXFKWnURXJKO\ m,I\RXKDYHWRDVNZKDWQDÈYHDUWLV\RXZLOO WUDQVODWHVWRmLQWHQVHO\ORQJLQJnGHQRWLQJ never know.’ – Viktor Zappner a deep emotional state for which there is no English equivalent. Compounded from After listening to the melodic twists of mGDVVHKQHQn \HDUQLQJ DQGmGDVVHLFKWXPn Thelonious Monk in the early 1960s, musician (lingering illness), it represents feelings about and art lover Viktor Zappner discovered a link IDFHWVRIOLIHWKDWDUHXQíQLVKHGRULPSHUIHFW between jazz and the work of Henri Rousseau. paired with a desire for ideal alternatives. 7KLVDSSUHFLDWLRQDQGXQGHUVWDQGLQJRIQDÈYH Andjana Pachkova explores this experience DUWVKDSHVm7DVPDQLDQ1DLYLVWVnIHDWXULQJ in her painterly abstracts, which weigh tone Pat Hull, Ray (Shorty) Keeting, Tut Ludby, against form and mark, to visualise the Chris Wilson and Bill Yaxley, whose paintings balance between searching for happiness and and sculptures create a refreshing, childlike the reality of unattainable wishes. innocence juxtaposed with a propulsive beat of spontaneity.

Castle in the Sky – Islands of Tears, 2017, mixed media and collage Bill Yaxley, Monk’s Dream (detail), 2009, painting on canvas on Archer watercolour paper, 57 x 76cm Courtesy the artist and Burnie Regional Art Gallery, Tasmania Courtesy the artist and Stanley Street Gallery, Sydney

61 Delay Justine Muller

Contemporary Art Tasmania Until 15 July, 2018 Tasmania ǡ Until July 29, 2018 New South Wales m'HOD\n LQYLWHV DXGLHQFHV WR QHJRWLDWH D GHQVH m:KHQWKH\WDNHWKHZDWHUIURPD%DUNDQGML environment of video projection, objects, person, they take our blood.’ – Badger Bates text-based correspondence and photographic images that explore escape and withdrawal Concerned for the degradation of the Barka- as politico-personal acts of alterity and Darling River, artists Badger Bates and Justine non-participation. The exhibition centres Muller, in collaboration with the Wilcannia DURXQG D íOP I Go Further Under (2017-18) community, draw attention to its dissipation, where an isolated island off the South coast wider ecosystem and surrounding basin. of Tasmania becomes a place of entrapment, Presenting ceramics, sculpture, leadlight, paranoia and surveillance – yet not without linocut, painting, multi-media video and over the potential to break free. Weaving together 200 footprints of Wilcannia residents created mysterious characters, liminal landscapes and with clay from the river, this exhibition gives slippery realities, Newitt unpacks the human voice to the Barkandji people who rely on its preoccupation with escapism. care for their survival.

James Newitt, I go further under íOP VWLOO Badger Bates, Life Coming Back to Moon Lake Wilcannia, 2011, Courtesy the artist and Contemporary Art Tasmania, Hobart linocut Courtesy the artist and Broken Hill Regional Art Gallery, New South Wales 62 To Tell Another’s Story The Memory Within Portrait Exhibition Canberra Contemporary Art Space, Manuka 12 to 22 July, 2018 ͳʹǡʹͲͳͺ m7KH0HPRU\:LWKLQnH[SORUHVWKHHPRWLRQDO Featuring portraits of local refugees by associations we hold for everyday objects, the South Australian artists, this show responds ones that occupy our homes and intimate to the highly politicised and divisive spaces that are linked to domestic ritual and global phenomenon of immigration and the memories they evoke. With a survey of asylum. Through the mediums of paint and trinkets, ornaments and other household photography, artists capture individualised things, artist Naomi Taylor Royds considers stories tracing the plights, challenges and the importance of the familiar, contemplating successes of their journeys to our shores. the idea that perhaps it is only through Presented by the Australian Refugee SHUVRQDOFRQQHFWLRQDQGPHPRU\WKDWZHíQG Association and the State Library of South the true value in the ordinary. Australia, the exhibition confronts audiences with provocative themes of multiculturalism, human rights, cultural diversity and anti- racism, ultimately nurturing acceptance and empathy.

Chinese Takeaway, 2017, rescued objects, aqua sand and cement, Muzafar Ali, Student from Cisarua Refugee Learning Centre, West dimensions variable Java, Indonesia, photograph Courtesy the artist and Canberra Contemporary Art Space, Courtesy the artist, Australian Refugee Association Inc, South Manuka, Australian Capital Territory Australia and State Library of South Australia 63 Art & Industry

As we near celebrating 45 years of publishing Art Almanac continues to serve and be shaped by people who engage with art everyday. Our practice supports the sustainability of our arts community in all its forms. We have experience as artists, in critical writing, working in galleries and festivals, design, teaching, digital media and the curatorial ield.

Art Almanac is more than a magazine.

64 identify with the diplomacy of food in our society, environments and everyday existence.’ Artist Pirrie will collaborate with contemporary Northern Territory artists, Artback NT and industry mentors over Opportunities the next few months to develop and prepare the show, which will open in April 2019. ‘Fecund: Fertile Worlds’, developed by Clare Armitage the SPARK NT Curator for 2017, is now showing We have selected a few galleries at Godinyamayin Yijard Rivers Arts and Cultural and funding bodies calling for Centre, Northern Territory, until 21 July. On Friday 6 and Saturday 7 July, the centre will present ‘SPARK submissions for Art Awards, NT Symposium: Curatorial practice unpacked’ – a Artist Engagements, Grants, gathering of leading curators from around the country Public Art, Residency Programs, with artists and arts practitioners to consider the Exhibition Proposals and more. current state of curatorial practice in the NT. artbacknt.com.au Enjoy and good luck! Australian Life Sarah Pirrie: photography competition Entries close 29 July 2018 SPARK NT Curator for 2018 Professional and amateur photographers are invited The SPARK program, inaugurated in 2017, is to enter the Australian Life photography competition. an Artback NT initiative aimed at supporting an This is an annual event offering a cash prize of independent or emerging curator resident in the $10,000. Twenty-two finalist images will be blown Northern Territory to develop a touring exhibition as up to bedsheet-sized portraits for the outdoor part of a three-year project. exhibition on show along the St James walkway of Darwin-based artist, educator and curator Sarah Pirrie Hyde Park from 13 September to 7 October. Curated has been announced as the SPARK NT Curator for by photographer Sandy Edwards, Australian Life is 2018 and has been awarded a development budget part of the City of Sydney’s year-round Art & About of $10,000 and $10,000 curatorial fee to assist in program of events and temporary art projects in the initiation and delivery of the exhibition ‘We are: unusual spaces throughout the city. We eat’. artandabout.com.au Evelyn Chapman Art Award Entries close 5pm, 15 September 2018 S.H. Ervin Gallery is calling for entries for a new $50,000 scholarship, the Evelyn Chapman Art Award, to be presented to an Australian painter, male or female under the age of 45 years. This scholarship is offered to support a young Australian painter by furthering their art education both in knowledge and artistic practice internationally, or in Australia. Applicants are invited to submit up to three landscape, portrait or still life paintings in oil or tempera. shervingallery.com.au

Henry Jones Art Prize The new Henry Jones Art Prize for emerging artists offers $20,000 in prize money, and the winner of the People’s Choice prize will receive $1,000 in framing by Wagner Framemakers. Two-dimensional works; painting, drawing, printmaking and mixed media, created since June 2017 are invited. The prize is Sarah Pirrie, SPARK NT Curator 2018 open to Tasmanian residents over the age of 18, who have not been previously exhibited in awards and The theme for the show is ‘food’ – as a cultural competitions. An exhibition will be held in the Henry determinant, shared language and environmental Jones Packing Room and Atrium at The Henry Jones resource. Reflecting on this idea Pirrie says, Art Hotel, Tasmania, from 7 to 18 November. ‘Everyone loves food and I feel it’s one of our best thehenryjonesartprize.com.au communication tools… I hope the universality and local specificity of the theme will resonate with both regional and urban NT audiences to freely

Art & Industry 65 Contemporary Art Tasmania 31 July. Round 2 is open 1 December 2018 to 28 February 2019. ACT-based artists at all levels, and Studio Residencies 2019 organisations providing the Canberra community Applications close 1 October 2018 with opportunities to engage in the arts are invited Contemporary Art Tasmania’s studios located to apply. in Tasma Street, North Hobart, are available by arts.act.gov.au application to visual arts practitioners committed to a career in contemporary art. The studios are awarded annually for a fixed period of 12 months NSW Artists Grant with recipients being selected by an expert panel of Applications close 21 July 2018 peers. Visual artists, curators and arts writers are National Association of the Visual Arts (NAVA) invites invited to apply. By providing studios at minimal cost, professional artists residing in New South Wales Contemporary Art Tasmania addresses the needs of, to apply for funding of up to $1,250 (+GST) for and supports local artists and their practice. individual artists and up to $2,500 (+GST) for group contemporaryarttasmania.org applications. Regional NSW and Western Sydney based artists are encouraged to apply. This NAVA initiative aims to assist artists to produce, present and Fremantle Arts Centre promote their work throughout NSW, across Australia Artist in Residence program and overseas. Applications open year round visualarts.net.au Fremantle Arts Centre (FAC) invites local, national and international artists including individuals, groups, Artbank Roadshow for curators, writers and organisations to apply for a residency at one of the centre’s 11 studios and a Unrepresented Artists residential apartment (located at the Moores Building, Artbank Roadshow is a national initiative that seeks applications for this apartment will be accepted in to provide opportunities for unrepresented artists September 2018 for residencies beginning after to be seen and potentially acquired for the Artbank September 2019.) FAC accommodates a variety Collection. The Artbank team will travel to each state of disciplines and projects. Residencies can be for across Australia to meet with artists for 20-minute the creation of new works, research, and practice appointments, where artists will take their work and development. discuss their practice. Applicants will be assessed and fac.org.au recommendations made to the Artbank Director for acquisition. Visit the website for dates in each state and an information pack. Terrence and Lynette Fern artbank.gov.au Cité Internationale des Arts Residency Fellowship, 2019 Art meets Science Exhibition Applications close 23 July 2018 Expressions of Interest close 5 July 2018 The Power Institute Foundation for Art & Visual The Science Division of the Department of Culture is calling on artists across all fields of Environment and Science at the Ecosciences Precinct, the visual arts including performance, video and Dutton Park is calling artists from across South multi media at any level of his/her profession to East Queensland to showcase recent artworks that apply for the 2019 Terrence and Lynette Fern Cité demonstrate specific art-science connection and are Internationale des Arts Residency Fellowship, hosted suitable for the space. The 7th iteration of Art meets by the Cité Internationale des Arts in Paris. The Science will be held from 10 August to 7 September. program offers three categories; the ‘Power Institute Award for Artists/Craftspeople’, the ‘Power Institute MADA Gallery 2019 Award for Art Critics, Art Writers, Art Curators, Art Historians or Art Administrators’, and the ‘Power Exhibition Proposals Institute Award for Staff of the University of Sydney, Submissions close 5pm, 30 July 2018 the Museum of Contemporary Art; or PhD research Exhibition proposals are invited for the 2019 MADA students of the University of Sydney’. Gallery exhibition program. Submissions are open powerinstitute.submittable.com to MADA’s academic and professional staff, HDR candidates, alumni and artists in residence as well as external applicants including artists, curators, Arts ACT designers, architects and other creative practitioners Arts Activities Funding with varying degrees of experience from culturally The ACT Government has developed a new Arts diverse backgrounds. Funding Plan for the arts in Canberra. Artists can artdes.monash.edu now apply for up to $5,000, at any time of the year. Applications for up to $50,000, with two rounds open each year, are also available. Round 1 closes

66 Art & Industry Bruny18 Awards W www.brunyislandartprize.com ‘The Bruny’ is a national art prize, focused on painting that explores concepts of identity and environment, including the A.M.E. Bale Travelling relationship between people and the physical world. Scholarship and Art Prize The 2018 theme is ‘Art of Adaptation’. Exhibition Oct W www.gleneira.vic.gov.au/Bale Applications are 13 to 21. A major prize of $20,000 is on offer, Highly open to emerging Australian artists who have Commended $1,500. Judges are Elizabeth Ann demonstrated talent and achievement in traditional Macgregor, Director MCA; artist Fiona Hall and Jarrod styles for this major $50,000 award. Exhibition Nov Rawlins, Curator MONA. Visit website for details. 24 to Dec 9 at Glen Eira City Council Gallery. Entries close midnight, Sun July 16. Visit website for details and entry. Entries close Wed Oct 3. See ad page 103. Burnie Print Prize T (03) 6430-5875. E [email protected] ANL Maritime Art Awards W www.burniearts.net Burnie Regional Art Gallery E [email protected] is calling artists to enter the 2019 Burnie Print Prize W www.missiontoseafarers.com.au/art-prize and is offering a major acquisitive award of $15,000. Exploring the theme of ‘the Relationship of Humanity Exhibition March 22 to May 5 2019. Entry forms are to the Sea’. Over $25,000 in prize money across five available online. Entries close Fri Oct 5. categories. Entries close Fri Aug 31. See ad page 161. See ad page 112. Deakin University Contemporary Belle Property Bowral Prize Small Sculpture Award T (02) 4861-4093. T (03) 9244-5344. E [email protected] W www.bdasgallery.com/artists-opportunities W deakin.edu.au/art-collection A $10,000 acquisitive Bowral & District Art Society Inc. invites entries for sculpture prize, with the winning work to become part the inaugural Belle Property Bowral Prize for works of the Deakin University Art Collection. Exhibition Sept interpreting the theme of ‘My Highland Home’. Visit 4 to Oct 19. Entries close Fri July 13. website for more info and entry. Exhibition Aug 10 to See ad page 121. 19. Entries close Wed July 25. See ad page 149. EMSLA Birregurra Festival Eutick Memorial Still Life Award Weekend Art Show and Prize W www.emsla.com.au Painters over the age of 18 are W www.birregurrafestival.com/art-show Artists invited to submit entries for the 12th Eutick Memorial are invited to enter the Birregurra Art Show Prize. Still Life Award. First prize $20,000 non-acquisitive. Categories include Drawing, Pastels, Watercolour, Visit website for details and entry. Acrylics, Oils, Photomedia, Printmaking and 3D Entries close Fri Sept 28. See ad page 54. works. Exhibition Oct 13 to 15. Visit website for details and entry. Entries close Fri Sept 14. Evelyn Chapman Art Award See ad page 117. W www.shervingallery.com.au S.H Ervin Gallery is calling for entries for a new $50,000 scholarship to Black Swan Prize for Portraiture be presented to an Australian painter, male or female W www.blackswanprize.com.au Portrait artist’s are under 45. Offered to support a young Australian invited to submit works for the opportunity to share in painter by furthering their art education both in $70,000 in prizes, across the ‘Portraiture Prize’ and knowledge and artistic practice internationally, or in ‘Youth Prize’ categories. Main exhibition Oct 27 to Australia. Entries close 5pm, Sat Sept 15. Nov 26, and Youth & Salon des Refusés exhibitions See ad page 53. Oct 29 to Nov 23. Visit the website for details and entry forms. Adult entries close Fri July 20. Youth FAC Open Exhibition entries close Fri July 27. W www.thefac.com.au The FAC Open Exhibition 2018 theme ‘immersion’ is inspired by FAC’s Dive into the Arts campaign. Artwork entries will aim to enhance the visually aesthetic experience,or interactive participation of visiting FAC audiences. The winning artist is awarded their own FAC exhibition and opening event on Fri Aug 10, 6pm. Artwork entry $16. Enquiries (03) 9768-1361. Applications close Fri July 27.

Art & Industry 67 Grace Cossington Smith Meroogal Women’s Art Prize Art Award W slm.is/meroogalartprize Sydney Living Museums E [email protected] invites entries for the Meroogal Women’s Art Prize, a W www.gcsgallery.com.au A biennial award for two- non-acquisitive competition and exhibition. Open to dimensional artworks inspired by the theme ‘Making female artists over 18 years who are NSW residents. Connections’. Prizes: $15,000 acquisitive; $2,500 Up to two entries per artist, in any medium. Exhibition early career; $2,500 local. Visit the website for online Sept 2018 to March 2019. Visit website for details. entry. Entries close Thurs Aug 31. Entries close 4pm, Tues July 31. Hornsby Art Prize NSW Parliament W hornsby.nsw.gov.au/artprize Entries are now Plein Air Painting Prize open for the Hornsby Art Prize. Prizes valued at over W www.pleinair.com.au The NSW Parliament $23,000 are on offer. Visit the website for more Plein Air Painting Prize is an acquisitive art prize of information. Entries close Tues July 31. $20,000, awarded for the best ‘plein air’ painting of See ad page 127. a NSW subject. All artists are encouraged to enter this landscape painting award, with finalists and semi- Jacaranda Acquisitive finalists exhibited at the Parliament of NSW, Sydney Oct 3 to 26. Visit website for details. Drawing Award – JADA Entries are open July 2 to Aug 6. See ad page 141. T (02) 6642-3177. W graftongallery.nsw.gov.au Entries are open for Grafton Regional Gallery’s 2018 JADA award. First prize $30,000, Acquisitions Paddington Art Prize $10,000. Exhibition Oct 26 to Dec 9. Visit website T 0418-167-135. E [email protected] for details. Entries close 5pm, Fri Aug 10. W www.paddingtonartprize.com.au A $30,000 national acquisitive prize for a painting inspired by the Australian landscape. Online submissions are now John Leslie Art Prize open. Visit the website for more information. T (03) 5142-3500. W www.gippslandartgallery.com Entries close 5pm, Fri Aug 17. See ad page 78. This acquisitive prize for landscape painting offers an award of $20,000. Visit website for entry details. Entries close Fri Aug 10. See ad page 16. Petrie Terrace Gallery Advance call for the QLD Figurative prize $10,000. Now in its third year the Queensland Figurative Josephine Ulrick is a unique non-acquisitive competition open to and Win Schubert Queensland artists for two dimensional works Photography Award containing the human figure(s) integrated to create a harmonious and unified composition. The central W www.hota.com.au/gallery/josephine-ulrick-and- theme of the award is the integration of the figure(s) win-schubert-photography-award-2018 into the composition. For more information email Artists are invited to enter the Josephine Ulrick and [email protected] or visit www.rqasbiennial.com.au Win Schubert Photography Award 2018. A total Entries close Tues Aug 14. prize pool of $50,000 is on offer. First prize is an acquisitive cash prize of $25,000, and an additional $25,000 in acquisitions will be awarded to a Redland Art Awards selection of finalists. Selected works will be exhibited W www.redlandartawards.org.au Redland Art Awards at Gallery HOTA from Oct 20 to Nov 25. See website is a biennial contemporary painting competition for details and online entry. Entries are open Mon open to all Australian artists. Acquisitive first prize July 2 to Fri Aug 24. See ad page 17. $15,000. Exhibition Sept 2 to Oct 14. Visit website for details and entry form. Entries close Mon July 23. Kangaroo Valley Art Prize See ad page 181. & Exhibition $7000 in prizes. Exhibition Sept 28 to Oct 1, sales ROI Art Prize on-line for additional month. Open to all 2-D artists, W www.roiapartments.com.au/roi-art-prize.html any medium. Judges Felicity Fenner, international The annual ROI Art Prize is calling for entries contemporary art curator; Therese Kenyon, Sydney from emerging and established artists to submit artist, educator and writer. For updates, sign up to original artworks including painting, limited edition our mail list at artsinthevalley.net.au/visual-arts. printmaking, photography and drawing. First prize is Entries are open Wed Aug 15 to Wed Sept 12. $10,000 and People’s Choice $1,000. The winning See ad page 144. work is acquired for display in the ROI Apartments complex located in North Fitzroy, Melbourne. Entries close Thurs Nov 1.

68 Art & Industry Tesselaar Sculpture Prize Editions 2019 – Call for Entries Sculpture among the Tulips T 0432-323-188. W www.tacitart.com.au W www.tulipfestival.com.au The 11th annual Tacit Galleries invites entries from Victorian-based Tesselaar Sculpture Prize for outdoor sculpture entries printmakers for the Editions 2019 exhibition to run are open. This is a $20,000 acquisitive award. Feb 13 to 24. Entries close Sat Dec 1. Guidelines and applications available from the curator See ad page 91. Mark Cowie on [email protected] or P.O. Box 1086, Daylesford, Vic, 3460. Project Gallery Applications close Fri Aug 3. See ad page 107. 90 Oxford Street, Paddington, Sydney 2021. T 0402-144-350. E [email protected] William and Winifred Bowness W www.projectgallery90.com Calling artists, curators Photography Prize and designers to apply to exhibit in this new concept space opening in July. See ad page 143. W www.mga.org.au Entries are open for the annual Bowness Photography Prize, an acquisitive award offering a $30,000 first prize. All film-based and digital Tacit Galleries 2019/20 work from amateurs and professionals is accepted. Proposals There are no thematic restrictions. Exhibition Sept 29 to T 0432-323-188. W www.tacitart.com.au Nov 18. Entries close Wed July 11. See ad page 23. Exhibition proposals are open to exhibit in 2019/20. See ad page 91. The Woollahra Small Sculpture Prize Toorak Village Art walk W sculptureprize.woollahra.nsw.gov.au This acquisitive T Tony Fialides 0419-005-052. award is for an original, free-standing sculpture of up to W www.toorakvillage.com.au Accepting submissions 80cm in any dimension with a prize pool of $24,000 for original paintings, drawings and mixed media and is open to Australian and international artists. works for display in Toorak Village shop windows Oct Exhibition Oct 20 to Nov 11. Visit website for entry 15 to Nov 11. Visit website for entry form and details. form and details. Entries close Fri July 6. Entries close Thurs Aug 30. See ad page 105. Yering Station | Yarra Valley Arts Sculpture Exhibition & Awards T (03) 9730-0102. E [email protected] Internships & W www.yvarts.com Submissions are invited for the Yering Station | Yarra Valley Arts Sculpture Exhibition Fellowships & Awards Oct 28 to Dec 9. Download application from www.yering.com/visit-yering-station/art-gallery Entries close Fri July 6. Art Gallery of Western Australia W www.artgallery.wa.gov.au AGWA accepts volunteers on an ongoing basis, as well as offering formally structured internships. Submissions Art India Magazine W www.artindiamag.com Learn the process of & Proposals publishing the magazine from finish to end. Three four-month internships are offered each year. Box Hill Community Arts Centre 2019 Artist in Residence ϐ ǡ 470 Station Street, Box Hill 3128. T (03) 9895-8888. W www.artasiapacific.com Editorial and design E [email protected] W www.bhcac.com.au internships for students and recent graduates excited Expressions of interest are now open for the 2019 about contemporary art, magazines and learning. Artist in Residence program. Visit website for details. Applications close Fri July 27. Artsy, United States W www.artsy.net A fast-paced digital company Brunswick Street Gallery regularly advertises for Editorial, Accounts and Art Level 1, 322 Brunswick Street, Fitzroy 3065. Marketing positions. T (03) 8596-0173. E [email protected] W www.brunswickstreetgallery.com.au/exhibit Applications are open to exhibit at the gallery in 2019. For more info visit the website.

Art & Industry 69 Chippendale Creative Precinct Queen Victoria Museum W chippendalecreative.com The CCP Internship and Art Gallery Program offers a platform for students looking to W www.qvmag.tas.gov.au Volunteering with QVMAG further their course work through practical insight into enables individualstodevelop new skillsand the operation of a not for profit Arts Organisation. knowledge in related fields, offers the opportunity to make professional connections, contribute to the Documentary Arts Asia, visitor experience, be part of asupportive team and Thailand get involved with research and collections behind the scenes. W www.doc arts.asia This non profit organisation aims to advance visual literacy and supports documentary artists in Asia. Internshipsin Singapore Art Museum documentary photo, film, editing, curating, teaching W www.singaporeartmuseum.sg Singapore Art and administration. Museum has internship opportunities throughout the year within different departments of the museum. M+ Museum, HongKong W www.westkowloon.hk In the Performing Arts Sydney Living Museums Internship Programme you will work with professional W www.sydneylivingmuseums.com.au SLM staff, full time for a period of around six months and internships are project based allowing students to gain practical and theoretical training in programming, gain insight into the elements of one or more projects. venue operations as well as technical and productions. Interns may work in core museum areas; exhibition Paid and operating on a recurring basis, with content development andinterpretation, collection openings every year. cataloguing, heritage and research, marketing, or event coordination. Monash Gallery of Art The Australianhomeof Tate London photography W www.tate.org.uk Gain a valuable insight into the arts, and opportunities to work on interesting projects W www.mga.org.au Volunteers at MGA assist with and learn new, practical skills. greeting visitors, events and programs, and undertake a range of specialised duties, including assisting with the gallery’s archive and research library. National Art School, Sydney Studio Spaces W www.nas.edu.au The NAS Gallery provides an internship program each year for a tertiary student or Ess Art Studio recent graduate. NAS also seeks volunteers to work at 3 7Crystal Street, Petersham NSW 2049. least one or two half days each fortnight and commit T Anthony: 0404 700 299. E [email protected] to the program for 12 months. 14sqm $80 p/w. National Gallery of Australia, Canberra W www.nga.gov.au We offer placements in a wide Materials rangeoffunctions in a number of areas to provide as broad an experience as possible. Art Spectrum NTU Centre for Contemporary E [email protected] W www.artspectrum.com.au We are the makers of Art Singapore colour, dedicated to creating the finest possible artists’ W www.ntu.ccasingapore.orgAthree month program colours. Visit website for more information on these with stipend offers insights and an immersive work quality products. See ad page 145. experience across several departments including; Exhibitions, Residencies, Research and Education and Art Stretchers – art supplies Communications and Development. and canvas stretching PeggyGuggenheim, Italy 309 311 High Street, Northcote VIC 3070. T (03) 9486 4446. E [email protected] W www.guggenheim venice.it Internship program in W www.artstretchers.com.au H Mon Fri 9.00 to Venice and The Hilla Rebay International Fellowship 5.30, Sat 10.00 to 3.00. Also at 161 Morphett advertised throughout the year. Street, Adelaide SA 5000. T (08) 8212 2711. E [email protected] See ad page 111.

70 Art & Industry Artists’ Oil Colours

Tradition meets technology in the manufacture of Daler-Rowneyw Artists’Oils.

In order too achieve the accuracyr of colour and strength of tint thatisasssociated with the Daler-Rowwney name, only the best pigmments and precise formulatioons are used to ensure absoluteb perfection for the discerning artist.

This creates the distinctive buttery coonsistency of Daler-Daler Rowney ArtistA Oilsand releases thefullintensity of the colour

texture heelping to prevent even heavy impasto from becoming www.arthousedirect.com.au brittleand cracking over time. Arthouse Direct Port Art Supplies W www.arthousedirect.com.au An extensive range 83 Commercial Road, Port Adelaide SA 5015. of art, graphic and craft supplies for students and T (08) 8241-0059, F 8241-0058. professionals. During July 35% off Daler Rowney E [email protected] Artists’ Oil Colours. See ad page 71. W www.portartsupplies.com.au H Mon-Fri 8.30 to 5.00, Sat 9.00 to 2.00. Stockists of quality fine art Deans Art materials. See ad page 163. E [email protected] W www.deansart.com.au Complete range of artists’ materials available. S&S Creativity Unlimited T 1300-731-529. W www.creativityunlimited.com.au Eckersley’s Art & Craft Wholesalers of fine art supplies. Stocking a range of art and craft materials with over 22,000 items in W www.eckersleys.com.au Shop online and in-store. the range. Gift cards available. Fitzroy Stretches Shades of Art 74C Ovens Street, Wangaratta, VIC 3677. 63 Weston Street, Brunswick VIC 3056. T (03) 5722-2296. W www.shadesofart.com.au T (03) 9380-9553. E [email protected] Fine Art and Craft Supplies. W www.fitzroystretches.com Jasco The Sydney Canvas Company 9/79 Station Road, Seven Hills NSW 2147. W www.jasco.com.au Your guide to the best value art T (02) 8854-5070. W www.tsccaus.com.au Superior and craft supplies around! quality artists’ cotton and linen canvas rolls. Stretcher bars, stretching tools, gesso, easels. Order your Kadmium swatch book online or call us. See ad page 99. Art + Design Supplies W www.kadmium.com.au 80b Bay Street, Broadway Wholesale Canvas Australia NSW 2007. T (02) 9212-2669. 29 Smith Street, Marrickville NSW 2204. T (02) 9517-3025. Kerrie Lowe W www.wholesalecanvasaustralia.com.au Ceramic Art Supplies Wholesalers of fine primed and unprimed canvas and linen rolls. A range of stretcher bars available. 49 King Street, Newtown NSW 2042. T (02) 9550-4433. W www.kerrielowe.com H Mon-Sat 10.00 to 5.30 (Thurs 10.00 to 7.00). The only location in the inner city selling clay, underglazes, glazes, tools and museum gel. Services Neil Wallace A Brush with Jordan Printmaking Supplies W www.abrushwithjordan.com Unique tours for art 409 Gore Street, Fitzroy VIC 3065. lovers. Experience the ancient country of Jordan from T (03) 9419-5949. E [email protected] the artists’ perspective. Visit website for details. W www.e-artstore.net H Mon-Fri 9.30 to 5.30, Sat 10.00 to 5.00. Huge range of materials for Accent Framing printmakers and artists, also stocking a range of bookbinding accessories. See ad page 109. Fine Art Printing 421 Sturt Street, Ballarat VIC 3350. T (03) 5331-7011. W www.accentframing.com.au Newtown Art Supplies Wide-format Giclée printing. Short or multiple runs T (02) 9516-2339. W www.newtownartsupplies.com.au on archival cotton rag, artist’s canvas and specialist Online Australia-wide. papers. Bespoke framing and canvas stretching. Parkers Sydney Art Hunter Fine Art Supplies T 0404-434-008. E [email protected] W www.parkersartsupplies.com W www.arthunter.com.au Art Hunter moves art, Darlinghurst: Building 22, National Art School, Cnr quickly and safely offering affordable rates, regional Forbes and Burton streets, Darlinghurst NSW 2010. and interstate delivery, seven days, and at short T (02) 9339-8706. E [email protected] notice. Art installation. See ad page 113. The Rocks: 3 Cambridge Street, The Rocks NSW 2000. T (02) 9252-3706. E [email protected]

72 Art & Industry Art on the Move Fine Art Restoration T 0410-337-223. Affordable art couriers for Western T 0415-482-686. E [email protected] Victoria, Melbourne, Sydney and Adelaide. Up to: W www.laetitiawojtas.com Laetitia Wojtas professional 35cm $30, 60cm $35, 1 metre $45, 2 metres $60. painting restoration in Sydney. Specialising in modern and contemporary art. Contact for a free quote. Art Production Services See ad below. T 0404-280-768. E [email protected] Fitzroy Stretches W www.artproductionservices.com On-Site art 63 Weston Street, Brunswick VIC 3056. documentation for print, publication and archive. T (03) 9380-9553. E [email protected] Sydney, NSW and ACT. W www.fitzroystretches.com Framing, stretching and printing. Fine art printing on rag paper and canvas. Art. Van. Go. Sydney All our prints are exhibition-quality and archival to museum standards. T 0404-027-445. W www.artvango.com.au Affordable, professional fine art transport for galleries, artists, framers and you in Sydney and NSW. Gianna Rosica Accounting for the Arts Artist Moving Artists T (03) 9428-3855. E [email protected] Melbourne W www.giannarosica.com.au Chartered accountants specialising in the taxation and accounting needs of T 0437-214-402. E [email protected] the arts community. See ad page 113. W www.artistmovingartists.com.au Art courier Melbourne and regional Victoria. Affordable prices. IAS – International Art Services Arts Accountant & Valuer W www.iasdas.com.au Sydney: (02) 9667-1077, Melbourne: (03) 9329-6262, Brisbane: (07) 3890- Michael Fox 7422, Canberra: (02) 6232-9773, 79 Langridge Street, Collingwood 3066. Perth: (08) 9249-5376. Fine Art Logistics. T (03) 8560-3583. E [email protected] W www.foxmichael.com.au H Tues-Sat 10.00 to 6.00. Michael Fox offers specialist tax advice to Kosnar’s Picture Framing creative professionals. Registered with the Australian Ascot Vale, Melbourne Tax Practitioners Board. 488 Mount Alexander Road, Ascot Vale VIC 3020. T (03) 9370-5744. W www.kosnar.com.au Artward Bound We offer a large range of frame styles for the artist and collector. Expert advice in framing design for all types T 0418-545-834. E [email protected] of artwork. W www.artwardbound.com.au Art hanging systems/ art installation. Police and working with children check provided. Lupo Bianco Photography and Design Belgrave Creative Space T 0439-675-240. E [email protected] 1658a Burwood Highway, Belgrave 3160. W www.lupobianco.com.au Documentation of all T 0425-831-425. W www.belgravecreativespace.com kinds of artworks. See ad page 86. Space for hire: workshops, forums, exhibitions, classes, private tuition, performances, rehearsals and art projects. Chapman & Bailey 420 Johnston Street, Abbotsford VIC 3067. T (03) 9417-0500. E [email protected] W www.chapmanbailey.com.au Custom framing, stretchers/stretching. Australia’s most comprehensive professional art service. Best-quality artists materials, linens and stretchers.

Art & Industry 73 Mal Wood Foundry 6 Kurnai Avenue, Reservoir VIC 3073. Consultants T (03) 9462-3793. E [email protected] W www.malwood.com.au & Valuers Omnus Framing 409 Gore Street, Fitzroy VIC 3065. Catherine Asquith Art T (03) 9419-2226. E [email protected] Advisory Brokerage Consultancy W www.omnusframing.com.au H Mon-Fri 9.30 T 0422-753-696. to 5.30, Sat 10.00 to 5.00. Archival framing – E [email protected] specialising in works on paper and beautifully W www.catherineasquithart.com Bespoke art hand-crafted, sustainably-grown timber frames. advisory, brokerage and consultancy services See ad page 109. including art collection audit, management and development; insurance, superannuation and market Parkers Framing Works valuations; and design project collaboration. 69 Renwick Street, Redfern NSW 2016. Member: Art Consulting Association of Australia. T (02) 9698-8591. E [email protected] W www.parkersartsupplies.com Louise Smith Fine Art Melbourne Picture Hanging Systems T 0418-519-747. E [email protected] T 1300-883-645. W louisesmithfineart.com.au Approved valuer E [email protected] Australian Government Cultural Gifts Program and W www.picturehangingsystems.com.au member Art Consultants Association Australia. Manufacture, supply and installation of modern With over 30 years’ experience. discreet picture hanging systems. Effortless art installation. Australia-wide. Noël Stott of Adam Galleries Print 2 Metal Fine Art Valuer of Australian T (03) 9571-2600. E [email protected] and European Art W www.print2metal.com Award winning Print 2 T 0407-338-538. E [email protected] Metal specialises in the printing of photos, artwork W www.adamgalleries.com Paintings, drawings, and graphics onto metal. Five surfaces available. graphics, sculpture and photography. Fine art consultant and approved valuer for the Australian Cultural Gifts Program. Member of Art Consultants Shakespeare Solutions Association of Australia. Over 30 years experience. Picture Hanging Systems T (03) 9028-6805. W www.shakespearesolutions. Private View Art Collections com.au The Gallery System & Slimline Art Hanging T 0409-505-628. E [email protected] System. Buy online or via phone. Satisfaction W www.privateviewart.com Private and corporate guaranteed. Free delivery Australia wide. collection development and advice. Offering assistance Very friendly staff. with sourcing, framing, conserving, and investing in art, with an extensive range of specialist networks. The Sydney Canvas Company 9/79 Station Road, Seven Hills NSW 2147. Stella Downer T (02) 8854-5070. W www.tsccaus.com.au Handmade custom stretched canvases. We stretch Dealer, Consultant, Valuer existing artwork of any size. See ad page 99. T 0402-018-283. E [email protected] W www.stelladownerfineart.com.au H Tues-Fri 10.00 to 5.00, Sat 11.00 to 5.00, or by appt at Stella Downer Fine Art 1/24 Wellington Street, Waterloo, 2017. Approved valuer for the Australian Government Cultural Gifts Program. Insurance/ market value, authentication, consulting and collection management.

74 Art & Industry Royal Queensland Art Society Member Unit 3, 162 Petrie Terrace, Brisbane QLD 4000. T (07) 3367-1977. E [email protected] W www.rqas.com.au/rqas-membership The Royal Organisations Queensland Art Society Brisbane Branch welcomes all artists covering a diverse range of media. Social, Art Gallery of New South Wales Country, and Family memberships welcomed. Networking and social events, exhibition opportunities (AGNSW) at Petrie Terrace Gallery and workshops. T (02) 9225-1664. W www.artgallery.nsw.gov.au/members Call or visit the website for information about gallery membership; discounts, free exhibition viewings, magazine and over than 400 lectures, workshops and Training other events each year. The Art Room artsHub Australia 125 Hyde Street, Footscray VIC 3011. W www.artshub.com.au ArtsHub is a critical resource T 0407-197-106. W www.the-art-room.com.au for Australia’s arts sector of daily news bulletins, An art class, studio workshop and all round creative reviews and interviews for creative professionals and hub in the Inner West of Melbourne. art enthusiasts. ARTCLASSCO Copyright Agency | Viscopy Art Classes in Fitzroy Melbourne T W 1800-066-844 (toll free). www.copyright.com.au W www.artclassco.com Visual artist Jacqui Stockdale Copyright Agency | Viscopy are not-for-profit rights offers Short Courses and Masterclasses for all levels. management organisations and collection societies. Painting, drawing, collage and mentoring. We enable the use of text and images in return for fair payment to visual artists, writers and publishers. Bayside Sculpture & Gallery National Association for the 16B Advantage Road, Highett 3190. T (03) 9553-0661. W www.baysidesculpture.com.au Visual Arts (NAVA) H Daily 11.00 to 5.00. Term 3: eight-week Sculpture T (02) 9368-1900. E [email protected] Classes beginning July 23, 24 and 25. W www.visualarts.net.au NAVA is the peak body representing and advancing the professional interests Hands On Studio Art Classes of the Australian visual arts, craft and design sector. W www.catholiccarechoices.org.au Hands On Studio is a creative and inclusive art space that provides The Print Council of Australia people with disabilities access to art education and (PCA) facilities at the M16 studio and gallery complex W www.printcouncil.org.au A national not-for-profit in Griffith. Classes include painting, drawing, member organisation that promotes contemporary printmaking, mixed media and clay. Contact Catholic Australian fine art printmaking and print media, Care Choices (02) 6295-4300, or visit website. including artist books, zines and works on paper, and provides support and advocacy for artists. Through Ku-ring-gai Art Centre publications, commissioned editions, exhibitions and T (02) 9424-0310. W www.kmc.nsw.gov.au/artcentre other events we work to foster a greater appreciation Visual art, guitar, creative writing classes. Exhibitions/ of original prints and a knowledge of the history events. Day, night and weekend classes available. of Australian printmaking amongst our members, Adult, children, teens. Beginner to advanced collectors and the wider community. welcome. Facebook @kuringgaiartcentre Resale Royalty MAS Gallery & Studio T 1800-066-844 (toll free). Art Classes W www.resaleroyalty.org.au Copyright Agency has 1297-1299 High Street, Malvern VIC 3144. been appointed by the Australian Government to T (03) 9822-7813. E [email protected] manage the resale royalty scheme, which pays a W www.malvernartists.org.au Art classes including: share from eligible resales of artworks to artists. life drawing, oils, acrylics, drawing, watercolour, mixed media and open studio. Beginners and all levels invited.

Art & Industry 75 Melbourne Sculpture School Artlink T 0407-509-758. W www.artlink.com.au Contemporary art of Australia W www.melbournesculptureschool.com Sat mornings and the Asia-Pacific. Online reviews and archive. – Life Modelling, Mould Making and Bronze Casting. Thurs evenings – Design, Mould and Foundry. Broadsheet Journal Sat afternoons – Introduction to Sculpture. W www.cacsa.org.au Essays and reviews on Beginners welcome. contemporary art practice supporting critical thinking. Warringah Printmakers Studio Discipline Cnr Condamine and Lovett streets (entry on W www.discipline.net.au Discipline is a contemporary Condamine Street), Manly Vale NSW 2093. art journal publishing artist pages and interviews, W www.printstudio.org.au July 21 and 22 Etching, research essays on contemporary Australian art, and Chine Colle and hand colouring with pure pigment histories and theories of contemporary art as a global with Basil Hall. Sept 29 and 30 Relief in Layers industry or phenomenon. (jigsaw linocuts) with Diane Fogwell. Workshops and weekly printmaking classes available. Please see website for details. Dissect journal Bookings: [email protected] W www.dissectjournal.com An independent contemporary art publication with a focus on art and artists, and explores writing, editing, design and publishing as artistic practice. Art eyeline T (07) 3138-5521. E [email protected] Publications W www.eyelinepublishing.com Contemporary visual arts magazine. Get free access to the eyeline digital Art + Australia archive when you subscribe. W www.artandaustralia.com Art + Australia is a publishing and research body that focuses on Oberon contemporary art and its relationship to broader W www.oberonmagazine.com Oberon is a periodical theoretical, social and geo-political contexts. on art in the world. Art Almanac Pollen W www.art-almanac.com.au Australia’s monthly W www.pollenmagazine.com In each issue POLLEN guide to galleries, news and awards. See ad page 77. takes a theme from philosophy and explores it through a collision of photography, fiction, essay, poetry Art Monthly and more. W www.artmonthly.org.au/subscribe Visual arts essays, reviews and options – Australia, New Zealand Runway and the Asia-Pacific region. W www.runway.org.au Runway is an independent Australian experimental art journal run by a collective ϐ of Sydney-based and internationally-based artists, writers and curators. W www.artasiapacific.com ArtAsiaPacific magazine is the leading English-language periodical covering contemporary art and culture from the Middle East Sturgeon and Asia-Pacific. W www.sturgeonmagazine.com.au Produced by Artbank magazine surveys Australian art, culture, etc. The Article W thearticle.com.au The Article is a new forum for un Magazine Australian and International cultural debate, reviews W www.unprojects.org.au Projects publishes essays, and features by professional writers. artists’ work and reviews with a focus on artists, writers, artist-run initiatives and independent projects. ϐ W www.artistprofile.com.au The artists behind Vault the art. Artist interviews, essays, reviews, news. W www.vaultart.com.au New Art & Culture Magazine. Subscribe online at mymagazines.com.au

76 Art & Industry Subscribe 11 issues for $59

Huge savings on the cover price Free delivery to your door Never miss an issue

artalmanac.com.au mymagazines.com.au Call 1300 361 146 or +61 2 9901 6111 for international callers ONLINE ENTRIES CLOSE: 5pm 17th August 2018 A $30,000 National acquisitive prize for a painting inspired by the Australian landscape. 6 non-acquisitive prizes are on offer including the opportunity for two unrepresented artists to have an exhibition with Defiance Gallery. Judges for 2018 are Katrina Cashman, Assistant Director Mosman Art Gallery, Ramesh Mario Nithiyendran, artist & Associate Lecturer at UNSW Art & Design and Tony Costa, artist.

EXHIBITION OF NATIONAL FINALISTS & PRIZE PRESENTATION Monday, 17th September 2018 MENZIES ART BRANDS 12 Todman Ave, Kensington 2033 ______

______paddingtonartprize.com.au [email protected] 0418 167 135 Gallery Index

79 A - C

Aboriginal & Pacific Art 130 Australian Galleries 95, 138 Academy Gallery 160 Australian Print Workshop 96 ACE Open 163 Australian Tapestry Workshop 90 Adelaide Central Gallery 163 Ballarat – Gallery on Sturt 118 AIRspace Projects 132 Bank Art Museum Moree 148 Alcaston Gallery 95 BAROMETER Gallery 138 Alternating Current Art Space 100 Barossa Regional Gallery 165 ANCA Gallery 155 Bathurst Regional Art Gallery 152 Andrew Baker Art Dealer 174 Bayside Sculpture 106 ANKAAA 171 Beaver Galleries 156 Anna Schwartz Gallery 88 Bega Valley Regional Gallery 150 Annandale Galleries 132 Belalie Art Gallery 165 Anne & Gordon Samstag Museum of Art 163 Belconnen Arts Centre 157 Annette Larkin Fine Art 138 Belgrave Creative Space 106 Anthea Polson Art 177 Benalla Art Gallery 119 ANU Drill Hall Gallery 155 Bendigo Art Gallery 118 ANU School of Art Gallery 155 Bett Gallery Hobart 160 APY Gallery 126 Biennial of Australian Art 119 Araluen Arts Centre 172 Bijou Gallery Petschel House 117 Ararat Gallery TAMA 118 BlackCat Gallery 96 ARC ONE Gallery 88 Blacktown Arts Centre 141 arc Yinnar Gallery 116 Blarney Books & Art 117 ARO 126 Blender Gallery 138 Art at Linden Gate 106 BLINDSIDE 88 Art at St Francis 85 Blue Mountains City Art Gallery 151 Art Atrium 138 Bolin Bolin Gallery 106 Art Gallery of Ballarat 118 Boomalli Aboriginal Artists Co-operative 134 Art Gallery of New South Wales 123 Bowral Art Gallery 150 Art Gallery of South Australia 164 Box Hill Community Arts Centre 106 Art Gallery of Western Australia 168 Bradley Hall Antiques & Art Gallery 120 Art Mob 159 Brett Whiteley Studio 130 The Art of Dr. Seuss 85, 123 Bridget McDonnell Gallery 92 541 Art Space 123 Brightspace 100 Art Space on the Concourse 135 Brisbane Powerhouse 174 Artarmon Galleries 135 Broken Hill Regional Art Gallery 152 Artback NT 172 Brunswick Street Gallery 96 Artbank 101, 130 Bunbury Regional Art Gallery 169 Artereal Gallery 132 Bundaberg Regional Galleries 180 Arthouse Gallery 126 Bundeena Maianbar Art Trail 141 Articulate project space 132 Bundoora Homestead Art Centre 106 Artitja Fine Art 167 Burnie Regional Art Gallery 160 Arts Academy, Post Office Gallery 118 Burra Regional Art Gallery 165 Arts Project Australia 99 Burrinja Gallery 108 Artsite Galleries 134 Buxton Contemporary 90 Artspace 126 Cairns Art Gallery 180 ArtSpace at Realm 106 Cairns Indigenous Art Fair 2018 180 Artspace Mackay 180 Cambridge Studio Gallery 96 ArtSpace Wonthaggi 116 Campbelltown Arts Centre 142 Ascot Theatre Gallery 165 Canberra Contemporary Art Space, Gorman Arts Centre 155 Association of Sculptors of Victoria 85 Canberra Contemporary Art Space, Manuka 156 Australian By Design 85 Canberra Glassworks 156 Australian Catholic University Gallery 95 Canberra Museum and Gallery 155 Australian Centre for Contemporary Art 90 Carlisle Street Arts Space 100 Australian Centre for Photography 126 Castlemaine Art Museum 119 Australian Centre for the Moving Image 85 Casula Powerhouse Arts Centre 142

80 Gallery Index C - J

Central Goldfields Art Gallery 119 Gab Titui Cultural Centre 180 Ceramic Break Sculpture Park 153 Gaffa Gallery 123 Chapman & Bailey 96 GAGPROJECTS | Greenaway Art Gallery 164 Chapter House Lane 88 The Gallery at Bayside Arts & Cultural Centre 101 Charles Darwin University Art Gallery 171 Gallery 107 @ Dalby 178 Charles Nodrum Gallery 99 Gallery 139 147 China Heights Gallery 130 Gallery 371 134 Coffs Harbour Regional Gallery 148 Gallery 9 127 Collingwood Gallery 96 Gallery at HOTA 177 Colville Gallery 159 Gallerysmith 94 The Commercial 124 Gate 6 Gallery 108 Contemporary Art Society of Victoria Inc. 99 Gecko Studio Gallery 116 Contemporary Art Tasmania 160 Gee Lee-Wik Doleen Gallery 108 Counihan Gallery In Brunswick 99 Geelong Gallery 117 Cowra Regional Art Gallery 153 George Paton Gallery 94 Craft Victoria 88 Geraldton Regional Art Gallery 169 Craft ACT 155 Gippsland Art Gallery 116 The Cross Art Projects 126 Glass Artists’ Gallery 135 CSIRO Discovery Centre Gallery 155 Glasshouse Regional Gallery 149 The Cullen 100 Glen Eira City Council Gallery 104 Davson Gallery 178 The Goat Gallery 120 The Dax Centre 92 Godinymayin Yijard Rivers Arts and Cultural Centre 171 Deakin Downtown Gallery 85 Gordon Studio Glassblowers 115 Deakin University Art Gallery 108 Gosford Regional Gallery 147 Defiance Gallery 134 Goulburn Regional Art Gallery 153 Defiance Gallery at Mary Place 138 Grace Cossington Smith Gallery 136 Delmar Gallery 134 Grafton Regional Gallery 149 Desart 172 Graydon Gallery 174 Despard Gallery 159 Griffith Regional Art Gallery 153 Devonport Regional Gallery 161 Gympie Regional Gallery 178 Dogwood Crossing, Miles 180 Hadley’s Orient Hotel 159 Duck Print Fine Art 150 Handmark Gallery 159 Duldig Studio 101 Harvey Galleries 136 East & West Art 102 Hawthorn Studio & Gallery 102 Eastgate Gallery 102 Hazelhurst Regional Gallery & Arts Centre 142 Elizabeth Arthur Fine Art Gallery & Sculpture Garden 117 Headland Artists and Sculpture Park 136 Eltham Library Community Gallery 108 Hearth Galleries 120 Factory 49 134 Heartland Studio 164 Falkner Gallery 119 Heathcote Museum and Gallery 167 Fellia Melas Gallery 138 Heide Museum of Modern Art 108 FELTspace 164 The Henry Jones Art Hotel 159 Fine Arts, Sydney 126 Heritage Hill Museum and Gardens 108 Firestation Print Studio Gallery 101 Horsham Regional Art Gallery 120 FireWorks Gallery 174 Hugo Michell Gallery 164 Firstdraft 127 Hurstville Museum and Gallery 142 Flinders Lane Gallery 88 The Ian Potter Museum of Art 94 Flinders Street Gallery 130 in.cube8r gallery & emporium 96 fortyfivedownstairs 88 Incinerator Gallery 110 4A Centre for Contemporary Asian Art 124 Ipswich Art Gallery 178 The Fox Darkroom & Gallery 92 Islamic Museum of Australia 99 Fox Galleries 96 JamFactory 164, 165 Fox Jensen Gallery 138 Jan Manton Art 174 Frances Keevil Gallery 127 Jan Murphy Gallery 174 Frankston Arts Centre and Cube 37 Galleries 115 Janet Clayton Gallery 140 Fremantle Arts Centre 167 The Japan Foundation Gallery 124

Gallery Index 81 J - P

Japingka Gallery 167 Megalo Print Studio + Gallery 157 Joel Gallery 110 Merricks House Art Gallery 115 John Curtin Gallery 169 Metropolis Gallery 117 Kapunda Community Gallery 165 Michael Reid Sydney 130 Kate Owen Gallery 135 Mildura Arts Centre 120 The Ken Done Gallery 123 Millicent Gallery 165 Kerrie Lowe Gallery 135 Mitchell Fine Art 175 Kerry Packer Civic Gallery 164 Modern Times 96 KickArts Contemporary Arts 180 Mona – Museum of Old and New Art 159 King Street Gallery on William 127 Monash Gallery of Art 111 Koorie Heritage Trust 85 MONDO ART 119 Korean Cultural Centre Australia Gallery 123 Montalto Sculpture park 115 Kosnar’s Picture Framing 110 Montville Art Gallery 177 La Trobe Art Institute 119 Moores Building Contemporary Art Gallery 167 Lake Macquarie City Art Gallery 147 Mornington Peninsula Regional Gallery 111 Langford 120 94 Mosman Art Gallery 137 Lapunyah Art Gallery 178 Mu Studio Gallery 137 The Larwill Studio 94 Mundaring Arts Centre 169 Latrobe Regional Gallery 116 Museum and Art Gallery of the Northern Territory 171 Lauraine Diggins Fine Art 104 Museum of Brisbane 175 Laurent Gallery 90 Museum of Contemporary Art Australia 123 Lawrence Wilson Art Gallery 168 Museum of Sydney 124 Lesley Kehoe Galleries 86 Muswellbrook Regional Arts Centre 149 Linden New Art 100 Nancy Sever Gallery 155 Linton & Kay Galleries 168, 169 NAS Gallery 127 Lismore Regional Art Gallery 149 National Association for the Visual Arts 128 Liverpool Street Gallery 127 National Gallery of Australia 157 The Lock Up 147 National Gallery of Victoria 86, 92 Logan Art Gallery 178 National Library of Australia 157 Lorraine Pilgrim Gallery 177 National Portrait Gallery 157 Lost Bear Gallery 151 Neon Parc 86 The Lost Ones 119 New England Regional Art Museum 153 Lynn Jaanz Art Gallery 90 Newcastle Art Gallery 147 M16 Artspace 156 Niagara Galleries 99 Macquarie University Art Gallery 142 Nicholas Thompson Gallery 98 MADA Gallery 104 Nishi Gallery 155 Maffra Exhibition Space 117 Noel Shaw Gallery, University of Melbourne 95 Maitland Regional Art Gallery 147 Nolan on Lovel Gallery 152 Murray Art Museum Albury 153 Noosa Regional Gallery 177 Manly Art Gallery & Museum 136 Norman Lindsay Gallery & Museum 152 Manning Regional Art Gallery 149 Northern Centre for Contemporary Art 171 Manningham Art Gallery 110 Oak Hill Gallery 116 March Space 106 The Olsen 100 Margaret Lawrence Gallery 92 Olsen Gallery 140 Margaret River Gallery 169 Orange Regional Gallery 153 Margaret Whitlam Galleries, Female Orphan School 142 Outstation Gallery 171 Margot Hardy Gallery 142 Pan Pacific Melbourne 86 Maroondah Access Gallery 111 Parramatta Artists Studios 142 Martin Browne Contemporary 140 Peacock Gallery and Auburn Arts Studio 144 MAS Gallery 101 Penrith Regional Gallery & The Lewers Bequest 144 Maunsell Wickes Gallery 140 Performance Space 124 MAY SPACE 130 Perth Institute of Contemporary Arts 168 McClelland Sculpture Park + Gallery 115 Petrie Terrace Gallery 175 McGlade Gallery at the Australian Catholic University 135 Phil Henshall Studio 120

82 Gallery Index P - Z

Philip Bacon Galleries 176 Sutton Gallery 98 Pilgrim Creek Studios 120 Suzanne O’Connell Gallery 176 Plimsoll Gallery 159 Swamp Gallery 135 Port Hedland Courthouse Gallery 169 Swan Hill Regional Art Gallery 120 Port Jackson Press Print Gallery 98 Sydney Road Gallery 138 Port Pirie Regional Art Gallery 165 Tacit Galleries 98 Post Office Gallery 119 Tactile Arts 171 PROJECT [504] 138 Tandanya 165 Qdos Arts + Sculpture Park 118 TAP Art Gallery 128 Quadrant Gallery 102 TarraWarra Museum of Art 112 Queen Victoria Museum & Art Gallery 160 Tasmanian Museum and Art Gallery 160 Queensland Art Gallery | Gallery of Modern Art 176 Ten Cubed 101 Queensland College of Art – Project Gallery 176 There Is 168 QUT Art Museum 176 Thienny Lee Gallery 141 red gallery 98 Tinning Street Presents 99 Red Tree Gallery Jindivick 120 Tjanpi Desert Weavers 172 Redland Art Gallery 176 Retrospect Galleries 149 Tolarno Galleries 87 Rex-Livingston Art + Objects 152 Toowoomba Regional Art Gallery 178 RMIT Gallery 86 Town Hall Gallery 102 RMIT Project Space / Spare Room 95 Tributary Projects 157 Robin Gibson Gallery 128 The University Gallery and Senta Taft-Hendry Museum 148 Roslyn Oxley9 Gallery 140 The University of Queensland Art Museum 177 Sabbia Gallery 140 UNSW Galleries 128 Saint Cloche 141 Utopia Art Sydney 132 Salamanca Arts Centre 159 UTS Gallery 126 Sarah Scout Presents 87 Verge Gallery 126 SASA Gallery 164 Vermilion Contemporary Chinese Art 124 Sawtooth ARI 160 Victorian Artists’ Society 98 SCA Galleries 135 Vivien Anderson Gallery 101 SCOPE Galleries 118 Wagner Contemporary 141 Scott Livesey Galleries 101 Wagner Framemakers 160 S.H. Ervin Gallery 124 Walker Street Gallery & Arts Centre 112 Sheffer Gallery 124 Wangaratta Art Gallery 120 Shepparton Art Museum 120 Wanneroo Gallery 168 Sherbrooke Art Gallery 111 Warrnambool Art Gallery 118 The Shop Gallery 135 Watch This Space ARI 172 Sister Gallery 164 Watt Space 148 Soho Waterloo 130 Watters Gallery 128 Spring. 1883 87 West End Art Space 87 St Heliers Street Gallery 98 Western Plains Cultural Centre 153 STACKS Projects 128 Western Sydney University Art Gallery 144 Stanley Street Gallery 128 State Library of South Australia 164 White Rabbit Gallery 126 STATION 100 Whitehorse Artspace 112 Stella Downer Fine Art 130 William Holt Gallery 92 Stephen McLaughlan Gallery 88 William Mora Galleries 100 Steps Gallery 95 Wishart Gallery 118 Stevens Street Gallery 177 Wollongong Art Gallery 151 Stirato Gallery 157 Women’s Art Register 1975-2015 100 Strathnairn Arts 157 Yandina Historic House 178 Sturt Gallery & Studios 150 Yarra Ranges Regional Museum 112 Suki & Hugh Gallery 153 Yarra Sculpture Gallery (YSG) 98 Sullivan+Strumpf 132 Yering Station Art Gallery 112

Gallery Index 83 Melbourne

84 Deakin Downtown Gallery Federation Level 12, Tower 2 Collins Square, 727 Collins Street, Melbourne 3008. W deakin.edu.au/art-collection Free entry. H Mon-Fri 9.00 to 5.00 during exhibitions, Square closed public hols. To July 13 Artworks From The Torch – the Torch supports current and former Indigenous offenders in Victoria through its arts in CBD prison and community program. This exhibition builds from successful exhibitions at Deakin in 2017 and is curated by artist and The Torch CEO Kent Morris Art at St Francis (Barkindji). July 25 to Aug 31 Paint, Painting, Contemporary Art Painted – an exhibition featuring emerging Melbourne 326 Lonsdale Street, Melbourne 3000. artists Matthew Dettmer, Sarah Gosling and Laura T (03) 9663-2495. E [email protected] Skerlj. Working with divergent approaches to painting Contact: Brigitte Remmen. H Mon-Fri 9.00 to 5.00, processes these artists have been born into an internet Sun 9.00 to 3.00. July 3 to 31 The Aboriginal way of era defined by a proliferation of images, big data and the Cross by John Dunn. Celebrating NAIDOC week. social media. Amidst this state of constant distraction, the exhibition considers how subjectivity manages to impose itself, even when we are not looking. Curated The Art of Dr. Seuss by James Lynch. presented by Harvey Galleries, Block Arcade The Block Arcade, 19-18/282 Collins Street, Melbourne 3000. E [email protected] W www.harveygalleries.com.au H Mon-Thurs 10.00 to 6.00, Fri 10.00 to 7.00, Sat 10.00 to 6.00, Sun 10.00 to 5.00. Authorised editions from the Seuss Estate. Association of Sculptors of Victoria 600 Bourke Street, Melbourne 3000. W www.sculptorsvictoria.asn.au H Mon-Fri 9.00 to 5.30. Aug 6 to 24 (opening Thurs Aug 9, 6-8pm) Annual & Awards Sculpture Exhibition 2018. See ad page 107. Australian By Design Room 303e, 3rd Floor, Lift 1 opposite The Hopetoun Tea Rooms, The Block Arcade, 282 Collins Street, Melbourne 3000. T (03) 9663-9883, Terrence 0404-699-033 . E [email protected] W www.australianbydesign.com.au H Open daily. Matthew Dettmer, Hippy Pocket, 2017, oil on canvas Courtesy the artist and Deakin Downtown Gallery Australian Centre for the Moving Image (ACMI) Koorie Heritage Trust Yarra Building, Federation Square, Melbourne 3000. Federation Square, Flinders Street, Melbourne 3000. T (03) 8622-2600. E [email protected] T (03) 8663-2200. W www.acmi.net.au W www.koorieheritagetrust.com CEO Tom Mosby. H Daily 10.00 to 5.00. H Daily 10.00 to 5.00. July 21 to Sept 30 Blak Design Matters – Aarli, Arkie Barton, Babbarra Women’s Centre, Balarinji Designs, Maree Clarke, Gilimbaa Designs, Carroll Go-Sam, Jefa Greenaway, Haus of Dizzy, Paul Herzich, Injalak Arts, Dillon Kombumerri, Francoise Lane, Grace Lillian Lee, Marcus Lee, MI Arts, Nicole Monks and Lyn- Al Young – a national survey of Contemporary Indigenous Design, curated by Jefa Greenaway.

Melbourne 85 Lesley Kehoe Galleries Neon Parc Ground Floor, 101 Collins Street, Melbourne 3000. 1/53 Bourke Street, Melbourne 3000. T (03) 9671-4311. E [email protected] T (03) 9663-0911, Also at 15 Tinning Street, W www.kehoe.com.au H Open by appt. To make an Brunswick 3056. E [email protected] appointment, or request an invite to 2018 viewings W www.neonparc.com.au H Wed-Sat 12.00 to 5.00, and events email, or call the gallery. Lesley Kehoe or by appt. Galleries is an internationally recognised gallery for contemporary and historical Japanese artworks. ϐ The Galleries provide visitors with an immersive 2 Convention Centre Place, South Wharf 3000. experience underpinned by beauty and intellect. Free entry. H Open daily/nightly. To Oct 4 HIDDEN FACES: The 2018 Victorian Salon des Refusés – a curated selection of portraits by Victorian artists submitted for national portrait prizes, but not hung in the official exhibitions. Jacqueline Taylor OAM, Exhibition Manager/Curator 0418-357-814, [email protected], youtu.be/ric4WMSG70M RMIT Gallery 344 Swanston Street, Melbourne 3000. T (03) 9925-1717. E [email protected] W www.rmit.edu.au/rmitgallery Free admission. Lift access. H Mon-Fri 11.00 to 5.00, Thurs 11.00 to 7.00, Sat 12.00 to 5.00, closed Sun and public hols. Like RMIT Gallery on Facebook. Iida Seppo, Kanazawa Japan, ceramic Oribe glaze, 8.5 x 8.5 x 13.2cm Follow @RMITGallery on Twitter. June 29 to Aug Courtesy Lesley Kehoe Galleries 18 My Monster: The Human Animal Hybrid. The hybrid is the ultimate metaphor and its almost human National Gallery of Victoria image haunts us from mythology to horror films, The Ian Potter Centre: folk lore to fiction, and all aspects of visual art. The trouble with hybrids is that they disturb our moral NGV Australia compass, reminding us that we are animals, and Federation Square, cnr Russell and Flinders streets, animals are like us. Bringing together work by more Melbourne 3000. T (03) 8620-2222. than 25 Australian and international artists in diverse W www.ngv.vic.gov.au H Daily 10.00 to 5.00. media from public and private collections, including To July 15 Colony: Australia 1770-1861. Also, several new works created for the exhibition, My Top Arts 2018. To July 29 Writing In The Rain Monster: The Human Animal Hybrid is a compelling Contemporary Asian Video Art From The National modern celebration of the 200th anniversary year Gallery Of Victoria. To Aug 26 Robert Hunter. Also, of the publication of Mary Shelley’s seminal novel The Field Revisited. To Sept 2 Colony: Frontier Wars. Frankenstein. Artists: Rose Agnew, Jane Alexander, Janet Beckhouse, Peter Booth, Jazmina Cininas, Kate Clark, Catherine Clover, Beth Croce, Julia deVille, Heri Dono, Peter Ellis, Moira Finucane, Rona Green, Ai Hasegawa, Rayner Hoff, Sam Jinks, Deborah Kelly, Bharti Kher, Deborah Klein, Oleg Kulik, Sam Leach, Norman Lindsay, Sidney Nolan, Eko Nugroho, Patricia Piccinini, Kira O’Reilly & Jennifer Willet, Lisa Roet, Geoffrey Ricardo, Mithu Sen, Maja Smrekar, Ronnie van Hout and (((20hz))). Curated by Evelyn Tsitas. Public programs: Fri July 6, 12.30-1.30pm Animal instinct: Rona Green artist talk. Fri July 20, 12.30-1.30pm Contemporary hybrids: Ronnie van Hout artist talk. Tues July 24, 12.30-1.30pm Frankenstein’s Legacy: Evelyn Tsitas Curator talk. Fri July 27, 12.30-1.30pm In a Manner of Speaking: Catherine Clover participatory performance. Thurs Aug 2, 5.30-6.30pm Metamorphosis & transformation: Jazmina Cininas & Deborah Klein. Thurs Aug 9, 5.30-6.30pm Informed by science: Beth Croce & Sam Leach. Fri Aug 17, 12.30-1.30pm Surreal monsters: Peter Ellis artist talk. See ad page 33.

86 Melbourne Spring. 1883 The Hotel Windsor Spring Street, Melbourne 3000. W www.spring1883.com Aug 1 to 4 As part of Melbourne Art Week, and coinciding with the Melbourne Art Fair, Spring. 1883 will be showcasing 24 galleries from the region and beyond throughout The Hotel Windsor – Melbourne’s grandest heritage hotel. Visit the website for participating galleries. Free admission. See ad page 21. Tolarno Galleries Level 4, 104 Exhibition Street, Melbourne 3000. T (03) 9654-6000 F 9654-7000. E [email protected] W www.tolarnogalleries.com Director: Jan Minchin (member of ACGA). H Tues-Fri 10.00 to 5.00, Sat 1.00 to 5.00. July 12 to Aug 18 Invisible Stories: Meditations on Port Essington by Benjamin Armstrong. West End Art Space 175-185 Rosslyn Street, Melbourne 3003. T 0415-243-917. E [email protected] W www.westendartspace.com.au H Wed-Sat 11.00 Ronnie van Hout, Monkey Business, 2001, print on archival museum rag paper, 81 x 51cm to 4.00. July 6 to 28 (opening Sat July 7, 2-4pm) Courtesy the artist and RMIT Gallery Four Solo Shows: Disruption to Distraction by Wendy Busch, Call and Response by Rebecca Monaghan, Intermingling by TomboyBill, and Cut it Out by Naomi Nicholls. See ad page 110.

Julia deVille, Peter, 2012, rabbit, antique sterling silver goblet (2.15g 925), 17 x 15 x 21cm Courtesy the artist, Sophie Gannon Gallery, Melbourne and RMIT Gallery Sarah Scout Presents Level 1, 12 Collins Street, Melbourne 3000. T (03) 9654-4429. E [email protected] W www.sarahscoutpresents.com Directors: Kate Barber and Vikki McInnes. H Thurs-Sat 12.00 to 5.00. To July 7 HER/E by Cate Consandine. July 13 to Aug 24 The Enigma Code – Fiona Abicare, Jeremy Eaton, Lou Hubbard, John Meade, Tully Moore and Tomboy Bill, Scrambled not Fried, 2018, mixed media on board Nick Ryrie. Curated by Kate Daw. 114 x 90cm Courtesy the artist and West End Art Space

Melbourne 87 Chapter House Lane Flinders Lane Entry via Flinders Lane, Melbourne 3000. W www.chapterhouselane.org.au July 5 to Aug 31 (opening Thurs July 5, 6-8pm) Killing Time Anna Schwartz Gallery by Colleen Ahern, Kirsty Budge, Kate Just, Dan 185 Flinders Lane, Melbourne 3000. Moynihan, Oscar Perry and Toby Pola. Curated by T (03) 9654-6131. E [email protected] Louise Klerks. W www.annaschwartzgallery.com Director: Anna Schwartz. H Tues-Fri 12.00 to 5.00, Craft Victoria Sat 1.00 to 5.00. Watson Place, off Flinders Lane behind Supernormal, Melbourne 3000. T (03) 9650-7775. ARC ONE Gallery E [email protected] W www.craft.org.au Free entry. 45 Flinders Lane, Melbourne 3000. T (03) 9650- H Mon-Wed 11.00 to 6.00, Thurs-Fri 11.00 to 7.00, 0589. E [email protected] W arcone.com.au Sat 10.00 to 5.00. Directors: Fran Clark and Suzanne Hampel (member of ACGA). H Tues-Sat 11.00 to 5.00. To July 28 Flinders Lane Gallery (opening Wed June 27, 6-8pm) Nonetheless by Pat 137 Flinders Lane, Melbourne 3000. Brassington. July 31 to Sept 1 (opening Wed Aug 1, T (03) 9654-3332. E [email protected] 6-8pm) Afterglow by Robert Owen. W www.flg.com.au Director: Claire Harris. H Tues-Fri 11.00 to 6.00, Sat 11.00 to 5.00. Please consult website for any opening hours changes. Our extensive stockroom can also be viewed on our website. To July 14 Exploration 18: Annual emerging artist exhibition – Archie Barry, Tiffany Cole, Farnaz Dadfar, Mohsen Meysami, Claire Mooney, Belinda Wiltshire, Rose Jiiwu Lee, Brett Ferry and Jasper Jacobsen. July 17 to Aug 11 Gallery 1: Bundanon Floor To Sky by Gina Kalabishis. Gallery 2: After The Rain by Jon Eiseman.

ϐ 45 Flinders Lane, Melbourne 3000. T (03) 9662-9966. E [email protected] W www.fortyfivedownstairs.com H Tues-Fri 11.00 to 5.00, Sat 12.00 to 4.00. July 3 to 14 Too-Roo-Dun mixed media installation presented by Baluk Arts. July 17 to 28 Weaving the here and then painting by Ali McNabney-Stevens. Also, Real and Imagined Spaces Robert Owen, Out of the Blue #8, 2014-2016, synthetic polymer textile art and illustration by Jessica Gannaway. July paint of canvas, 122 x 122cm Courtesy the artist and ARC ONE Gallery 31 to Aug 11 All We Can’t See a group exhibition. BLINDSIDE Stephen McLaughlan Gallery Nicholas Building, 714/37 Swanston Street (enter via Level 8, Room 16, 37 Swanston Street (cnr Flinders Cathedral Arcade lifts, cnr Flinders Lane), Melbourne Lane), Melbourne 3000. T 0407-317-323. 3000. T (03) 9650-0093. E [email protected] W www.stephenmclaughlangallery.com.au Director: W www.blindside.org.au H Tues-Sat 12.00 to 6.00. Stephen McLaughlan. H Wed-Fri 1.00 to 5.00, Sat To July 7 Reparar Means To Repair by Camila 11.00 to 5.00 or by appt. To July 7 South Gallery: Galaz. Also, SERPENT SONGS / WINDSHADOWS Laura Osborne. Also, Kendal Heyes. July 11 to 28 by Gerard Crewdson. Daily performances by the Rebecca Sampson. artist: Sat June 30 and Thurs-Fri July 5-6, 4-5pm. Closing performance with Antony Riddell: Sat July 7, 2-4pm. BLINDSIDE SOUND SERIES 2018 partners with Liquid Architecture & Jeff Henderson, Audio Foundation NZ.

88 Melbourne

Australian Tapestry Workshop Southbank 262-266 Park Street, South Melbourne 3205. T (03) 9699-7885. E [email protected] W www.austapestry.com.au Gold coin entry to the galleries and workshop. H Tues-Fri 10.00 to 5.00. Sth Melbourne Guided tours Wed 11am and Thurs 2pm, $10 per person: bookings essential. View the weavers and Australian Centre for dyer at work on major contemporary art commissions and artists in residence. Tapestries being woven on Contemporary Art (ACCA) the looms designed by Emily Floyd, Guan Wei and 111 Sturt Street, Southbank 3006. Justin Hill. To July 28 Tapestry x Architecture – an T (03) 9697 9999. W www.acca.melbourne exhibition of experimental tapestry samples which Free admission. H Tues Fri 10.00 to 5.00, Sat Sun interpret previous Tapestry Design Prize for Architects 12.00 to 5.00, Mon by appt. July 7 to Sept 16 A prize winning designs by John Wardle Architects Lightness of Spirit is the Measure of Happiness – (TDPA 2015) and Justin Hill (TDPA 2016). Tapestry Alec Baker, Benita Clements, Vicki Couzens, Robert x Architecture offers viewers a glimpse into the Fielding, Jonathan Jones, Peter Mungkuri, Vincent process of handmade tapestry production and Namatjira, Jimmy Pompey, Yhonnie Scarce, Peter highlights the innovative collaboration between the Waples-Crowe, Lisa Waup, Kaylene Whiskey and ATW weavers and living architects. Tiger Yaltangki. Curated by Hannah Presley. The first exhibition in the Yalingwa series celebrates the significance of family, community and humour in Buxton Contemporary contemporary Aboriginal life. The exhibition features Cnr Dodds Street and Southbank Boulevard, ten new commissions from artists from south east Southbank T (03) 9035-3020. Australia and beyond, in an exploration of everyday E [email protected] life and experiences of Aboriginal people today. W www.buxtoncontemporary.com H Wed-Sun 11.00 Country music icons, queer identity, pop culture and to 5.00, Thurs to 8.00. The new purpose-built home community leadership are referenced, as well as the for the Michael Buxton Collection of contemporary art. legacy of ancestors and the importance of coming July 12 to Oct 21 No One Is Watching You: Ronnie together to strengthen identity and connection. van Hout – this ironically titled exhibition shines a Yalingwa is a Victorian Government initiative, spotlight on Ronnie van Hout, a Melbourne-based developed in partnership between Creative Victoria, New Zealand-born artist best known for his distinctive ACCA and TarraWarra Museum of Art and designed to brand of existential absurdism. support outstanding contemporary Indigenous art and curatorial practice. It includes three new curatorial Laurent Gallery positions and three major exhibitions alternating 115 Thistlethwaite Street, South Melbourne 3205. between ACCA and TarraWarra, focused on new T 0481-055-558 . E [email protected] commissions by contemporary Indigenous artists. W www.laurentgallery.com H Mon-Wed and Fri 12.00 to 5.00, or by appt. Permanent exhibition by Titane Laurent. Lynn Jaanz Art Gallery Level 1, 216 York Street, South Melbourne 3205. T 0450-955-467. W www.yorkstreetartgallery.com Curator: Anne Ioannou. International artist Lynn Jaanz and guest artist advertised. Viewing by appt: email Curator@lynnjaanzartgallerycom

Robert Fielding, Untitled, 2018, from the series ‘Objects of Origin’, 2018, digital photograph Courtesy the artist, Mimili Maku Arts, Northern Territory and Australian Centre for Contemporary Art

90 Melbourne

Margaret Lawrence Gallery 40 Dodds Street, Southbank 3006. Carlton T (03) 9035-9400. E [email protected] W www.vca.unimelb.edu.au/mlg H Tues-Sat 12.00 to 5.00. July 20 to Aug 25 (opening Thurs July 19, 5.30pm) Yours Internally – Kiron Robinson Nth Melbourne and Grant Stevens – organic kale, yoga mats, adult colouring-in books, active wear – the lifestyle Bridget McDonnell Gallery accessories of our time… but where and how did they become so woven into our social fabric? New Carlton found peace, the quest for nirvana or a reaction 130 Faraday Street, Carlton 3053. to something darker? Yours Internally combines T (03) 9347-1700. E [email protected] neon works by Kiron Robinson and videos by W www.bridgetmcdonnellgallery.com.au H During Grant Stevens in an exploration of the internalised exhibitions Tues-Fri 10.00 to 5.00, Sat 12.00 to experiences of doubt, insecurity, anxiety and 5.00, or by appt. uncertainty. Curated by Dr David Sequeira. Kiron Robinson courtesy Sarah Scout Presents, Melbourne. The Dax Centre Grant Stevens courtesy Sullivan+Strumpf, Sydney. Rear of 30 Royal Parade, Parkville 3010. www.sarahscoutpresents.com/web/kiron-robinson T (03) 9035-6258. E [email protected] www.grantstevens.net/#/haven W www.daxcentre.org Entry by donation. H Wed-Fri 12.00 to 5.00, or by appt. The Dax Centre exhibits selections of works from the Cunningham Dax Collection, all of which are created by people with lived experience of mental illness or psychological trauma. The Fox Darkroom & Gallery 8 Elizabeth Street (enter via laneway), Kensington 3031. T 0414-486-051. E [email protected] W www.thefoxdarkroom.com.au H Tues 5.30 to 9.30, Thurs-Fri 11.00 to 6.00, Sat-Sun 11.00 to 5.00. To July 8 Australians by Paul Blackmore – a photo exhibition. Australians expands on Blackmore’s acclaimed ‘Australians’ series, that focused on how Kate Daw, installing her work Afterwards (Show Me Grace) #2 Courtesy the artist and Margaret Lawrence Gallery the tough Australian environment animates and influences Australian culture. The more recent works revisit themes of the landscape and belonging but National Gallery of Victoria focuses mainly on the Australian coast. In particular NGV International a dynamic culture laid bare amidst the waters and 180 St Kilda Road, Melbourne 3004. beaches of the east coast beneath an ever hotter sun. T (03) 8620-2222. W www.ngv.vic.gov.au H Daily 10.00 to 5.00. To Oct 7 MoMA AT NGV: 130 Years Of Modern and Contemporary Art. Also, Rirkrit Tiravanija, and New York! New York! For Kids. To Oct 28 Japonisme Japan and The Birth Of Modern Art. To Jan 27, 2019 A Modern Life Tablewares 1930s-1980s. Ongoing: NGV Collection International Art. William Holt Gallery In conjunction with 100th Gallery 200 Normanby Road, Southbank 3006. Paul Blackmore, Breathe, Flat Rock Bondi, 2018, C-type print, T 0419-206-358. E [email protected] 120 x 80cm W www.williamholtart.com H Mon-Fri 7.00 to 4.30, Courtesy the artist and The Fox Darkroom & Gallery or by appt. Permanent exhibition with regular new works showing 25 large-scale paintings on display – William Holt.

92 Melbourne , , Time for Tea for Time Drink Me Christine Aspland, Christine 50 x 50cm media on canvas, mixed Mariani, Leah 50 x 50cm oil on fabric, Curiouser and Curiouser 62 Lygon Street, Carlton South Vic 3053 Leah Mariani and Chris Aspland

This exhibition by Leah Mariani and Chris Aspland is an exploration of Alice and her wonderland. Each artist approaches the subject from a different perspective – Mariani’s work has a strong feminist theme and Aspland’s an unusual take on tea parties.

Even though their works are different, they have combined their strengths – one focusing

Steps Gallery 03 9650 3577 • [email protected] miesf.com.au/steps-gallery on modern figurative and the other contemporary still life. Mariani starts from a patterned base working her subject into the pattern; Aspland creates the pattern onto her work. Both work in mixed media to create quirky images of an alternative wonderland.

19 - 30 July 2018 Daily 10am - 4pm Opening Thursday 19 July, 6-8pm

Quadrant Gallery www.quadrantgallery.com.au

72 Barkers Road Hawthorn 3122 www.quadrantgallery.com.au Tues - Sat 10am - 4pm Phone: 03 9079 0943

Melbourne 93 Gallerysmith The Ian Potter Museum of Art 170-174 Abbotsford Street, North Melbourne 3051. The University of Melbourne, Swanston Street T (03) 9329-1860. E [email protected] (between Elgin and Faraday streets), Parkville 3010. W www.gallerysmith.com.au H Tues-Sat 11.00 to T (03) 8344-5148. E [email protected] 5.30. To July 21 Limen by Adriane Strampp, and W www.art-museum.unimelb.edu.au Director: Kelly Woodland by Fiona Hiscock. July 26 to Sept 1 Gellatly. Free entry. H Tues-Fri 10.00 to 5.00, Sat-Sun (opening Sat July 28, 4-6pm) Pedestal by Belinda 12.00 to 5.00. To July 1 Stieg Persson: Polyphonic. Fox. Also, Blue Silence by Ian Friend. Also, Meredith Turnbull: Closer. To Sept 30 Liquid Form: Ancient and contemporary glass. July 24 to Oct 28 State of the Union, and Eavesdropping. Langford 120 120 Langford Street, North Melbourne 3051. T (03) 9328-8658. E [email protected] W www.langford120.com.au Directors: Irene Barberis and Wilma Tabacco. H Thurs-Sat 12.00 to 5.00, Sun 12.00 to 5.00. June 30 to July 29 (opening Sat June 30, 2-4pm) Hexa by Gordon Monro, and A Peripatetic View by Linda Pickering (see ad page 89). Also, Written by Sophia Errey. The Larwill Studio 48 Flemington Road, Parkville 3052. T (03) 9032- Fiona Hiscock, earthenware vases Courtesy the artist and Gallerysmith 9111. W www.artserieshotels.com.au/larwill A boutique hotel in Melbourne’s north dedicated to the work of Australian artist David Larwill.

The Australian National Brooch Show 2018 Contemporary Art Society of Victoria Inc.

A showcase exhibition of small wearable contemporary artworks, created in a diverse range of media by artists from across Australia. All for sale! Average price $20 - $60 Belinda Fox, Pedestal, 2018, watercolour, drawing, collage, stamping on board, 110 x 100cm Courtesy the artist and Gallerysmith Fitzroy: 6 July - 31 August Fitzroy Library, 128 Moor St, Fitzroy George Paton Gallery Open every day. See website for hours. Second floor, Union House, University of Melbourne 3010. T (03) 8344-5418. Special event: “Try & Buy” E [email protected] Saturday 7 July, 11am - 1.00pm W www.union.unimelb.edu.au/georgepaton H Mon-Fri 11.00 to 5.00. 03 9428 0568 or 0407 059 194 [email protected] See all works online at end of exhibition: www.contemporaryartsociety.org.au

94 Melbourne Noel Shaw Gallery University of Melbourne Fitzroy Level 1, Baillieu Library, University of Melbourne, Parkville 3053. W www.library.unimelb.edu.au/ exhibitions/dark-imaginings H Mon-Fri 10.00 to 5.00. Collingwood To July 31 Gothic imaginings: gothic tales of wonder – this exhibition traces Gothicism from the mid-1800s to the end of the 19th century. Abbotsford Alcaston Gallery 11 Brunswick Street, Fitzroy 3065. T (03) 9418- 6444 F 9418-6499. E [email protected] W www.alcastongallery.com.au Director: Beverly Knight (approved to value Aboriginal paintings, ceramics, sculpture, textiles and artefacts for the Cultural Gifts Program). H Wed-Sat 11.00 to 5.00, or by appt. June 27 to July 14 Tiger Yaltangki: Rock n Roll. Also, Artists from Balgo Hills: An Archive Survey. July 25 to Aug 25 Artists from the APY Lands Art Centre Collective. Australian Catholic University Gallery 26 Brunswick Street, Fitzroy 3065. W www.acu.edu.au July 7 to 8 For Those Who Came In Late paintings, prints, pasteups and zines by Dr Kevin G Rowley (1964-2016). www.townofasylum.tumblr.com Australian Galleries 35 Derby Street, Collingwood 3066. T (03) 9417-4303 F 9419-7769. E [email protected] Bernhard Siegfried Albinus (1697-1770), author, anatomist, Tables of the skeleton and muscles of the human body W www.australiangalleries.com.au Director: Stuart London: Printed by H. Woodfall for John and Paul Knapton, 1749 Purves AM. H Daily 10.00 to 6.00. To July 15 John Brownless Medical Collection Anderson. July 24 to Aug 12 Inner Logic by Dale Cox Courtesy Noel Shaw Gallery, University of Melbourne (see ad page 15). Also, Condolence: 27 Drawings by Peter Wegner (see ad page 11). RMIT Project Space / Spare Room Australian Galleries RMIT Building 94.2, 23-27 Cardigan Street, Carlton Stock Rooms 3053. T (03) 9925-4971. E [email protected] 28 Derby Street, Collingwood 3066. W intersect.rmit.edu.au Free entry, wheelchair access. T (03) 9417-2422 F 9417-3433. H Wed and Fri 10.00 to 5.00, Thurs 10.00 to 8.00, E [email protected] Sat 12.00 to 4.00. June 29 to Aug 9 (opening Thurs W www.australiangalleries.com.au June 28, 5-7pm) Project Space: Selected works Director: Stuart Purves AM. H Daily 10.00 to 6.00. from Martumili – Nora Wompi, Nora Nungabar and To July 15 Sculpture, paintings, drawings and prints Bugai Whyoulter, curated by Dr Damian Smith. Spare by Kevin Mortensen. July 24 to Aug 12 Cocktail by Room: Chloe Bartram, curated by Dr Damian Smith. Annette Bezor. Steps Gallery 62 Lygon Street, Carlton South 3053. T (03) 9650- 3577. W miesf.com.au/steps-gallery H Daily 10.00 to 4.00. July 19 to 30 (opening Thurs July 19, 6-8pm) Curiouser and Curiouser by Leah Mariani and Chris Aspland. See ad page 93.

Melbourne 95 Australian Print Workshop Fox Galleries 210 Gertrude Street, Fitzroy 3065. 79 Langridge Street, Collingwood 3066. T (03) 9419-5466. E [email protected] T (03) 8560-5487. E [email protected] W www.australianprintworkshop.com Director: Anne W www.foxgalleries.com.au H Tues-Sat 10.00 to Virgo OAM. Free entry. H Tues-Sat 10.00 to 5.00. 6.00. To July 14 The Female Gaze by Esther Erlich. To July 28 APW George Collie Memorial Award July 19 to Aug 11 The Unstable Image by Exhibition. Australian Print Workshop is delighted Mark Dustin. to announce the 2018 APW George Collie Memorial Award recipients: Graham Fransella and Euan Heng. These original limited edition fine art prints showcase the artists’ significant and enduring contributions to the field of contemporary Australian printmaking. BlackCat Gallery 95 Johnston Street, Collingwood 3066. T (03) 9913-5833 , 0413-584-829. E [email protected] W www.blackcatgallery.com.au H Wed-Sun 12.00 to 5.00. July 4 to 15 (opening Fri July 6, 6-8pm) Paris Tremayne, Marc Tremayne and George Diamandis. July 18 to 29 (opening Fri July 20, 6-8pm) Stacey Korfiatis (Emerge in Yara 2018). Esther Erlich, Epic, 2012-2017, acrylic on canvas, 137 x 183cm Courtesy the artist and Fox Galleries Brunswick Street Gallery Level 1, 322 Brunswick Street, Fitzroy 3065. in.cube8r gallery & emporium T (03) 8596-0173. 321 Smith Street, Fitzroy 3065. T 0414-736-659. E [email protected] W incube8r.com.au H Mon-Wed 11.00 to 5.00, W www.brunswickstreetgallery.com.au Thurs-Sat 11.00 to 6.00, Sun 12.00 to 4.00, closed H Tues-Sun 10.00 to 6.00, Fri 10.00 to 8.00. public hols. June 29 to July 4 (openings Thurs June 28 and Tues July 5, 6-8pm) Alkanofer Collective – a Cambridge Studio Gallery group show of Alkanofer Collective Members. July 13 52 Cambridge Street, Collingwood 3066. to 24 (opening Thurs July 12, 6-8pm) Idol a show of T (03) 9486-0169, 0413-537-532. wonderful fan art. July 27 to Aug 7 (opening Thurs E [email protected] July 26, 6-8pm) Galactic – join us – fellow space- W www.cambridgestudiogallery.com.au cadets – as we travel to outerspace together. H Wed-Sun 12.00 to 5.00. To July 15 Life Abstracted 2018 – Cambridge Studio’s annual 2D Modern Times abstract competition open to Australian artists. July 311 Smith Street, Fitzroy 3065. T (03) 9913-8598. 25 to Aug 12 Still Life, a solitary gaze by Lawrie E [email protected] Groom and Jennifer Vandeleur – an exhibition of oil W www.moderntimes.com.au H Mon-Fri 10.00 paintings that depicts the interplay of objects with to 6.00, Sat 10.00 to 5.00, Sun 11.00 to 5.00. shadows, shapes and colours. July 12 to 26 Relics Todayy – Ella Bendrups, Dá a Ceramics (Hana Vasak), Hearth Collective (Alicia van Chapman & Bailey Rhiji) (NSW), Nicolette Johnson (QLD), Tessy King, 350 Johnston Street, Abbotsford 3067. Claudia Lau, Peta Marie and Zhu Ohmu. T (03) 9415-8666 F (03) 9415-8811. E [email protected] W www.chapmanbailey.com.au H Mon-Fri 10.00 to 5.00, Sat 10.30 to 4.00. July 4 to 28 HUNTING SEASON by John Prince Siddon. Collingwood Gallery 292 Smith Street, Collingwood 3066. T 0411-650-399. E [email protected] W www.collingwoodgallery.com.au To July 12 Ensemble by Vaughan Prain. Tues-Sun 12.00 to 5.00. July 13 to 26 (opening Fri July 13, 6pm) Illustrators Australia 9x5 Exhibition. Info: 0478-080-200. July 27 to Aug 10 (opening Fri July 27, 1-3.30pm) Wintringham Art Exhibition. Nicolette Johnson, Verdigris (detail), 2018, stoneware with green Info: Larrissa (03) 9376-1122. glaze and manganese oxide, 38 x 28 x 28cm Courtesy the artist and Modern Times

96 Melbourne LIVID LEGISLATION LOVERS LOVERS FOR LIFE LOGOS LOVERS LOVERS LOBBYING LITANY LOVERS LOVERS LOYALT UNLOVING LOVE VERS LACRIMA ER VERITATIS

2016-2018 Warren Breninger July 14 - August 4. Opening: Sat July 14, 4-6pm CHARLES NODRUM GALLERY www.charlesnodrumgallery.com.au (03) 9427 0140 267 Church Street Richmond Victoria 3121 Nicholas Thompson Gallery Tacit Galleries 155 Langridge Street, Collingwood 3066. 123a Gipps Street (cnr Gipps and Islington streets), T (03) 9415-7882. Collingwood 3066. T 0423-323-188. W www.nicholasthompsongallery.com.au E [email protected] W www.tacitart.com.au H Wed-Sun, 11.00 to 6.00. July 4 to 22 Peter H Wed-Sun 11.00 to 5.00. To July 1 The Exquisite Sharp. July 25 to Aug 12 Rhys Lee. Palette by Celia Bridle and Albert Koomen. To July 15 Peter Newton, Anne Hamalainen, TJ Bateson Port Jackson Press Print Gallery and Craig Daniels. July 4 to 29 (opening Wed July 4, 6.30-8pm) Robyn Burgess, Graham McKenzie, 84 Smith Street, Collingwood 3066. T (03) 9419- Hellen Edwards and Julia Sant Mire. July 18 to Aug 8988. E [email protected] 12 (opening Wed July 18, 6.30-8pm) Pete Gurrie, W www.portjacksonpress.com.au H Wed-Sat 11.00 Wendy Havard & Jacqueline Christians, Terry Beer, to 5.00. Publishers and dealers in limited-edition fine- Mina Shafer and Lana de Jager. See ad page 91. art prints. Established 1975. red gallery Victorian Artists’ Society 430 Albert Street, East Melbourne 3002. contemporary art space T (03) 9662-1484. 157 St Georges Road, North Fitzroy 3068. E [email protected] T (03) 9482-3550. E [email protected] W victorianartistssociety.com.au/exhibitions H Mon to W www.redgallery.com.au H Thurs-Fri 11.00 to Fri 10.00 to 4.00, Sat-Sun 1.00 to 4.00. July 12 to 6.00, Sat-Sun 12.00 to 5.00. July 5 to 22 G1, G2 23 (opening Fri July 13, 7-9pm) Shot In The Heart and G3: PaPeRcuTz works on paper. July 25 to Aug Of Melbourne – an exhibition of Street Photography. 12 G1: Dirty Magic by Jessie Balletta and Adam Wilkinson. G2: Thalia Robertson. G3: Erica Bettles and Isabel Koslowsky. Yarra Sculpture Gallery Contemporary Sculptors St Heliers Street Gallery Association Abbotsford Convent (enter via Cam’s Café), 117 Vere Street, Abbotsford 3067. T (03) 9419-6177. 1 St Heliers Street, Abbotsford 3067. H Mon 8.00 E [email protected] to 4.00, Tues-Thurs 8.00 to 9.00, Fri-Sat 8.00 to W yarrasculpturegallery.com.au H Thurs-Sun 11.00 11.00, Sun 3.00 to 9.00. July 13 to 24 (opening to 4.00. June 29 to Aug 11 The Yarra Sculpture July 13, 6-8pm) Hearing it for Silence a solo Gallery’s Winter Residency Program – Pimpisa exhibition of ceramic lighting and drawings by Tinpalit, Katy Bowman and International Taiwanese Sarah Tracton. [email protected], Artists from the National Taipai University: Professor www.sarahtracton.com Boris Kuo, Ching Chen Wu, Bi Lan Zhang, Sin Yu Lien and Yi Long Chen. The Winter Residency Program will run from the June 29 until Aug 11. The Sutton Gallery Gallery will be closed during this period as the artists 254 Brunswick Street, Fitzroy 3065. use the space before presenting their artist talks on T (03) 9416-0727 F 9416-0731. Sat Aug 11, 12-2pm. See ad page 98. E [email protected] W www.suttongallery.com.au H Tues-Sat 11.00 to 5.00. To July 28 Amanda Marburg.

WINTER RESIDENCY PROGRAM Artists: Katy Bowman 29 June - 11 Aug 2018 Pimpisa Tinpalit International Taiwanese Artists from the ARTIST TALKS: National Taipai University, Saturday, 11 August Professor Boris Kuo 12 - 2pm Ching Chen Wu YSG - Yarra Sculpture Gallery Bi Lan Zhang Gallery Hours: Thurs - Sun, 11am - 4pm Sin Yu Lien 117 Vere Street, Abbotsford VIC 3067 [email protected] Yi Long Chen yarrasculpturegallery.com.au

98 Melbourne 1938. July 6 to Aug 31 The Australian National Brooch Show 2018 at Fitzroy Library: 128 Moor Brunswick Street, Fitzroy (see ad page 94). At Decoy Café & Gallery, 303 Exhibition Street, Melbourne: to July 19 Contemporary Showcase 22. July 23 to Oct 18 Northcote Contemporary Showcase 23. Arts Project Australia Niagara Galleries 245 Punt Road, Richmond 3121. T (03) 9429-3666. 24 High Street, Northcote 3070. T (03) 9482-4484 E [email protected] F 9482-1852. E [email protected] W www.niagaragalleries.com.au Director: William W www.artsproject.org.au H Mon-Fri 9.00 to 5.00, Nuttall (member of ACGA). H Tues-Fri 11.00 to Sat 10.00 to 5.00. 6.00, Sat 12.00 to 5.00 or by appt. July 3 to 28 Sometime/somewhere by Euan Heng. Also, 18 Counihan Gallery In Brunswick Hours & 674 Days by Steven Rendall. Also showing 233 Sydney Road, Brunswick 3056. T (03) 9389- in our stockroom: Rick Amor, Glenn Barkley, Terry 8622. E [email protected] Batt, Stephen Benwell, Tony Bevan (UK), Angela W www.moreland.vic.gov.au/counihan-gallery Brennan, Robert Bridgewater, Paul Boston, Gunter Free entry. H Gallery: Wed-Sat 11.00 to 5.00, Sun Christmann, Julie Ciccarone, Brenda L. Croft, Harry 1.00 to 5.00. Office: Wed-Sat 11.00 to 5.00. To Dixon Mptyane, Julia Dowling, Fiona Foley, Star July 8 A Widening Gap: The Intervention 10 Years Gossage (NZ), Michelle Grabner (US), Malaluba On. Curated by Jo Holder and Djon Mundine OAM. Gumana, Rubaba Haider, Dale Hickey, Dianne Jones, July 20 to Aug 19 (opening Thurs July 19, 6-8pm) Jennifer Joseph, David Keeling, Yvonne Kendall, Gallery one: The Dreamers by Kirstin Berg. Gallery Richard Larter, Kevin Lincoln, Song Ling (CN), Travis Two: Almost Like A Reality: The Landscape and its MacDonald, Euan Macleod, Helen Maudsley, Noel Subjects by Simon Grennan. McKenna, Sean Meilak, Samuel Namunjdja, Lena Nyadbi, Martin Parr (UK), Angelina Pwerle, Hu Islamic Museum of Australia Qinwu (CN), Andreas Ruthi (CH), Jan Senbergs, Neil Taylor, Savanhdary Vongpoothorn, Wukun Wanambi, 15 Anderson Road, Thornbury 3071. Wolpa Wanambi, Bradd Westmoreland, Ken T 1300-915-171. W islamicmuseum.org.au Whisson, Helen Wright and Liu Zhuoquan (CN). H Tues-Sat 10.00 to 4.00. Tinning Street Presents Lot 5/29 Tinning Street, Brunswick 3056. E [email protected] W tinningstreetpresents.com H Thurs-Sun 11.00 to 5.00. June 28 to July 1 Elise Hurst. July 5 to 15 Speaking to the Surface of a Lake by Rebecca McCauley and Aaron Claringbold. July 19 to 29 Jason Hazel. Richmond Charles Nodrum Gallery 267 Church Street, Richmond 3121. T (03) 9427- 0140. E [email protected] W www.charlesnodrumgallery.com.au Director: Charles Nodrum (member of ACGA). H Tues-Sat 11.00 to 6.00. July 14 to Aug 4 (opening Sat July 14, 4-6pm) Lovers by Warren Breninger. See ad page 97. Contemporary Art Society of Victoria Inc. CAS Inc. PO Box 283, Richmond 3121. T (03) 9428-0568, 0407-059-194. E [email protected] W www.contemporaryartsociety.org.au A non-profit art society run by artists, for artists, established

Melbourne 99 William Mora Galleries The Cullen 60 Tanner Street, Richmond 3121. T (03) 9429-1199. 164 Commercial Road, Prahran 3181. E [email protected] T (03) 9098-1555. W www.artserieshotels.com.au/ W www.moragalleries.com.au Director: William Mora. cullen A boutique hotel featuring original artwork and H Wed-Sat 10.00 to 4.00, or by appt. July 19 to Aug prints by Australian contemporary artist Adam Cullen. 17 (opening Thurs July 19, 6-8pm) A Temptation to Ships recent works by Jane Burton. To be opened Linden New Art by Dr Edward Colless, Head of Critical and Visit Linden New Art In Residence at Domain House, Theoretical Studies, Victorian College of the Arts, Dallas Brooks Drive, South Yarra 3141. University of Melbourne. T (03) 9534-0099. E [email protected] W www.lindenarts.org Director: Melinda Martin. Women’s Art Register H Wed-Sun, 10.00 to 3.00, closed public hols. 1975-2015 July 28 to Sept 2 Wangka Kutjara, Tjukurpa Kutju by Richmond Library, 415 Church Street, Richmond Puna Yanima and Linda Puna. 3121. E [email protected] W www.womensartregister.org Member organisation The Olsen with information on 5,000+ women artists. 637-641 Chapel Street, South Yarra 3141. Supported by the City of Yarra. T (03) 9040-1222. W www.artserieshotels.com.au/ olsen The Olsen is an elegant hotel with suites featuring lyrical works of Australian landscape artist Toorak John Olsen. STATION 9 Ellis Street, South Yarra 3141. T (03) 9826-2470. Sth Yarra E [email protected] W www.stationgallery.com.au H Tues-Fri 11.00 to 5.00, Sat 11.00 to 4.00. To July 21 Shantih shantih shantih – Jon Cattapan, Adam Lee, Sam Martin, Nell, Prahran Tomislav Nikolic, Michelle Ussher and Jake Walker. Alternating Current Art Space (map ref Melway 2L, K12) 248 High Street, Windsor 3181. T (03) 9528-2459. St Kilda E [email protected] W www.alternatingcurrentartspace.com H Thurs-Fri 12.00 to 7.00, Sat-Sun 12.00 to 5.00. Elwood July 6 to 28 Gallery 1: Pictures by Kate Wallace. Gallery 2: The Quieter you are the more you can hear – Andrea Hughes, Kate Walsh and Olga Tsara. Gallery 3: My Mother’s Room by Cathy Muhling. Brighton Gallery 4: Crystallinity by Ann McGinley. The Cupboard: Affirmative Action #2 (Enconium) by Mitchel Brannan. Brightspace 8 Martin Street, St Kilda 3182. T (03) 9593-9366. W www.brightspace.com.au H Wed-Fri 11.00 to 5.00, Sat-Sun 12.00 to 4.00. July 9 to 22 (opening Thurs July 19, 6-8pm) Bright New Day by Richard Claremont. Carlisle Street Arts Space 99a Carlisle Street, St Kilda 3182. T (03) 9209-6777. E [email protected] W www.portphillip.vic.gov.au/carlisle-st-arts-space.htm Free entry. H Mon-Fri 8.30 to 5.00, Thurs 8.30 to 7.00 (during exhibitions). To July 4 Cathy Henenberg: Thread Lines, and Isabel O’Brien: Re-Thought. July 11 to Aug 8 Robert Lee Davis exhibits mixed media works that are reminiscent of early colonial coastal cartographic surveys, while Gabrielle Khazam presents abstract works underpinned by an Olga Tsara, Surface, 2018, oil on canvas exploration of memories and encounters. Courtesy the artist and Alternating Current Art Space

100 Melbourne The Gallery at Bayside Arts MAS Gallery & Cultural Centre 1297-1299 High Street, Malvern 3144. (map ref Melway 67 F10) cnr Wilson and Carpenter T (03) 9822-7813. E [email protected] streets, Brighton 3186. T (03) 9261-7111. W malvernartists.org.au H Daily 11.00 to 4.00 E [email protected] during exhibitions. W bayside.vic.gov.au/gallery, www.facebook.com/ thegalleryatbacc Free entry. H Wed-Fri 11.00 to 5.00, Scott Livesey Galleries Sat-Sun 1.00 to 5.00. Closed public hols. To July 8 909a High Street, Armadale 3143. T (03) 9824-7770. Bayside Acquisitive Art Prize. Bayside Acquisitive Art E [email protected] Prize winner: Moya McKenna. Local Art Prize winner: W www.scottliveseygalleries.com H Tues-Fri 11.00 Georgie Mattingley. July 21 to Sept 9 Freshwater/ to 5.30, Sat 11.00 to 4.00. To July 18 Group Saltwater – contemporary and historical works that Exhibition. July 25 to Aug 11 Vipoo Srivilasa. Aug 2 highlight how water remains central to identity, and to 5 Melbourne Art Fair, Stand D12. to how and where we live. A collaborative exhibition between Shepparton Art Museum and the Gallery at Bayside Arts & Cultural Centre (see ad page 55). Ten Cubed 1489 Malvern Road, Glen Iris 3146. T (03) 9822-0833. E [email protected] Vivien Anderson Gallery W www.tencubed.com.au H Tues-Sat 10.00 to 4.00. Ground Floor, 284-290 St Kilda Road, St Kilda 3182. A private collection of contemporary art, open to the T (03) 8598 9657. E [email protected] general public. June 26 to Sept 8 Pat Brassington – W www.vivienandersongallery.com H Tue-Fri 11.00 to Ten Cubed is excited to announce a new exhibition 5.00, Sat 12.00 to 4.00. Representing and exhibiting by Pat Brassington, it will be the artist’s second Australian Indigenous artists for over 30 years. To with Ten Cubed. Considered one of Australia’s most July 7 Mimih Spirit Figures by Samson Bonson, prominent and influential artists, Brassington will and Mandjabu Bark Paintings by Susan Marawarr exhibit a fresh body of work alongside key pieces in association with Maningrida Arts & Culture, NT. from the collection. With a career spanning four July 25 to Aug 25 Dark Spaces by James Tylor and decades, Brassington is well known for her incisive Hayley Millar-Baker. ability to infuse the familiar with the fantastic. Her practice is informed by an interest in surrealism, feminism and psychoanalysis. Pat Brassington is represented by ARC ONE Gallery, Melbourne, and Armadale Bett Gallery, Hobart. Malvern Artbank 18-24 Down Street, Collingwood 3066. T 1800-251-651. E [email protected] W www.artbank.gov.au H Mon-Fri by appt. A Commonwealth Government art leasing program for contemporary art. Supporting Australian artists. Duldig Studio museum + sculpture garden 92 Burke Road, East Malvern 3145. T (03) 9885-3358. E [email protected] W www.duldig.org.au H Tues, Thurs and second Sat of every month 1.00 to 3.00, or groups by appt. Through July SLAWA: modernist art and design – a Viennese modernist in Melbourne. Firestation Print Studio Gallery (map ref Melway 59 A8) 2 Willis Street, Armadale Pat Brassington, Three Fathoms Deep, 2017, edition of 8, 3143. T (03) 9509-1782. E [email protected] pigment print W www.fps.org.au H Wed-Sat 11.00 to 5.00. Courtesy the artist, ARC ONE Gallery, Melbourne and Ten Cubed To July 15 (opening Wed June 27, 6-8pm with talk by Kate Gorringe Smith) Overwintering Project with Migaloo Press, Queensland. Members’ show.

Melbourne 101 Quadrant Gallery Hawthorn (map ref Melway 45 A8) 72 Barkers Road, Hawthorn 3122. T (03) 9079-0943. E [email protected] East & West Art W www.quadrantgallery.com.au H Tues-Sat 10.00 665 High Street, East Kew 3102. T (03) 9859-6277. to 4.00. June 28 to July 21 Three Painters – Clive E [email protected] Sinclair, Peter Smales and Maxwell Wilks. This W www.eastwestart.com.au Director: Marjorie Ho. exhibition is a celebration of the friendship between H Mon-Fri 11.00 to 5.30, Sat 11.00 to 4.30. Sinclair, Smales and Wilks. These contemporary Specialists in Asian Fine Arts and Antiques. July 12 representation painters are all members of the Twenty to Aug 31 Earth and Sea by Louise Foletta paintings Melbourne Painters Society, which is celebrating its and Glenys Hazelman potter. 100 year anniversary. These recent works show their enduring shared love of painting. See ad page 93. Eastgate Gallery Dealers in Fine Art 158 Burwood Road, Hawthorn 3122. T (03) 9818-1656. E [email protected] W www.eastgatejarman.com.au H Mon-Fri 9.00 to 5.00, Sat 10.00 to 4.00. A Selection of traditional, abstract, and contemporary art from leading Australian artists past and present. Hawthorn Studio & Gallery 635 Burwood Road, Hawthorn East 3123. T (03) 9882-5553. E [email protected] W www.hawthornstudiogallery.com.au H Tues-Sat 11.00 to 4.30. To July 7 Aspects Of Nature a group exhibition of oil paintings – Caroline Calway, Laurel Foenander, John Graham, Margaret McLoughlin, Annette Smeeton and Wendy Steer. July 25 to Aug 4 (opening Sat July 25, 3-5pm) Created World, Made World a collaborative exhibition of sculptures by wood artist Gary Male and glass artist Peter Toyne.

Peter Smales, Watching Waves – Corio Bay, 30 x 20cm Courtesy the artist and Quadrant Gallery Town Hall Gallery 360 Burwood Road, Hawthorn 3122. T (03) 9278- 4626. E [email protected] W boroondara.vic.gov.au/arts H Tues-Fri 10.00 to 5.00, Sat-Sun 11.00 to 4.00, closed Mon and public hols. July 7 to Aug 26 Main Galleries: Unknown, Untitled – four contemporary artists have been commissioned to create new work based on the historical and civic items in the Town Hall Gallery Collection. The exhibition features items from the collection alongside the new works they inspired, promising viewers a new way of seeing historical works and cultural objects. Also, Yesterday, Today and Tomorrow – Hawthorn Historical Society brings you an exhibition of historical photographs, memorabilia and items from the Town Hall Gallery Collection, which Gary Male and Peter Toyne, sculpture, 2018, wood and glass celebrate the many ways in which this building has Courtesy the artists and Hawthorn Studio & Gallery

102 Melbourne Melbourne 103 been a part of the community and adapted to the Lauraine Diggins Fine Art changes in society since the 19th century. August 5 Malakoff Street, North Caulfield 3161. 2018 marks 130 years since the foundation stone T (03) 9509-9855. E [email protected] was laid at the former Hawthorn Town Hall, now W www.diggins.com.au H Tues-Fri 10.00 to 6.00, Hawthorn Arts Centre. July 3 to 29 Community and during exhibitions Sat 1.00 to 5.00, or by appt. Project Wall: felt – Victorian Feltmakers Inc – features Specialists in Australian colonial, impressionist, diverse works created by members of the Victorian modern, contemporary and Indigenous painting, Feltmakers Inc, including wearable art, jewellery, sculpture and decorative art. Sourcing European sculptures, wall hangings and framed works. masterworks on request.

Paul Partos, Equivocal Actor, 1965, oil on canvas, 133 x 122cm Courtesy Lauraine Diggins Fine Art MADA Gallery Sabrina Croswaith, Exploring, 2017, prefelts, hand stitched in wool, 42 x 52cm Monash University, © the artist ϐ Courtesy the artist and Town Hall Gallery Building D, Ground Floor, 900 Dandenong Road, Caulfield East 3145. E [email protected] W www.artdes.monash.edu/gallery Free entry. H Wed-Fri 10.00 to 5.00, Sat 12.00 to 5.00 during ϐ exhibitions. June 27 to Aug 6 Representation, Remembrance and the Memorial – including artworks by Brook Andrew, the London-based Mauritius artist Shiraz Bayjoo, and interview Elsternwick recordings with Indigenous scholar Professor Marcia Langton, American architect Peter Eisenman and Glen Eira City Council Gallery scholar of cultural memory, Andreas Huyssen. Cnr Glen Eira and Hawthorn roads, Caulfield 3162. Curated by Brook Andrew and Dr Jessica Neath. T (03) 9524-3402. W www.gleneira.vic.gov.au MADA Gallery – call for proposals for 2019 now open. Curator: Diane Soumilas. Free admission. H Mon-Fri See website for more details. 10.00 to 5.00, Sat-Sun 1.00 to 5.00, closed public hols. To July 8 The Storytelling Machine. July 12 to 29 Beyond, A Century’s Love II by Jenny Zhe Chang. Also, Remembering Yosl Bergner.

104 Melbourne

ArtSpace at Realm Moorabbin 179 Maroondah Highway, Ringwood 3134. T (03) 9298-4545. E [email protected] W www.artsinmaroondah.com.au H Mon-Fri 9.00 to Highett 8.00, Sat-Sun and public hols 10.00 to 5.00. To July 15 Monuments to the everyday – Carly Bayside Sculpture Fischer, Kenny Pittock and Nathan Taylor. 16B Advantage Road, Highett 3190. T (03) 9553- 0661. E [email protected] Belgrave Creative Space W www.baysidesculpture.com.au H Daily 11.00 to 1658a Burwood Highway, Belgrave 3160. 5.00. Term 3: eight-week Sculpture Classes beginning T 0425-831-425. W www.belgravecreativespace.com July 23, 24 and 25. Space for hire: workshops, forums, exhibitions, classes, private tuition, performances, rehearsals and March Space art projects. 5 Waltham Street, Sandringham 3191. T 0413-685-488. E [email protected] Bolin Bolin Gallery Director: Gang Liu. H Tues-Sun 10.00 to 5.00. at Bulleen Art & Garden Facebook: @marchspacegallery 6 Manningham Road West, Bulleen 3105. T (03) 8850-3030. W www.gallery.baag.com.au H Daily 9.00 to 5.00. To July 3 Found sculpture, mosaics, assemblage. July 6 to Aug 19 (opening Greater Sun July 15, 3-5pm) Whispers in the Wild Woods ceramic sculpture by Christen Jo Stone. Melbourne Box Hill Community Arts Centre 470 Station Street, Box Hill 3128. T (03) 9895-8888. Art at Linden Gate E [email protected] 899 Healesville-Yarra Glen Road, Yarra Glen 3775. W www.bhcac.com.au H Mon-Fri 9.00 to 5.00, T (03) 9730-1861. E [email protected] call for w’end hours. July 3 to 15 (opening Tues W www.artatlindengategallery.com.au H Fri-Mon July 3, 7-9pm) Fabulous Fakes – Whitehorse Arts 10.00 to 5.00 (including public hols, except Dec 24 Association. July 17 to 29 (opening Mon July 16, and 25). June 29 to July 30 (opening Sat June 30, 6-8pm) Winter Warmers – Alcove Art Shop. July 31 2-4pm) Yarra Valley Arts – Member Exhibition. to Aug 19 Snapshots by Jesse Marlow. Bundoora Homestead Art Centre 7 Prospect Hill Drive, Bundoora 3083. T (03) 9496- 1060. E [email protected] W www.bundoorahomestead.com Free admission. H Thurs-Sun 10.00 to 5.00. To July 29 One on One – Chris Bahng, Katie Collins, Anna Davern, Mark Edgoose, Hendrik Forster, Wanda Gillespie, Annie Gobel, Wendy Korol and Claire McArdle. Curated by Olivia Poloni. Also, Craft Lab+ – if you’re into knitting, macramé, quilting, embroidery, tapestry, patchwork, felting or any other textile-based craft then come and be part of Craft Lab+ by taking up residence at Bundoora Homestead Art Centre until July 29, and help create a community of crafters. A ten-week program of free facilitated craft classes will be run by craft specialist Ramona Barry, and all works created will be part of the exhibition at the Homestead galleries until July 29.

Kerryl Shirley, Jean, acrylic on board Courtesy the artist and Art at Linden Gate

106 Melbourne Call for Applications Applications are now being accepted for the eleventh annual Tesselaar Sculpture Prize, a professionally among the curated competition for outdoor sculpture. The Tesselaar Sculpture Prize exhibition will be part of the annual Tesselaar Tulip Festival held in the Dandenong Ranges and attracting Tesselaar SculpturSculpturee PrPrizeize 2012018 60,000 visitors between 15th September and 14th October 2018. $20,000 The Tesselaar Sculpture Prize is an Acquisitive Award of $20,000 presented by Tesselaar and Applications close on Friday, the Association of Sculptors of Victoria 3rd August 2018. Guidelines and Application Forms can be obtained from the curator: Mark Cowie on [email protected] or at PO Box 1086, Daylesford 3460.

www.tulipfestival.com.au

Melbourne 107 Burrinja Gallery Eltham Library (map ref Melway 75 B12) Burrinja Cultural Centre, Community Gallery 351 Glenfern Road, Upwey 3158. T (03) 9754-8723. (map ref Melway 21 J5) 1 Panther Place, Eltham E [email protected] W www.burrinja.org.au 3095. T (03) 9433-3175. H Tues-Sun 10.00 to 4.00. E [email protected] W nillumbik.vic.gov.au/Living-in/Arts-and-Cultural- Deakin University Art Gallery at Development H Mon-Thurs 10.00 to 8.30, Fri-Sat Melbourne’s Burwood Campus 10.00 to 5.00, Sun 1.00 to 5.00, closed public hols. To July 2 Legacy – Dunmoochin Artist Collective. 221 Burwood Hwy, Burwood 3125. July 5 to Aug 6 Get Squished – Squish Art Collective. T (03) 9244-5344. E [email protected] Squish is a collective of young artists based in and W deakin.edu.au/art-collection/ Free admission. around Eltham. Squished, their debut exhibition, H Tues-Fri 10.00 to 4.00 during exhibitions, will feature a range of artworks featuring different closed public hols. To July 13 Boneta-Marie Mabo: materials and processes. All colourful. All new. All Immersed – a collection of portraits by Boneta- striving to convey a message. Marie Mabo of First Nations women that celebrates resistance against patriarchal colonialism. Each woman presents herself as she wants you to see her. Gate 6 Gallery The portraits offer a glimpse of individual resistance, Gate 6, Cardinia Street, Berwick 3806. power and beauty. July 25 to Aug 26 Wearing Your W secan.com.au Free entry. H Sat-Sun 11.00 to Heart On Your Sleeve – in 1818, Mak Sai Ying 5.00. July 8 to 29 (opening Sat July 7, 4-5.30pm) arrived in Sydney, as the first known migrant of Strip Art. Chinese descent – the start of a 200-year journey of the Chinese community in Australia. At the 200th Gee Lee-Wik Doleen Gallery anniversary of Mak Sai Ying’s arrival the Australian population now comprises over 1.2 million Chinese at Hume Global Learning Centre Australians – a community that has influenced the Craigieburn evolution of contemporary Australian Society and, in (map ref Melway 386E-F7) 75-95 Central Park the future, will play a pivotal role in the shaping of Avenue, Craigieburn 3064. T (03) 9356-6117. Australia as a nation, particularly in its engagement E [email protected] with the Asia Pacific region. Deakin University is W www.hume.vic.gov.au/gallery H (refer to website). celebrating this bicentenary by staging an exhibition To Aug 5 Behind the Wire – They Cannot Take The called Wearing Your Heart On Your Sleeve –a Sky: Stories From Detention – an award-winning oral journey about a personal and collective identity history project documenting stories of people who reflected through the garments Chinese Australians have been detained by the Australian government have worn over the past 200 years in Australia. after seeking asylum in Australia. Developed in partnership with Museum of Chinese Australian History. Heide Museum of Modern Art 7 Templestowe Road, Bulleen 3105. T (03) 9850- 1500. W www.heide.com.au H Tues-Sun 10.00 to 5.00. To Aug 19 EuroVisions: Contemporary Art from the Goldberg Collection. To Aug 26 After Dark: Nocturnes from the Heide Collection. To Oct 7 Design For Life: Grant and Mary Featherston. To Nov 11 Heide I: House of Ideas. Heritage Hill Museum and Gardens 66 McCrae Street, Dandenong 3175. T (03) 9793-4511. E [email protected] W www.heritagehill.com.au Free entry. H Tues-Fri Wedding portrait of Sam Chung Gon and Queenie Young in Sydney, 10.00 to 4.00. To July 13 My Dandenong, My Story. c1920s Also, Shaping Greater Dandenong. Donated by Frank Chinn, Chinese Museum Collection Courtesy Deakin University Art Gallery

108 Melbourne Melbourne 109 Incinerator Gallery Kosnar’s Picture Framing (map ref Melway 28 D7) 180 Holmes Road, Moonee 488 Mount Alexander Road, Ascot Vale 3020. Ponds 3039. T (03) 8325-1750. T (03) 9370-5744. W www.kosnar.com.au E [email protected] We offer a large range of frame styles for the artist and W www.incineratorgallery.com.au Free entry. collector. Expert advice in framing design for all types H Tues-Sun 11.00 to 4.00. To July 29 standing still; of artwork. looking back, looking forward – a celebration of First Nations identities today, yesterday and tomorrow Manningham Art Gallery featuring new works by Dean Cross, Brad Darkson, Manningham City Square (MC ), 687 Doncaster Amala Groom & Nicole Monks, Ashley Perry and Road, Doncaster 3108. T (03) 9840-9367. Katie West. Curated by Jessica Clark. Also, Atrium: E [email protected] The Patterns of Displacement by Rushdi Anwar. W www.manningham.vic.gov.au/manningham-art- To July 15 Boadle Hall Community Gallery: Calligraphic gallery Free entry. H Tues-Sat 11.00 to 5.00. Media by Hugh Davis and Yoko Nakazawa. July 11 to Aug 11 Full Circle by Karen Standke – an exhibition of new work by Standke inspired by recent travels around Australia and her impressions of its landscape gained over the last two decades. Standke’s paintings are informed by thorough research into the changing face of the landscape, the impact of climate change and the introduction of weeds and non-native fauna and flora. The work in this show focuses on visible and rapid changes in the environment and raises questions around how we respond emotionally, but also practically, to these challenges.

Katie West, Body remembering – grinding stone (work in development) (detail), 2018, installation, dimensions variable Courtesy the artist and Incinerator Gallery Joel Gallery 5 Sargood Street, Altona 3018. T (03) 9398-2511. E [email protected] W www.ljac.com.au H Mon-Fri 10.00 to 4.00, Sat-Sun 11.00 to 3.00. Joel Gallery is a contemporary exhibition space hosting a diverse program of visual arts exhibitions by professional and community artists. ljac.genesisperpetual.com.au

Karen Standke, Amoonguna Landscape III (drift), 2015, oil on canvas, 183 x 137cm Photograph: Tim Gresham Courtesy the artist and Manningham Art Gallery

110 Melbourne Maroondah Access Gallery showcases recent work by some of Australia’s leading artists working in the field of drawing, 32 Greenwood Avenue, Ringwood 3134. printmaking and digital media. This diverse exhibition T (03) 9298-4545. provides a survey of contemporary practice across E [email protected] Australia today. W www.artsinmaroondah.com.au H Mon-Fri 9.00 to 5.00, closed w’ends and public hols. To July 13 Arts from the village: seasons in our environment – Sherbrooke Art Gallery members of the Gifford Arts Program. 62 Monbulk Road, Belgrave 3160. W www.sherbrookegallery.com H Daily 11.00 to 4.00 Monash Gallery of Art (MGA) (closed Tues). July 28 to Aug 12 (opening Sat July 28, 7pm) Lionel Gell Art Awards – art exhibition of 860 Ferntree Gully Road, Wheelers Hill 3150. Rolls Royce and Bentley Cars. Presented by Sir Henry E [email protected] W www.mga.org.au Royce Foundation of Australia. See ad page 103. H Tues-Fri 10.00 to 5.00, Sat-Sun 12.00 to 5.00, closed public hols. To July 15 TopSHOTS: photomedia work by VCE Art, Media & Studio Arts students. To July 22 LEGACY. Your collection. Our story. Mornington Peninsula Regional Gallery (MPRG) (map ref Melway 145 G4) Civic Reserve, Dunns Road, Mornington 3931. T (03) 5975-4395. E [email protected] W mprg.mornpen.vic.gov.au H Tues-Sun 10.00 to 5.00. July 20 to Sept 9, 2018 National Works on Paper. The National Works on Paper is one of the most prestigious acquisitive prize exhibitions of its Stephen Park, Bentley, 2012, acrylic, 90 x 71cm type in Australia. The 2018 National Works on Paper Second prize winner of the Sir Henry Royce Foundation of Australia Awards 2012 Courtesy the artist and Sherbrooke Gallery

Melbourne 111 TarraWarra Museum of Art multiculturalism. The photo series, presented by AMES Australia in collaboration with the Victorian (map ref Melway 277 B2) 313 Healesville-Yarra Multicultural Commission, has been gathered by a Glen Road, Healesville 3777. T (03) 5957-3100. group of young migrant and refugee photographers. W www.twma.com.au Adults $10, seniors $8, Gallery Two: Women helping women by concession $5, free entry for children 12 and under. Evangeline Cocherino. H Tues-Sun 11.00 to 5.00. Visit website for public programs and events. To July 15 Edwin Tanner: Mathematical Expressionist. Also, James Hullick: Whitehorse Artspace THE ARBOUR and THE ORRERY. Box Hill Town Hall, 1022 Whitehorse Road, Box Hill 3128. T (03) 9262-6250. Walker Street Gallery E [email protected] W www.whitehorseartspace.com.au H Tues-Fri 10.00 & Arts Centre to 4.00, Sat 12.00 to 4.00. To July 28 Home Is (map ref Melway 90 D8, E7) Cnr Walker and Where The Heart Is by Dean Bowen. It is at home, Robinson streets, Dandenong 3175. and more particularly in his studio, that Bowen has T (03) 9706-8441. E [email protected] created an abundance of artworks that resonate with W www.walkerstgallery.com.au H Tues-Fri 11.00 love. From small sculptures to gigantic paintings of to 5.00, Sat 11.00 to 3.00, closed Sun, Mon and houses and skyscrapers, Bowen demonstrates the public hols. Walker Street Gallery & Arts Centre is importance of ‘home’ to our wellbeing. South Eastern Melbourne’s premier art centre. To July 21 Gallery One & Two: Paperbark Tales by Wendy Grace – a series of works on paper displaying delicate patters and contours based on the artists lived experience at Heritage Hill Museum and Historic Gardens. July 26 to Aug 18 Gallery One: Heartlands 2018 – Stories from 70 years of migration – a photography exhibition asking the nation defining question: ‘What makes an Australian?’ Heartlands 2018 celebrates 70 years of diverse migration to Australia, from the first wave of non-Anglo migrants n the aftermath of World War II to our present day 2018 ANL MARITIME ART AWARDS Dean Bowen, The House of Love (Small Version), 2016, bronze, edition 9, 21 x 25 x 8.5cm Courtesy the artist and Whitehorse Artspace @ Mission to Seafarers Victoriaa Call out to Artists to respond to the theme Yarra Ranges Regional Museum ‘the Relationship of Humanity to the Sea’ 35-37 Castella Street, Lilydale 3140. T (03) 9294- 6313. E [email protected] ENTRIES OPEN 1ST JUNE W ach.yarraranges.vic.gov.au Free entry. CLOSE 31 AUGUST H Daily 10.00 to 4.00, closed public hols. Over $25,000 prize money in 5 categories Yering Station Art Gallery A unique cultural event in Docklands, Melbourne 38 Melba Highway, Yarra Glen 3775. T (03) 9730- 0102. E [email protected] W www.yering.com Contact: Dr Ewen Jarvis. H Mon-Fri 10.00 to 5.00, Sat-Sun 10.00 to 6.00. To July 15 Winery Viewing Gallery: From this Place by Angela Rivas and Lindy Schneider. July 4 to Aug 5 Main Gallery: Nevermore by Brenda Page. July 17 to Oct 7 Winery Viewing Gallery: The Stillest Hour: Reimagining Victoria’s Highland Forests by Chris Taylor.

For details and entry T’s & C’s www.missiontoseafarers.com.au/anl-art-prize [email protected] Image: 2017 MAA Winner, Ted Dansey

112 Melbourne Moving Art, quickly & safely.

• Regional and interstate transport • Weekend bookings ART HUNTER • Short notice trips • Art Installation

0404 434 008 • arthunter.com.au • [email protected]

Melbourne 113 Victoria

114 McClelland Sculpture Park Mornin on + Gallery (map ref Melway 103 E3) 390 McClelland Drive, Peninsu a Langwarrin 3910. T (03) 9789 1671. E [email protected] W www.mcclellandgallery.com Director: Lisa Byrne. FrankstonArts Centre Entrybydonation. H Gallery, shop and café Tues-Sun and Cube 37 Galleries 10.00 to 5.00. 27 37 Davey Street, Frankston 3199. T (03) 9784 1896. W www.thefac.com.au Free Entry. H Tues Fri Merricks House Art Gallery 9.00 to 5.00, Sat 9.00 to 2.00. Art After Dark every 3460 Frankston Flinders Road, Merricks 3961. evening from dusk. Opening Fri June 29, 5pm FAC T (03) 5989 8088. E [email protected] Curved Wall Gallery: Baluk Arts: NAIDOC Week. W www.mgwinestore.com.au H Daily 8.30 to 5.00. Through July Atrium Gallery: Yannick Bauer: North Merricks House is located adjacent to Merricks to South Passage.Cube Gallery: Lifegate: Colour of General Wine Store and showcases talent from both Hope. FAC Mezzanine: Mangkaja Arts: Workson the local Mornington Peninsula Regionaswellas Paper. From July 12 Glass Cube Gallery: Caroline artists from across Australia. Meander through the Grayley & John Noordennen: Full Bloom. garden from the café, bistro, cellar door or deck to discover this hidden gem. Through July Birds in Gordon StudioGlassblowers Habitat 2017-2018 by Sarah Faulkner, and Recent A Working Hot Glass Studio Works by Ann Howie and Gordon Hickmott. & Gallery 290 Red Hill Road (cnr Dunns Creek Road), Red Hill 3937. T (03) 5989 7073. E [email protected] W www.gordonstudio.com.au H Daily 10.00 to 5.00.

Ann Howie, Adelaide, 2018, oil on canvas Courtesy the artist and Merricks House Art Gallery Montalto Sculpture park 33 Shoreham Road, Red Hill South 3937. T (03) 5989 8412. W www.montalto.com.au (member of ACGA) Free entry. H Daily. To Oct 28 Montalto Sculpture Prize 2018.

Victoria 115 Mornington Peninsula Gippsland Art Gallery Regional Gallery (MPRG) 70 Foster Street, Sale 3850. T (03) 5142-3500. Civic Reserve, Dunns Road, Mornington 3931. E [email protected] W mprg.mornpen.vic.gov.au See Melbourne entry for W www.gippslandartgallery.com H Mon-Fri 9.00 to exhibition details. 5.30, Sat-Sun and public hols 10.00 to 4.00. To July 8 Invisible Tendrils, Billowing Threads by Leonie Ryan. To July 15 The Infinite Well: A Retrospective Oak Hill Gallery by Pat Waters. Also, The Ashes of Children by Frank (map ref Melway 145 G10) 100 Mornington-Tyabb Mesaric. To Sept 9 Call of the Wild – Wildlife art from Road (adjacent to the Rose Gardens), Mornington the Gallery Collection. July 14 to Sept 9 Posthumous 3931. T (03) 5973-4299. Tableaux by Michelle Molinari. July 21 to Sept 16 E [email protected] Event Horizon by Peter Gardiner, and Gunailand by W www.oakhillgallery.com.au H Daily 11.00 to 4.00. Steaphan Paton. Permanent Exhibition: The Art of July 1 to 31 Annual Members’ Exhibition. Annemieke Mein. Gippsland South East arc Yinnar Gallery 19 Main Street, Yinnar 3869. T (03) 5163-1310. W www.arcyinnar.org.au H Tues-Fri 12.00 to 4.00, Sat 11.00 to 3.00. July 7 to Aug 4, 2pm (opening Sat July 7, 2pm) Gallery arc: The Latrobe Regional Pat Waters, Triste, 2004, oil on canvas, 22 x 183.5cm Gallery Emerging Artist Award – artists Mira Halpern- Collection Gippsland Art Gallery Donated from the estate of Dianne Webster, 2017 Wilson and Juliette Reeve, final year students at Federation University have been selected by the Gippsland Centre for Art and Design. This exhibition is Latrobe Regional Gallery sponsored by Latrobe Regional Gallery. 138 Commercial Road, Morwell 3840. T (03) 5128- 5700 F 5128-5706. E [email protected] ArtSpace Wonthaggi W latroberegionalgallery.com H Mon-Fri 10.00 to 5.00, Sat-Sun 11.00 to 4.00. To July 8 Moving 1 Bent Street, Wonthaggi 3995. T (03) 5672-5767. Histories // Future Projections. Also, Arrangement. E [email protected] To July 29 Writing in the rain: contemporary W www.artspacewonthaggi.com.au H Daily 10.00 Asian video art from the National Gallery of to 4.00. 2D and 3D contemporary and traditional Victoria. Also, Industry. June 30 to Aug 26 Paint art. To July 23 Winter Solstice Exhibition – Senior County with County by Dennis Seymour. and Junior sections. July 24 to Sept 3 (opening Sun July 21 to Oct 20 Richard Tipping: Art Word, Signs, July 29, 2-4pm) exhibition featuring Sculpture and Drawings, Typographs. 3D artfoms. Gecko Studio Gallery and ArtHouse accommodation 15 Falls Road, Fish Creek 3959. T (03) 5683-2481. E [email protected] W www.geckostudiogallery.com.au Facebook: geckostudiogallery H Thurs-Mon 9.00 to 4.00. Also including Headquarters Café. To July 16 The Work of the Eggs… continued – a unique group exhibition of artist-decorated ostrich eggs. The Gallery and café are then closed, reopening Aug 16.

E. Dennis Seymour, Distant Rocks, 2017, hand ground ochre, 105 x 72cm Collection the artist Courtesy the artist and Latrobe Regional Gallery

116 Victoria Maffra Exhibition Space Geelong Gallery 150 Johnson Street, Maffra 3860. T Enquiries to 55 Little Malop Street, Geelong 3220. T (03) 5229- Gippsland Art Gallery (03) 5142-3500. H Mon, Wed- 3645. W geelonggallery.org.au Director: Jason Smith. Fri 10.00 to 6.00, Sat 10.00 to 12.00, closed Tues Free entry unless otherwise stated. H Daily 10.00 to and Sun. To July 23 Wellington Youth Art Prize. 5.00. To July 22 Beginnings: Indigenous art from the collection. To Aug 19 Geelong contemporary art prize (see ad page 14). To Sept 2 rethinking Antipodes by Brook Andrew. July 28 to Sept 9 My Geelong Geelong – our Gallery. South West Great Ocean Road Bijou Gallery Petschel House Petschel House, 107 Petschels Lane, Hamilton 3300. T 0417-585-102. E [email protected] W www.ElthamSouthFineArt.com.au H Thurs-Sun, or by appt. Fine Art Gallery, Painting Classes and Workshops, Framing. Blarney Books & Art 37 James Street, Port Fairy 3284. T (03) 5568-2174. E [email protected] W www.blarneybooks.com.au Instagram: blarneybooksandart. H Thurs-Sun 11.00 Brook Andrew, lately?, 2016, four-colour photolithograph with to 4.00. Unique book-related art space bookshop, in collaged photolithograph elements and hand colour, edition 24/30, beautiful Port Fairy. produced in collaboration with APW Printers Martin King and Simon White at Australian Print Workshop, Melbourne, Geelong Gallery Courtesy the artist, Tolarno Galleries, Melbourne and Geelong Gallery Elizabeth Arthur Fine Art Gallery & Sculpture Garden Metropolis Gallery 35 Carmichael Street, Hamilton 3300. 64 Ryrie Street, Geelong 3220. T (03) 5221-6505. T (03) 5572-2851. E [email protected] W www.metropolisgallery.com.au Director: Robert Director: Dr Elizabeth Arthur. H Thurs-Fri 10.00 to Avitabile. H Mon-Fri 9.00 to 5.00, Sat 10.00 to 6.00, Sun 12.00 to 4.00, or by appt. 4.00, Sun 12.00 to 4.00. July 13 to Aug 5 Linda Robertson, Rhondda Millen and Eros Anceschi.

Victoria 117 Qdos Arts + Sculpture Park Arts Academy, 35 Allenvale Road, Lorne 3232. T (03) 5289-1989. ϐ W www.qdosarts.com H Fri-Mon 9.00 to 5.00. Federation University Australia, cnr Sturt and Lydiard streets, Ballarat 3350; PO Box 663, Ballarat 3353. SCOPE Galleries T (03) 5327-8615. E [email protected] 38 Kelp Street, Warrnambool 3280. W federation.edu.au/pogallery Curator: Shelley T (03) 5561-4758, 0410-464-330 F 5561-5692. Hinton. H Wed-Sat 12.00 to 5.00. July 8 to Aug E [email protected] 4 NAIDOC 2018 – FedUni’s Post Office Gallery W www.scopegalleries.com Director: Liza McCosh. celebrates NAIDOC and Australia’s First Nations H Sat-Sun 1.00 to 4.00, or by appt. Through July peoples with two group exhibitions that includes, Contemporary painting, drawing, ceramics, sculpture Because of her, we can! by select local Indigenous and prints. artists, and Cooee! developed by way of a unique collaboration between Federation College’s VET Visual Arts program, Langi Kal Kal, Ararat and Hopkins Warrnambool Art Gallery Correctional Centre. 26 Liebig Street, Warrnambool 3280. T (03) 5559- 4949. E [email protected] W www.thewag.com.au Director: Vanessa Gerrans. H Mon-Fri 10.00 to 5.00, Sat-Sun and public hols 10.00 to 3.00. To July 22 Cornucopia – WAG Permanent Collection. Curated by Murray Bowes. To Sept 23 The Warrnibald 2018. To Sept 30 Once Women Won the Vote. July 4 to 22 The Junior Warrnibald 2018. July 21 to Oct 14 Code Breakers: Women in Games. Wishart Gallery 19 Sackville Street, Port Fairy 3284. T (03) 5568-2423. E [email protected] W www.wishartgallery.com.au Art, Antiques, Pizza, Bar Through July Topographical – Greg Mallyon, Marlene Gilson, Black Swamp, Lake Wendouree, 2017, acrylic on Carmel Wallace and Dean Bowen. linen, 76 x 100cm Courtesy the artist and Arts Academy, Post Office Gallery Ballarat – Gallery on Sturt 421 Sturt Street, Ballarat 3350. T (03) 5331-7011. Central E [email protected] W www.galleryonsturt.com.au Director: Leigh Victoria Tweedie. H Mon-Fri 9.00 to 5.00, Sat 10.00 to 2.00. Ararat Gallery TAMA Bendigo Art Gallery 42 View Street, Bendigo 3550. T (03) 5434-6088. Town Hall, Vincent Street, Ararat 3377. T (03) 5355- E [email protected] 0220. E [email protected] H Mon-Sun 10.00 W www.bendigoartgallery.com.au Director: Karen to 4.00. Closed Good Friday, Christmas Day, Boxing Quinlan. Entry by donation unless specified. Day and New Year’s Day. Reopening on Aug 4, 2018. H Gallery/shop daily 10.00 to 5.00. To July 29 New Histories. To Sept 9 Paul Guest Prize. July 7 to Sept Art Gallery of Ballarat 16 Myuran Sukumaran: Another Day in Paradise. 40 Lydiard Street North, Ballarat 3350. T (03) 5320-5858. E [email protected] W artgalleryofballarat.com.au Free entry unless specified. H Daily 10.00 to 5.00. To Aug 19 Megan Evans: Parlour. To Aug 26 Anne Chibnall and Tim Sedgwick: WOW! LOOK AT THAT. To Sept 2 Recent Acquisitions. To Sept 9 Into Light: French masterworks from the Musée de la Chartreuse – this international touring exhibition, exclusive to Ballarat, features 19th century paintings from the regional collection in Douai in northern France. Artists include Renoir, Fantin-Latour, Courbet and Corot. Tickets available from the gallery website (see ad page 4).

118 Victoria La Trobe Art Institute 121 View Street, Bendigo 3550. T (03) 5444-7272. E [email protected] W www.latrobe.edu.au/ art-institute H Mon-Fri 10.00 to 5.00, Sat 12.00 to 5.00. To July 7 Miwatj – Birrikitji Gumana, Dr Gumana AO, Narritjin Maymuru, Mithinarri Gurruwiwi and Wandjuk Marika. Also, The Label Makers an interactive exhibition. From July 23 The Grammar of Glitch – Antonia Sellbach, James Little, Katie Paine, Michael Georgetti, Paul Kaptein and Ross Taylor. The Lost Ones Contemporary art gallery, Ballarat 14 Camp Street, Ballarat Central 3350. T (03) 4343-1754 , 0419-630-091. E [email protected] W www.thelostones.com.au H Wed-Sun 11.00 to 4.00. Thomas Kennington, Homeless, 1890, oil on canvas Collection Bendigo Art Gallery MONDO ART E [email protected] Biennial of Australian Art W www.mondoartgallery.com A marketplace and BOAA consultancy of innovative, collectable, contemporary W www.boaa.net.au/tickets Sept 21 to Nov 6 BOAA 2D and 3D art for commercial and private spaces, ART 2018 – presenting a showcase of 150+ artists with a focus on large-scale works. from across Australia 65 curated solo exhibitions presented throughout three ‘Art Villages’ within 14 of ϐ Ballarat’s heritage buildings and historic locations. Visit website for program and ticketing. A satellite space of See ad page 30. Bendigo Art Gallery 51-67 Pall Mall, Bendigo 3550. T (03) 5434-6179. Castlemaine Art Museum E [email protected] W www.bendigoartgallery.com.au Director: Karen 14 Lyttleton Street (PO Box 248), Castlemaine 3450. Quinlan. Entry by donation. H Daily 9.00 to 5.00. T (03) 5472-2292. E [email protected] To Nov 11 Bankrolling Bendigo: building a city. W www.castlemainegallery.com H Thurs-Sun 12.00 to 5.00.

ϐ Old Fire Station, Neil Street, Maryborough 3465. North T (03) 5460-4588. E [email protected] W www.visitmaryborough.com.au H Thurs-Sun 10.00 to 4.00. Central Goldfields Art Gallery is a North East & cultural facility of the Central Goldfields Shire Council. To July 29 Wal Richards: Wedding Photographer. North West Falkner Gallery 35 Templeton Street, Castlemaine 3450. Art at Linden Gate T (03) 5470-5858. E [email protected] W www.artatlindengategallery.com.au W www.falknergallery.com.au H Wed 1.00 to 5.00, For exhibition details see Melbourne section. Thurs-Sat 11.00 to 5.00, Sun by appt. Gallery closed for Winter Break June 24 to July 24. Benalla Art Gallery (map ref Melway 619 D6) Botanical Gardens, Bridge Street West, Benalla 3672. T (03) 5760-2619. E [email protected] W www.benallaartgallery.com.au H Daily 10.00 to 5.00, closed Tues, Good Friday, Christmas Day and Boxing Day.

Victoria 119 The Goat Gallery Swan Hill Regional Art Gallery 87A Main Street, Natimuk 3409. T 0417-307-824. Horseshoe Bend, Swan Hill 3585. W facebook.com/TheGoatGallery H Sat-Sun 1.00 T (03) 5036-2430. E [email protected] to 4.00, or by appt. To July 8 Mosaic workshop W www.facebook.com/swanhillregionalartgallery exhibition by Andy Lambrogiotas. Mosaic workshops H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 4.00. for young people and their families: Sun July 1, 10.30am-12.30pm and 1-3.30pm. Make a small TarraWarra Museum of Art project in one session, or a larger project over the (map ref Melway 277 B2) W www.twma.com.au two sessions. Supported by Horsham Rural City See Melbourne entry for exhibition details. Community Grant and Arapiles Community Theatre, Natimuk. Enquiries: 0417-307-824, 0428-821- 185. July 14 to 15 Young People and their Families Wangaratta Art Gallery Mosaic Workshop Show. Sat-Sun 1-4pm. July 56 Ovens Street, Wangaratta 3677. 21, 1-4pm Youth Art Show Project – workshop in T (03) 5722-0865. E [email protected] photography and drawing, and plaster works for very W www.wangarattaartgallery.com.au Free entry. young people. July 22, 1-4pm Exhibition of works. H Tues-Sun 10.00 to 4.00, closed Mon. Office hours Supported by Horsham Rural City Community Grant, Mon-Fri 9.00 to 5.00, closed public hols and for Arapiles Community Theatre and the Nati Cafe. exhibition installations. Wangaratta Art Gallery is a Cultural Service of the Rural City of Wangaratta. To Hearth Galleries July 8 Gallery 2: Beard and Influence by Clayton Tremlett. To July 12 WPAC Foyer Gallery: Should We 208 Maroondah Highway, Healesville 3777. Say Something? by Marise Maas. To Aug 19 Gallery T 0423-902-934. E [email protected] 1: Petite Miniature Textiles. July 14 to Aug 12 W www.christinejoycuration.com.au H Wed-Sun Gallery 2: Field of Vision – Wangaratta Artist Society. 10.00 to 5.00. June 30 to July 8 (opening Sat 30th June, 3-6pm) Outer World Inner Life II by Leila Boakes – examines the collision between our inner lives and the outer world, the intersection of our imaginations. Wed-Sun 11.00 to 4.00. July 11 to 29 West Warlukurlangu: Art from the Desert. 10.00 to 5.00. Horsham Regional Art Gallery Gippsland 80 Wilson Street, Horsham 3400. T (03) 5382-9575. E [email protected] Bradley Hall Antiques W www.horshamtownhall.com.au H Tues-Fri 10.00 & Art Gallery to 5.00, Sat 11.00 to 4.30, Sun 1.00 to 4.30. Australian Studio of Gary Miles 12 Old Telegraph Road West, Drouin West 3818. Mildura Arts Centre T (03) 5626-8355, 0407-443-606. 199 Cureton Avenue, Mildura 3500. E [email protected] T (03) 5018-8330. E [email protected] W www.garymilesart.com.au H Sat-Sun and public W www.milduraartscentre.com.au H Daily 10.00 hols 11.00 to 5.00 or by appt. Artist: Gary Miles. to 5.00. To July 22 Happy Birthday Play School: Gallery viewing of available paintings of past series. Celebrating 50 Years – a travelling exhibition from Jugiong Series – Coming Soon. the National Museum of Australia developed in collaboration with the ABC. To Sept 2 Self-made: Phil Henshall Studio zines and artist books – State Library Victoria. 1116 Main Neerim Road, Rokeby 3821. July 5 to Aug 25 Testa Dura II by Vince Vozzo. T 0418-318-187. W philhenshall.com.au H Studio open the second weekend each month 10.00 to Shepparton Art Museum (SAM) 5.00. Exploring ASPECTIVISM™. July 14 and 15 (map ref Vic Roads map 273 L8 or 32 H8) 70 HIGHER land. Aug 11 and 12 The Lachlan Cavalier. Welsford Street, Shepparton 3630. T (03) 5832- 9861. E [email protected] Pilgrim Creek Studios W sheppartonartmuseum.com.au Director: Dr Rebecca Coates. Free entry. H Daily 10.00 to 4.00, Crossover (East of Melbourne) public hols 1.00 to 4.00. Closed Christmas Day, New T 0411-480-384. W www.pilgrimcreekstudios.com.au Year’s Day and Good Friday. Join SAM on Facebook, Paintings, Ceramics, Sculpture. Studio & gallery of Twitter and Instagram! To Aug 1 Drawing Wall #31: Kerrie Warren. David Harley. To Aug 8 Showcase #18: Alterfact. To Aug 12 I hope you get this: Raquel Ormella (see Red Tree Gallery Jindivick ad page 47). 420 Main Jindivick Road, Jindivick 3818. T (03) 5628-5224. E [email protected] W www.lauriecollins.com.au Ongoing Laurie Collins.

120 Victoria

Sydney

122 The Ken Done Gallery CBD 1 Hickson Road, The Rocks 2000. T (02) 8274-4500 F (02) 8274-4545. E [email protected] W www.kendone.com.au H Daily 10.00 to 5.30. Our recent hang in The Ken The Rocks Done Gallery is a wonderfully eclectic mix of brand new reef paintings, some older studio works and vivid Art Gallery of New South Wales beach and boating scenes. Complimenting these are some quintessential Sydney drawings and small (AGNSW) canvases of Chinamans Beach alongside pen and ink Art Gallery Road, Sydney 2000. T (02) 9225-1744, sketches to complete the show. Limited edition prints, 1800-679-278. W www.artgallery.nsw.gov.au posters and other art related products are available Admission charges apply to some exhibitions. H Daily for sale in the gallery shop including the artist’s 10.00 to 5.00. Art After Hours: Wed to 9pm. To latest publication ‘Ken Done: Paintings you probably July 29 Hold still: the photographic performance. haven’t seen’. To Sept 9 Henry VR. July 7 to Oct Playback: Dobell Australian Drawing Biennial 2018. July 14 to Oct Spacemakers and roomshakers: installations from Korean Cultural Centre the collection. July 21 to Nov 11 John Russell: Australia Gallery Australia’s French impressionist. July 21 to Jan 6, Ground Floor, 255 Elizabeth Street, Sydney 2000. 2019 Fearless: contemporary South Asian art. T (02) 8267-3400. E [email protected] W www.koreanculture.org.au H Mon-Fri 10.00 The Art of Dr. Seuss to 6.00. presented by Harvey Galleries, QVB Museum of Contemporary Art Queen Victoria Building , Level 2, 33-35 / 455 Australia (MCA) George Street, Sydney 2000. T (02) 9261-0275. 140 George Street, The Rocks 2000. E [email protected] T (02) 9245-2400. W www.mca.com.au Free entry. W www.harveygalleries.com.au H Mon-Wed 10.00 H Mon-Tues 10.00 to 5.00, Wed 10.00 to 9.00, to 6.00, Thurs 10.00 to 8.00, Fri-Sat 10.00 to 6.00, Thurs-Sun 10.00 to 5.00. July 6 to Sept 23 John Sun 11.00 to 5.00. Authorised editions from the Mawurndjul: I am the old and the new. July 9 to Oct Seuss Estate. 14 Sun Xun. Now Showing MCA Collection: Today Tomorrow Yesterday. 541 Art Space Level 1, 541 Kent Street, Sydney 2000. W www.541artspace.com.au July 6 to 28 (opening Fri July 6, 6-9pm) Love Letter: I do – Clache Raong, Sarah Woodward, Anna Battersby, Tanya Reinli, Aura Evans, Canbora Bayraktar, Ally Adeney, Gillian Kayrooz, Laura Nolan, Guy Morgan, Andy Chan, Jessica Thallmaier and Eleni Tsomis. Curated by Yves Lee. Guest artist Jonathan Blake. To be opened by Michael Fitzgerald. See ad page 136. Gaffa Gallery 281 Clarence Street, Sydney CBD 2000. T (02) 9283-4273. W www.gaffa.com.au H Mon-Fri 10.00 to 6.00, Sat 11.00 to 5.00. Closed Sun and public hols. Gaffa is an independent creative precinct, artist-run in attitude and execution. July 5 to 16 The Underwood by Eduardo Wolfe-Alegria, and Metaphoria by Andrew Ensor. Also, Interior Castles by Ba An Le and Eleanor De Pasquale. July 19 to 30 Sophomore by Agus Wijaya, and Come as far as the edge of my blood, and swim by Samuel Massey. Also, The Illustrated Works of the Court Paper by Jennifer Chua.

John Mawurndjul, Maninigrida, 2018 Photograph: Rhett Hammerton Courtesy the artist and Museum of Contemporary Art Australia

Sydney 123 Museum of Sydney Cnr Phillip and Bridge streets, Sydney 2000. Chippendale T (02) 9251-5988 . W sydneylivingmuseums.com.au H Daily 10.00 to 5.00. Closed Good Friday and Christmas Day. The Museum presents a diverse program of exhibitions and events. Central S.H. Ervin Gallery The Commercial National Trust of Australia (NSW), Watson Road, 148 Abercrombie Street, Redfern 2016. T (02) Observatory Hill, The Rocks 2000. T (02) 9258- 8096-3292. E [email protected] 0173. E [email protected] W www.thecommercialgallery.com Director: Amanda W www.shervingallery.com.au H Tues-Sun 11.00 Rowell. H Wed-Sat 11.00 to 6.00. Please visit our to 5.00. To July 29 Salon des Refusés: The website for current exhibition information. ‘alternative’ Archibald & Wynne Prize selection – The ‘alternative’ selection from hundreds of entries 4A Centre for Contemporary to the Archibald and Wynne Prizes not in the official exhibition. The Salon des Refusés at the S.H. Ervin Asian Art Gallery has established an excellent reputation that 181-187 Hay Street, Haymarket, Sydney 2000. rivals the selections in the ‘official’ exhibition, with T (02) 9212-0380. W www.4a.com.au Free entry. works selected for quality, diversity, humour and H Tues-Fri 11.00 to 5.00, Thurs nights to 8.00, experimentation, and which examine contemporary Sat-Sun 11.00 to 4.00. June 29 to Aug 12 (opening art practices, different approaches to portraiture Thurs June 28, 6-8pm) The Burrangong Affray by and responses to the landscape. Visitors can vote in Jason Phu & John Young Zerunge. the Holding Redlich People’s Choice Award which celebrates its 20th year in 2018. Principal Sponsor: The Japan Foundation Gallery Holding Redlich. Level 4, Central Park, 28 Broadway, Chippendale 2008. T (02) 8239-0055. E [email protected] W www.jpf.org.au/events/anime-architecture H Mon-Thurs 10.00 to 8.00, Fri 10.00 to 6.00, Sat 10.00 to 3.00. To Aug 11 Anime Architecture.

Hiromasa Ogura, Background for Ghost in the Shell (1995), cut 341, watercolour on paper, 28 x 38cm © 1995 Shirow Masamune / Kodansha, Bandai Visual, Manga Entertainment Ltd Performance Space Carriageworks, Level 2, 245 Wilson Street, Eveleigh Elliott Nimmo, Cherrychalina (Kate Alstergren, curator and artist), 2042. T (02) 8571-9111. oil and acrylic on canvas,180 x 140cm Courtesy the artist and S.H. Ervin Gallery E [email protected] W www.performancespace.com.au Presenting a program for experimental art practice. Vermilion Contemporary Visit website for more info. Chinese Art 5/16 Hickson Road, Walsh Bay 2000. Sheffer Gallery T (02) 9241-3323. E [email protected] 38 Lander Street, Darlington 2008. W www.vermilionart.com.au H Tues-Sat 11.00 T (02) 9310-5683. E [email protected] to 7.00. W www.sheffergallery.com H Wed-Sat 11.00 to 6.00.

124 Sydney Andjana Pachkova, Castle in the Sky, 2018, mixed media on canvas, 170 x 200cm

Andjana Pachkova Die Sehnsucht

18 July - 11 August 2018

Opening Hours: Wed-Fri 11am-6pm; Sat 11am-5pm 1/52-54 Stanley Street, Darlinghurst, NSW 2010 02 9368 1142 0407 406 414 [email protected] www.stanleystreetgallery.com.au UTS Gallery Arthouse Gallery University of Technology Sydney, Level 4, 702 Harris 66 McLachlan Avenue, Rushcutters Bay 2011. Street, Ultimo 2007. T (02) 9514-1652. T (02) 9332-1019. E [email protected] E [email protected] W art.uts.edu.au W www.arthousegallery.com.au H Tues-Fri 9.30 to Senior Curator: Tania Creighton. H Mon-Fri 12.00 6.00, Sat 10.00 to 5.00. To July 14 Everything Is by to 6.00, Sat 12.00 to 4.00. July 24 to Sept 14 James Ettelson. July 26 to Aug 18 Forgetting English (opening Tues July 24, 6-8pm) Hello World: by Katherine Hattam, and Turning Heads by Caroline Code and Design – examines the role of code in Gibbes (see ad page 20). contemporary design. Curated by Aaron Seymour.

Aaron Seymour, Hello World, 2017 Courtesy the artist and UTS Gallery

Verge Gallery Katherine Hattam, He forgot how to speak English, mixed media on Jane Foss Russell Plaza, (off City Road), Darlington, paper, 152 x 168cm University of Sydney 2006. T (02) 9563-6218. Courtesy the artist and Arthouse Gallery E [email protected] W verge-gallery.net H Tue-Fri 10.00 to 5.00, Sat 11.00 to 4.00. Artspace 43-51 Cowper Wharf Road, Woolloomooloo 2011. White Rabbit Gallery T (02) 9356-0555. E [email protected] 30 Balfour Street (near Central Station), Chippendale W www.artspace.org.au H Mon-Fri 11.00 to 5.00, 2008. T (02) 8399-2867. Sat-Sun 11.00 to 6.00. Visit website for exhibition W www.whiterabbitcollection.org H Wed-Sun 10.00 program. to 5.00. Through July The Sleeper Awakes, in which contemporary artists explore the relationship between Australian Centre the individual and the state and the influence of the for Photography Maoist past on today’s China. Featuring works by Sun Xun, Xu Bing, Feng Mengbo, Wang Ningde and Project Space Gallery Liu Xiaodong. 72 Oxford Street, Darlinghurst 2010. T (02) 9332- 0555. E [email protected] W www.acp.org.au Free entry. H Tues-Fri 10.00 to 6.00, Sat 11.00 to 4.00. Closed public hols. East Sydney The Cross Art Projects 8 Llankelly Lane (off Orwell Street), Kings Cross APY Gallery 2011. T (02) 9357-2058, 0406-537-933. 45 Burton Street, Darlinghurst 2010. E [email protected] W www.crossart.com.au E [email protected] Director: Jo Holder. H Thurs-Sat 11.00 to 6.00. W www.apygallery.com H Mon-Fri 9.00 to 5.00, Sat July 7 to Aug 18 Counter Forces: Fire + Water 10.00 to 4.00, Sun by appt. The APY Gallery is a by Peggy Griffiths and Jan Griffiths. Presented by platform for emerging Indigenous artists from the APY Warringarri Arts. Art Centre Collective. www.apyartcentrecollective.com Fine Arts, Sydney ARO Suites 204 & 205, 20-22 Bayswater Road, Potts 51 William Street, Darlinghurst 2010. Point 2011. T (02) 9361-6200. T 0414-946-894. W www.arogallery.com E [email protected] W www.finearts.sydney H Wed-Fri 12.00 to 6.30, Sat and Sun 12.00 to 5.00. H Wed-Sat, 12.00 to 6.00. To July 28 Measurement Room: Perimeter, 1968 by Mel Bochner.

126 Sydney Firstdraft Gallery 9 13-17 Riley Street, Woolloomooloo 2011. 9 Darley Street, Darlinghurst 2010. T (02) 8970-2999. E [email protected] T (02) 9380-9909. E [email protected] W www.firstdraft.org.au H Wed-Sun 12.00 to W www.gallery9.com.au Director: Allan Cooley. 6.00. An artist run organisation for emerging and Manager: Octavia Knox. H Wed-Sat 11.00 to 6.00, experimental art practice. Visit website for Sun-Tues by appt. To July 7 David Ralph, and Mark exhibition program. Titmarsh. July 11 to Aug 4 Eloise Kirk, and Julian Hooper. Frances Keevil Gallery Bay Village, 28-34 Cross Street, Double Bay 2028. T (02) 9327-2475. E [email protected] W www.franceskeevilgallery.com.au H Tues-Sat 10.00 to 5.00, Sun 11.00 to 4.00. June 27 to July 5 Illusions by Gemma Rasdall. July 17 to 22 The Oxygen Series by Rachel Carroll.

David Ralph, Double Life, 2018, oil on canvas, 72 x 63cm Gemma Rasdall, The Jetty, work on paper, 46 x 50cm Courtesy the artist and Gallery 9 Courtesy the artist and Frances Keevil Gallery King Street Gallery on William 177 William Street, Darlinghurst 2010. T (02) 9360-9727. E [email protected] W www.kingstreetgallery.com.au H Tues-Sat 10.00 to 6.00. To July 14 Towards Intuition by Andrew Christofides. July 17 to Aug 11 Harrie Fasher. Liverpool Street Gallery 243a Liverpool Street, East Sydney 2010. T (02) 8353-7799. E [email protected] W www.liverpoolstgallery.com.au Director: James Erskine. H Tues-Sat 10.00 to 6.00. July 6 to 25 (opening Sat July 7, 2-5pm) Drift by Ryan Hoffmann. NAS Gallery Forbes Street, Darlinghurst 2010. T (02) 9339-8686. E [email protected] W www.nas.edu.au/place/gallery Free entry. H Mon-Sat 11.00 to 5.00.

Sydney 127 NationalAssociation Stanley Street Gallery for the Visual Arts (NAVA) 1/52 54 Stanley Street, Darlinghurst 2010. T (02) 9368 1900. E [email protected] T (02) 9368 1142. E [email protected] W www.nava.net.au NAVA isthe peakbody W www.stanleystreetgallery.com.au Directors: Merilyn representing and advancing the professional interests Bailey andLiza Feeney. H Wed Sat 11.00 to 6.00. of the Australian visual arts, craft and design sector. To July 14 Virtual Relics by Tor Larsen. July 18 to See ad page 113. Aug 11 Die Sehnsucht by Andjana Pachkova (see ad page 125). Aug 15 to Sept 8 Drawings and Jewellery Robin Gibson Gallery by Margaret West. 278 Liverpool Street, Darlinghurst 2010. T (02) 9331 6692. W www.robingibson.net H Tues Sat 11.00 to 6.00. July 7 to Aug 1 Richard Byrnes, Patricia Lawrence and Ian Pearson. STACKS Projects 191 Victoria Street, Potts Point 2011. E [email protected] W www.stacksprojects.com Directors: Chloe Gunn, Zachary Harold, Annelies Jahn, Jane Lush and Joanne Makas. H Thurs Sat 11.00 to 6.00, Sun 11.00 to 4.00. To July 8 RELIC by DeborahBurdett and Annelies Jahn a body of work constructed from objects saved from destruction and given new lives, new uses. RELIC will bring together the rural and urban discarded, to create a new place and dialogue Andjana Pachkova, Castle in the sky, 2018, arcrylic, charcoal and of materiality and relationship. July 12 to 29 (opening crayons on canvas, 170 x 200cm Wed July 11, 6 8pm) AsIf By Magic by The New Photograph: Zorica Purlija Image Group: Kieran Butler, Renate Rienmueller Courtesy the artist and Stanley Street Gallery and Katherine Rooke an exhibition that speaks to the notion of magic inherent within the medium of TAP Art Gallery photography and its methods of production. T 0400 610 440. E [email protected] W www.tapgallery.org.au H Daily 12.00 to 6.00. Please see website for exhibition details. UNSW Galleries UNSW Art & Design, Oxford Street (cnr of Greens Road), Paddington 2021. T (02) 8936 0888. E [email protected] W www.artdesign.unsw.edu.au/unsw galleries H Tues Sat 10.00 to 5.00. To July 14 EnoughKhalas contemporary Australian Muslimartists. Also, Christian Thompson: Ritual Intimacy. July 28 to Sept8Make Known: The Exquisite Order of Infinite Variation exploring ideas about design thinking and Katherine Rooke, Curtain, a study for ‘As if by Magic’, 2018, gelatin silver print, 10.16 x 15.24cm the creative process. Presentedincollaboration with Courtesy the artist and STACKS Projects UNSW Built Environment. July 28 to Sept 15 Local Colour: Experiments in Nature artists and designers using natural dyes and pigments to express concerns aboutthe environment and natural resources. Watters Gallery 109 Riley Street, East Sydney2010. T (02) 9331 2556. E [email protected] W www.wattersgallery.com H Tues and Sat 10.00 to 5.00, Wed Fri 10.00 to 7.00. July 4 to 21 Paintings by Max Watters, and sculpture by Robert Parr.From July 25 Roger Crawford: UP CLOSE A Paradox of Time,and Paul Selwood: Sculpture.

128 Sydney

Michael Reid Sydney Redfern Standard House, 105 Kippax Street (enter from Waterloo Street), Surry Hills 2010. T (02) 8353 3500. W www.michaelreid.com.au Directors: MichaelReid, Toby Meagher and Will Sturrock. H Wed Sat 11.00 to Surry Hills 5.00. July 4to28Maningrida Arts Group Exhibition. Soho Waterloo Green Square Waterloo Design Centre, 105/197 Young Street, Waterloo 2017. T (02)9326 9066 F 9358 2939. Ƭ ϐ E [email protected] W www.sohogalleries.net 1/24 Wellington Street, Waterloo 2017. H Daily trading, closed public holidays. July 1 to T (02) 9699 2211. E [email protected] 31 (opening Sat July 21, 2 4pm) Personal Graffitti W www.aboriginalpacificart.com.au Director: Gabriella abstract paintings by Phil Stallard, with Group Roy (member of ACGA). H Tues Sat 11.00 to 5.00. Sculpture. ArtPark exhibitions continue at July 4 to 21 In Our Hands: Yarrenyty Arltere Artists dArenberg Winery, McLaren Vale, SA. soft sculptures from the 21st Biennale of Sydney, also Details visit www.artpark.com.au featuring three works from the Biennale by Yvonne Koolmatrie. July 25 to Aug 18 Tjala Arts. See ad page 140. Artbank, Sydney 222 Young Street, Waterloo 2011. T (02) 9697 6000. E [email protected] W www.artbank.gov.au H Mon Fri 9.00 to 5.00. Brett Whiteley Studio 2Raper Street, Surry Hills 2010. T (02) 9225 1881. E [email protected] W www.brettwhiteley.org Free admission made possible by J.P. Morgan. H The Studio is open to the public Fri Sun 10.00 to 4.00. The Brett Whiteley Studio is managed by the Art Gallery of New South Phil Stallard, Love Surrender, acrylic and oil on canvas, Wales. 165 x 200cm Courtesy the artist and Soho Galleries China Heights Gallery Level 3, 16 28 Foster Street, Surry Hills 2010. Stella Downer Fine Art T 0404132 023. E [email protected] 1/24 Wellington Street, Waterloo 2017. W www.chinaheights.com H Daily 12.00 to 5.00, T 0402 018283. E [email protected] or by appt. July 27 to Aug 5 (opening Fri July 27, W www.stelladownerfineart.com.au H Tues Fri 68pm) Reflected new mixed media collage by Steve 10.00 to 5.00, Sat 11.00 to 5.00. July 10 to Aug 4 Tierney. See ad page 139. (opening Thurs July 12, 6-8pm) Impossible Findd by Steve Lopes. Flinders Street Gallery 61 Flinders Street, Surry Hills 2010. T (02) 9380 5663. E [email protected] W www.flindersstreetgallery.com H Wed-Sat 11.00 to 6.00, or by appt. MAY SPACE 409b George Street, Waterloo 2017. T (02) 9318 1122. E [email protected] W www.mayspace.com.au H Tues Sat 10.00 to 5.00. To July 21 Janet Tavener, and Daniel O’Toole. From July 25 reminiSCENT, curated by Megan Fizell.

Steve Lopes, Syrian Sleeping – Paris, 2018, oil on canvas, 60 x 80cm Courtesy the artist and Stella Downer Fine Art

130 Sydney

Sullivan+Strumpf 799 Elizabeth Street, Zetland 2017. Inner West T (02) 9698-4696. E [email protected] W www.sullivanstrumpf.com Directors: Ursula Sullivan and Joanna Strumpf. H Tues-Sat 10.00 to 5.00, or by appt. June 29 to Aug 4 Out Of Marrickville Life by Darren Sylvester. Also, An Awkward Dance by Michael Lindeman. July 7 to Aug 12 Sullivan+Strumpf Singapore: Irfan Hendrian. Balmain AIRspace Projects 10 Junction Street, Marrickville 2204. T 0438-020-661. E [email protected] W www.airspaceprojects.com Directors: Sally Clarke and Brenda Factor. H Thurs-Fri 11.00 to 6.00, Sat 11.00 to 5.00 first three weeks each month. July 6 to 21 Session Vessels – organised by Rafaela Pandolfini with Ainslie Templeton – Gallery 1: Zhuxuan He, Womens History Museum, Maison the Faux, Megan Hanson, Laura/Deanna Fanning, Keith La Fuente, Come Tees, Ander Rennick and more. Gallery 2: Rafaela Pandolfini with outfit by Annie Wu, sound Lucreccia Quintanilla and more. The Cranny & Deep Space: Selby Nimrod, Kathy Acker, Brian Fuata/Enderie, Bette Gordon, Anna John, Ainslie Templeton and more. Shop Shelves: Simonne Goren, Lauren Kerjan, Kiki Ando and Catherine Flora Murray. Performances: Sun July 7, 14 and 21. Annandale Galleries 110 Trafalgar Street, Annandale 2038. T (02) 9552-1699. E [email protected] W www.annandalegalleries.com.au Directors: Bill Gregory and Anne Gregory (members of ACGA). H Tues-Sat 11.00 to 5.00. To July 21 Artists of the Gallery, works from Buku-Larrnngay Mulka and Maningrida. Darren Sylvester, IKEA Sun, 2018, edition of 3 plus 2 artist’s proofs, lightjet print, 160 x 120cm Courtesy the artist and Sullivan+Strumpf Sydney | Singapore Artereal Gallery 747 Darling Street, Rozelle 2039. T (02) 9818-7473. Utopia Art Sydney E [email protected] W www.artereal.com.au 72 Henderson Rd, Alexandria 2015. Director: Luisa Catanzaro. H Wed-Sat 11.00 to 5.00. T (02) 9699-2900. E [email protected] July 4 to 28 Original Nature by Owen Leong. W www.utopiaartsydney.com.au Director: Christopher Hodges. H Tue-Sat 10.00 to 5.00, all welcome by Articulate project space appt. June 29 to July 29 (opening Sat July 1, 3-5pm) 497 Parramatta Road (opposite Cass Bros), Marea Gazzard: The Unique Works – focusing on Leichhardt 2040. W articulate497.blogspot.com.au rare forms and sculptures by Marea Gazzard. articulateupstairs.blogspot.com.au H Fri-Sun 11.00 to 5.00 (or as listed). To July 8 PUSH – Genevieve Carroll, Steven Cavanagh, Parris Dewhurst and Bill Moseley. July 14 to 29 (opening Fri July 13, 6-8pm) Crossfires – Ros Cook, Liz Day, Adrian Hall, Barbara Halnan, Rose Ann McGreevy, Jacek Przybyszewski, Margaret Roberts, William Seeto and Gary Shaw, facilitated by Barbara Halnan. ARTICULATEUpstairs: To July 8 No Trespassing by Molly Wagner. July 14 to 29 (opening Fri July 13, 6-8pm) Ebony Secombe under the theme of Navigation, coordinated by Nadia Odlum.

132 Sydney charmaine pwerle new tradition

‘Sandhills’ by Charmaine Pwerle, (122 x 183 cm) 14 july - 12 august a member of one of aboriginal art’s great dynasties brings us a collection of recent works bridging tradition to contemporary style and expression

www.kateowengallery.com free fully insured worldwide delivery (rolled)

kate owen gallery 680 darling street rozelle nsw 2039 (02) 9555 5283 open 7 days 10-6 [email protected] Artsite Galleries ϐ 165 Salisbury Road, Camperdown 2050. 47 Enmore Road, Newtown 2042. T (02) 9557- T (02) 8095-9678. E [email protected] 8483. E [email protected] W www.artsite.com.au H Wed-Sun 11.00 to 5.00. W www.defiancegallery.com Directors: Campbell July 7 to 29 A Sydney Flower & Garden Show a Robertson-Swann and Lauren Harvey. H Wed-Sat group exhibition. What’s On: www.artsite.com.au/ 11.00 to 5.00. June 27 to July 26 Jan King: Survey whats-on-now-calendar.php Exhibition 2003-2018 (see ad back cover). Aug 1 to 30 Backwards Forwards by Roy Jackson. Boomalli Aboriginal Artists Co-operative Delmar Gallery 55-59 Flood Street, Leichhardt 2040. 144 Victoria Street, Ashfield 2131. T (02) 9581- T (02) 9560-2541. E [email protected] 6070. E [email protected] W www.boomalli.com.au W trinity.nsw.edu.au/delmar-gallery Free entry. www.facebook.com/boomalligallery H Wed-Sun 12.00 to 5.00. To Aug 5 RAW www.instagram.com/boomalliartgallery H Wed-Sun Wedderburn – Suzanne Archer, Elisabeth Cummings, 11.00 to 4.00. To July 15 Born Into Existence: Robert Hirschmann, Roy Jackson, Ildiko Kovacs Women’s Exhibition is about Aboriginal Women in the and John Peart. Guest curated by Sioux Garside. arts and from our communities. The exhibition pays The exhibition explores the artists’ shared interest in tribute to the strength and resistance of Aboriginal raw, primal mark-making combined with an intuitive Women in Australia. Featuring Euphemia Bostock, and experimental approach to painting, developed Bronwyn Bancroft, Sharon Smith, Nicole Renee in their bush studios in Wedderburn outside Sydney. Phillips, Marlene Cummins,Tracey Bostock, Debra Free gallery talk: Sun July 22, 3pm Sioux Garside in Beale, Charmaine Davis, Danielle Gorogo, Deborah conversation with Suzanne Archer. Taylor, Pam Walker, Carmen Sandy, Jaluka Rosalina Quinlin, Jasmine Sarin, Leeanne Hunter, Ella Noah Factory 49 Bancroft, Hayley Pigram, Rubyrose Bancroft, Jessica 49 Shepherd Street, Marrickville 2204. Johnson, Camellia Boney, Peta-Joy Williams, Kyra T (02) 9572-9863. E [email protected] Kum-Sing, Margaret Brown and Jemima Whitford. W factory49.blogspot.com H Thurs-Sat 1.00 to Front rooms: Nadeena Dixon. 6.00. July 5 to 14 (opening Wed July 4, 6-8pm) Jamie Bastolli. July 19 to 28 (opening Wed July 18, 6-8pm) Fiona Halles. Gallery 371 371 Enmore Road, Marrickville 2204. H Wed-Sun 11.00 to 6.00, or by appt. Aug 1 to 5 (opening Fri August 3, 6-8.30pm) Ghost Heart sculptures by Minka Gillian. www.instagram.com/minka_gillian See ad page 140.

Rowena Crowe FREQUENCY @ 20,000hz Opening 19 July 6-8pm Continues until 22 July Minka Gillian, Catching the Nebulous, 2018, polyester mono filament, glass, rope, nylon, cable ties, beads, wire, 80 x 70 x 36cm Courtesy the artist and Gallery 371 Glass Artists’ Gallery (upstairs) gallery Gauge Gallery (street level) 68 Glebe Point Road, Glebe 2037. T/F (02) 9552-1552. E [email protected] 102 Victoria Street, Marrickville, Sydney W www.glassartistsgallery.com.au www.rowenacrowe.com www.gaugegallery.com.au. H Tues-Sat 10.00 to 5.30, Sun 1.00 to 5.00.

134 Sydney Kate Owen Gallery McGlade Gallery at the 680 Darling Street, Rozelle 2039. Australian Catholic University T (02) 9555-5283. E [email protected] Mount St. Mary, Gate 3, 25a Barker Road, Strathfield W www.kateowengallery.com Member of the 2135. T (02) 9701-4256. W www.acu.edu.au Aboriginal Art Association of Australia. H Daily H Mon-Sat 11.00 to 4.00 during exhibition periods. 10.00 to 6.00. Kate Owen Gallery is a multiple award-winning gallery specialising in contemporary Aboriginal art. Artworks range from small affordable SCA Galleries works to large investment pieces. Three light-filled Sydney College of the Arts floors showcase major exhibitions of Indigenous Balmain Road (enter opposite Cecily Street), Rozelle masters, established artists and new talent. The 2040. T (02) 9351-1008. ground breaking Collectors’ Gallery is dedicated E [email protected] to museum-quality works from Australia’s leading W sydney.edu.au/sca Free admission. Indigenous artists. July 14 to Aug 12 New Tradition H Mon-Fri 11.00 to 5.00, Sat-Sun 11.00 to 4.00 by Charmaine Pwerle. Charmaine, daughter of (during exhibitions). Barbara Weir and granddaughter of Minnie Pwerle, hails from one of Aboriginal art’s great painting The Shop Gallery dynasties. It is tempting to look at Charmaine’s artworks in light of her famous relatives, however 112 Glebe Point Road, Glebe 2037. T 0438-550- her art demands attention in its own right. It makes 835. E [email protected] its own statements. Charmaine’s subject matter W www.theshopgalleryglebe.com draws on stories passed down for generations, but H Daily 11.00 to 6.00. approaches it in a wholly different fashion than her grandmother to whom she is so often compared. Swamp Gallery This latest body of work is truly both traditional but 102 Victoria Street, Marrickville 2204. also stands up against the best of contemporary art. W www.facebook.com/Swamp- Charmaine is defining a new tradition for Aboriginal Gallery-547464512319253 July 19 to 22 (opening art. Join us at Kate Owen Gallery for this memorable Thurs July 19, 6-8pm) Frequency @ 20,000hz by show. See ad page 133. Rowena Crowe www.rowenacrowe.com See ad page 134. Nth Sydney Northern Beaches

Charmaine Pwerle, Awelye, 122 x 183cm Courtesy the artist and Kate Owen Gallery Art Space on the Concourse 409 Victoria Avenue, Chatswood 2067. W www.willoughby.nsw.gov.au/whats-on/visual-arts Kerrie Lowe Gallery July 4 to 15 (opening Wed July 4, 6pm) Glimpses by 49-51 King Street, Newtown 2042. T (02) 9550- Kathy Liu and Natasha Junmanee. 4433 F 9550-1996. E [email protected] kathyliuart.wordpress.com, njfineart.com. W kerrielowe.com H Mon-Sat 10.00 to 5.30 (Thurs Daily 10.00 to 5.00 July 18 to 29 Climate Change 10.00 to 7.00). June 29 to July 23 Gathering: an by Ann Carney – Landscape painting themed around exhibition to celebrate Naidoc Week – Bankstown the subject of Climate Change. Contact: emily@ Koori Elders, Joe Hurst, Sean Jackson, Lena Logan, emilyharrison.com.au. Wed-Fri 10.00 to 5.00, Sat- Graham Toomey, Kerry Toomey and students from Sun 10.00 to 4.00. Eora Indigenous TAFE College. July 27 to Aug 18 Flame and Ash: a variety of woodfired ceramics from potters all over Australia. Artarmon Galleries 479 Pacific Highway, Artarmon 2064. T (02) 9427-0322. W www.artarmongalleries.com.au H Mon-Fri 10.00 to 5.00, Sat 11.00 to 3.00.

Sydney 135 Grace Cossington Smith Gallery Headland Artists and Gate 7, 1666 Pacific Highway, Wahroonga 2076. Sculpture Park T (02) 9473-7878. W www.gcsgallery.com.au Read Place, Headland Park at Georges Heights facebook.com/gcsgallery Free entry. H Mon-Fri 10.00 entrance off Middle Head Road (opposite Cobittee to 5.00, Sat 9.00 to 4.00. July 10 to 28 (opening Sat Street), Mosman 2088. T 0409-653-222. July 14, 2-4pm) Music Box – a Print Circle exhibition E [email protected] showcasing the work of women artists dedicated to W www.headlandartists.com In beautiful Headland printmaking and referencing the music in our lives. Park 20+ artists working and selling from their Also, Seven Days by Naomi Woodlands. studios, three art schools, art restoration and Frenchy’s Cafe. Manly Art Gallery & Museum West Esplanade Reserve, Manly 2095. T (02) 9976-1421. E [email protected] W www.magam.com.au Free entry. H Tues-Sun 10.00 to 5.00. July 13 to Sept 2 Belle Île: Luke Sciberras & Euan Macleod – an exhibition of paintings by Luke Sciberras and Euan Macleod from their recent expedition to Belle Île, France: a journey inspired by the landscape and memory of the expatriate Australian painter John Peter Russell (1858-1930). Here, Sciberras and Macleod found their own subjects and narratives within this dramatic and evocative landscape. Curated by Katherine Roberts. Also, One Man’s Treasure: Geoff Harvey – known as an inventive sculptor working with found objects, Geoff Harvey has created a new series of

Naomi Woodlands, Seven Days, woodblock carborundum u/s print, 76 x 57cm Courtesy the artist and Grace Cossington Smith Gallery Harvey Galleries Mosman 842 Military Road, Mosman 2088. T (02) 9968- 2153. E [email protected] W www.harveygalleries.com.au H Tues-Sat 11.00 to 6.00, Sun 12.00 to 5.00. Select key works from important artists. June 29 to July 8 Being There by Bernard Ollis. See ad page 129. July 27 to Aug 5 Sirens, Demons & Wowsers by Vince Vozzo. See ad page 131. Harvey Galleries Seaforth 515 Sydney Road, Seaforth 2092. T (02) 9907- 0595, 0408-359-199. F 9907-0657. E [email protected] W www.harveygalleries.com.au H Wed-Sat 11.00 to 6.00, Sun 12.00 to 5.00. Curated monthly exhibitions, see website.

136 Sydney assemblages which reflect upon his fascination with Mosman Art Gallery the architecture of worship. Some resemble Western 1 Art Gallery Way, Mosman 2088. architecture with their distinctive Christian domes and T (02) 9978-4178. E [email protected] columns while others are more evocative of Eastern W www.mosmanartgallery.org.au Director: John philosophy with their slender minarets of finely Cheeseman. Free entry. H Daily 10.00 to 5.00, proportioned towers. All convey a dignity and clarity closed public hols. July 7 to Sept 16 Cheryl of proportion that transcend their humble origins. Richardson – Mosman artist Cheryl Richardson is in Together in this installation they speak of an awe of the untamed landscapes on the South Coast overriding humanity. of Western Australia. In this series of new acrylic works Richardson introduces panels which awaken the light on Albany and fully reflect the striking natural beauty of this region. July 14 to Sept 8 New Sacred – developed as a partnership between Parramatta Artists Studios and Mosman Art Gallery in response to critical discourses in contemporary Australian art practices. Artists include Adorned, Khadim Ali, Cigdem Aydemir, Keg de Souza, Mehwish Iqbal, Elena Papanikolakis, Marikit Santiago, Salote Tawale and Shireen Taweel.

Euan Macleod, NEEDLES, 2017, oil on polyester, 216 x 122cm Marikit Santiago, The father, the son and the Panganay, 2018, Courtesy the artist and Manly Art Gallery & Museum acrylic, oil, pen and Dutch metal gold leaf on canvas (pen markings by Santiago Pearl aged 1 year and Maella Pearl aged 2 years), 122 x 102cm Courtesy the artist and Mosman Art Gallery Mu Studio Gallery Headland Park Artist Precinct, 8 Read Place (cnr Middle Head Road), Mosman 2088. T 0411-473-072. E [email protected] W www.studiomu.com.au H During July open by appt.

Geoff Harvey, Temples, found timber Courtesy the artist and Manly Art Gallery & Museum

Sydney 137 PROJECT [504] BAROMETER Gallery 657 Pacific Highway, St Leonards 2065. 13 Gurner Street, Paddington 2021. T 0450-468-387. E [email protected] T (02) 9358-4968. E [email protected] W www.project504.com.au H Mon-Fri 12.00 to 4.30. W www.barometer.net.au H Wed-Sat 12.00 to 5.00. To July 14 Lost in Space photographs by Catherine Sydney Road Gallery Rogers. July 25 to Aug 11 Diary of a Landscape textiles by Pamela Fitzsimons. Shop 2, 561-563 Sydney Road, Seaforth 2092. T 0404-996-739. E [email protected] W www.sydneyroadgallery.com H Thurs-Sun 10.00 Blender Gallery to 4.00. Sydney Road Gallery is a commercial art 16 Elizabeth Street, Paddington 2021. gallery that is co-run by practising artists and changes T (02) 9380-7080. E [email protected] exhibitions every four weeks. W blender.com.au www.facebook.com/BlenderGallery H Wed-Sat 11.00 to 5.00, Tues by appt.

ϐ Paddington 12 Mary Place, Paddington 2021. T (02) 9557-8483. W www.defiancegallery.com Directors: Campbell Robertson-Swann & Lauren Harvey. H Wed-Sun 11.00 to 5.00. July 4 to 26 Jan King: Survey Woollahra Exhibition 2003-2018. Aug 1 to 23 Backwards Forwards by Roy Jackson. Annette Larkin Fine Art Suite 4, 8 Soudan Lane, Paddington 2021. Fellia Melas Gallery T (02) 9332-4614. E [email protected] 2 Moncur Street, Woollahra 2025. W www.annettelarkin.com Director: Annette Larkin. T (02) 9363-5616. E [email protected] H Wed-Fri 11.00 to 5.00, Sat 12.00 to 5.00, or by W www.fmelasgallery.com.au H Open daily. Through appt. Deals in post-war and contemporary art and July From our Stockroom – Tim Storrier, Donald provides tailored advice in all aspects of purchasing, Friend, Robert Dickerson, Cressida Campbell, Ray valuing and collection management. July 10 to 28 Crooke, John Coburn, James Gleeson, Sydney Nolan, Full Circle by Fred Cress – paintings and works on Garry Shead, Gria Shead, Euan Macleod, Brett paper 1965-2008 in collaboration with Australian Whiteley, Ross Harvey, Tony Irving, Marco Luccio, Galleries. Works at this gallery will be paintings and Margaret Woodward, David Hart, Sally Paxton, Sally works on paper 1970-1983. West and many others. Art Atrium 181 Old South Head Road, Bondi Junction 2022. T 0411-138-308. E [email protected] W www.artatrium.com.au Director: Simon Chan. H Wed-Fri 12.00 to 6.00, Sat 12.00 to 4.00, or by appt. July 4 to 22 (opening Fri July 6, 6-8pm, with the artist) Chico Monks – What is the Boundary? at 515 Crown Street, Surry Hills. Artist in conversation with Jennifer Isaacs AM: Wed July 18, 6-8pm. July 18 to Aug 4 (opening Sat July 21, 2.30-4.30pm) Ceremony by Teena McCarthy at 181 Old South Head Road, Bondi Junction. Ceremony exhibition launch by Djon Mundine OAM.

Australian Galleries Tim Storrier, Fire Line – Night, oil on board, 40 x 50cm 15 Roylston Street, Paddington 2021. Courtesy the artist and Fellia Melas Gallery T (02) 9360-5177 F 9360-2361. E [email protected] Fox Jensen Gallery W www.australiangalleries.com.au Director: Stuart Cnr Hampden Street & Cecil Lane23a Roylston Street, Purves AM. H Daily 10.00 to 6.00. July 10 to 29 Paddington 2021. T (02) 8084-4298. Full Circle – Annette Larkin Fine Art in collaboration E [email protected] with Australian Galleries. W www.jensengallery.com H Wed-Sat 12.00 to 5.00.

138 Sydney Opens 6-8pm REFLECTED Friday 27th July 2018 New mixed media collage Continues to 5th August by Steve Tierney China Heights Gallery with photography by Tanja Bruckner Level 3, 16 - 28 Foster St Surry Hills, NSW 2010

www.chinaheights.com Janet Clayton Gallery Olsen Gallery Online 63 Jersey Road, Woollahra 2025. T (02) 9327-3922. E [email protected] E [email protected] W www.olsengallery.com W www.janetclaytongallery.com.au H Tues-Fri 10.00 to 6.00, Sat 10.00 to 5.00, Sun 11.00 to 5.00. June 27 to July 15 Jens Einhorn, and Julia Colavita. July 18 to Aug 5 Peter Gardiner, Martin Browne Contemporary and John Olsen. Olsen Annexe: at 74 Queen Street, 15 Hampden Street, Paddington 2021. Woollahra 2025. T (02) 9327-3922. H Tues-Sun T (02) 9331-7997. 11.00 to 5.00. E [email protected] W www.martinbrownecontemporary.com Director: Martin Browne (member of ACGA). Roslyn Oxley9 Gallery H Tues-Sun 10.30 to 6.00. June 28 to July 22 8 Soudan Lane (off Hampden Street), Paddington Group Show. July 26 to Aug 19 In Our Nature by 2021. T (02) 9331-1919. Tamara Dean. E [email protected] W www.roslynoxley9.com.au Director: Roslyn Oxley (member of ACGA). H Tues-Fri 10.00 to 6.00, Sat Maunsell Wickes Gallery 11.00 to 6.00. To July 7 Hany Armanious, and Julie 19 Glenmore Road, Paddington 2021. T (02) 9331- Rrap. July 12 to Aug 11 (opening Thurs July 12, 4676 F 9380-8485. E [email protected] 6-8pm) Dale Frank. W www.maunsellwickes.com H Tues-Sat 11.00 to 5.30, Sun 12.00 to 5.00. July 6 to 8 Paris (At Wombat Hollow) by Desmond Freeman. Sabbia Gallery July 17 to 29 Gail English, Annie Herron and 120 Glenmore Road, Paddington 2021. Jeannette Lloyd Jones. T (02) 9361-6448. E [email protected] W www.sabbiagallery.com Directors: Anna Grigson and Maria Grimaldi. H Tues-Fri 11.00 to 6.00, Sat 11.00 to 4.00. June 27 to July 21 Iconoplastic new ceramic works by Simone Fraser.

Yarrenyty Arltere Artists In Our Hands: Soft sculptures from the 21st Biennale of Sydney also featuring three works from the Biennale by Yvonne Koolmatrie 4 - 21 July 2018 Tjala Arts 25 July - 18 August 2018

1/24 Wellington Street, Waterloo NSW 2017 telephone 612 9699 2211 Tues-Sat 11.00-5.00 email info@aboriginalpaciﬁcart.com.au web www.aboriginalpaciﬁcart.com.au Image: Dulcie Sharpe, Pink bird, 2018, soft sculpture, 52 x 38 x 14 cm

140 Sydney Saint Cloche Wagner Contemporary 37 MacDonald Street, Paddington 2021. 2 Hampden Street, Paddington 2021. E [email protected] W www.saintcloche.com T (02) 9360-6069, 0419-251-013. Director: Kitty Wong. H Wed-Sat 10.00 to 5.00, Sun E [email protected] 11.00 to 4.00, Mon-Tues by appt. Visit website for W www.wagnercontemporary.com.au H Tues-Sun exhibition program. 10.30 to 6.00, Mon by appt. July 7 to 30 Interiors by Rosemary Valadon. Thienny Lee Gallery 176 New South Head Road (opp Edgecliff Train Station), Edgecliff 2027. T (02) 8057-1769. E [email protected] Greater W www.thiennyleegallery.com H Tues-Fri 10.00 to 4.00, Sat 11.00 to 4.00. July 26 to Aug 14 Timeless by Claire Tozer. Sydney Blacktown Arts Centre 78 Flushcombe Road, Blacktown 2148. T (02) 9839-6558. E [email protected] W www.blacktownaustralia.com.au/3057/blacktown- arts-centre H Tues-Sat 10.00 to 5.00, closed public hols. Bundeena Maianbar Art Trail Royal National Park W www.arttrail.com.au H 10.00 to 4.00 – 1st Sun every month. A collective of over 20 artists who open Claire Tozer, Salmon Gums, ink on paper, 76 x 114cm their studios to the public. Courtesy the artist and Thienny Lee Gallery

Sydney 141 Campbelltown Arts Centre Hurstville Museum and Gallery 1 Art Gallery Road, Campbelltown 2560. 14 MacMahon Street, Hurstville T (02) 9330-6444. T (02) 4645-4100. E [email protected] E [email protected] W www.georgesriver.nsw.gov.au/HMG W www.c-a-c.com.au Free entry. H Daily 10.00 H Tues-Sat 10.00 to 4.00, Sun 2.00 to 5.00. to 4.00. To July 29 Looking In: A Survey of David Hawkes from 1989 to Now – an intimate look Macquarie University into Hawkes’ life and eminent career over the past three decades. Art Gallery Building E11A, Eastern Road, North Ryde 2109. T (02) 9850-7437. E [email protected] Casula Powerhouse Arts Centre W www.artgallery.mq.edu.au Senior Curator: Rhonda A cultural facility of Davis. H Tues-Fri 10.00 to 5.00. Liverpool City Council 1 Powerhouse Road, Casula 2170 (access via Margaret Whitlam Galleries, Shepherd Street, Liverpool). T (02) 9824-1121. Female Orphan School E [email protected] W www.casulapowerhouse.com Free entry. Ample Western Sydney University parking available or alight at Casula Train Station. (Parramatta) H Mon-Fri 9.00 to 5.00, Sat-Sun 9.00 to 4.30, First Level, West Wing, EZ Building, Parramatta closed public hols. Campus, cnr of James Ruse Drive and Victoria Road, Rydalmere 2116. T (02) 9685-9210. Hazelhurst Regional Gallery W virtualtours.westernsydney.edu.au/home H Thurs-Fri 10.00 to 4.00. Parking $9 per day. & Arts Centre To July 27 Blaze: Working Women, Public Leaders 782 Kingsway, Gymea 2227. T (02) 8536-5700 – an exhibition exploring the stories of a selection of F 8536-5750. E [email protected] NSW women who were leaders and trailblazers in W www.hazelhurst.com.au Free admission. the public work sector. Curated and produced by H Daily 10.00 to 5.00, closed Christmas Day, State Archives and Records NSW, presented by the Boxing Day, New Year’s Day and Good Friday. Whitlam Institute. To Aug 19 Marion Hall Best: Interiors – a major survey exhibition that colourfully charts the work of Marion Hall Best, one of Australia’s first and most Margot Hardy Gallery influential independent interior designers. Western Sydney University (Bankstown) Foyer, Building 23, Bankstown Campus, Bullecourt Avenue, Milperra 2214. T (02) 4620-3450. W virtualtours.westernsydney.edu.au/home H Mon-Fri 9.00 to 5.00. Parking $7 per day. July 5 to Aug 3 Landscapes and Beyond – an exhibition by students from Panania North Public School. Parramatta Artists Studios Level 1 & 2, 68 Macquarie Street, Parramatta 2150. T (02) 9687-6090. E [email protected] W www.parramattastudios.com.au H Open during events and by appt.

A room for Mary Quant, display room designed by Marion Hall Best for the ‘Rooms on View’ exhibition, Daily Telegraph Home Centre, Sydney, 1967, Mary White, 1967 Caroline Simpson Library & Research Collection, Sydney Living Museums Photograph: © Estate of Mary White Courtesy Hazelhurst Regional Gallery & Arts Centre

142 Sydney

Peacock Gallery and Auburn Arts Studio Auburn Botanic Gardens, cnr Chisholm and Chiswick streets, Auburn 2144. T (02) 8745-9794. E [email protected] W cumberland.nsw.gov.au/arts H Tues-Sun 11.00 to 4.00. July 7 to Sept 2 In Flight by Lisa Woolfe – a suite of drawings on paper and drawings in space analysing flight, specifically of the Australian Raven. Humans often keep the living world or natural world at a distance and in this fast paced society rarely take the time to stop and take notice. In doing so we miss what the natural world can teach us and Hayley Megan French & Carla Liesch, Makes Sense Together, 2018, how intertwined we are with it. Also, Makes Sense part of the sign series ‘Makes Sense Together’, acrylic paint on a-frames, 120 x 80 x 30cm Together – an exhibition by Western Sydney-based Courtesy the artists and Peacock Gallery and Auburn Arts Studio collaborators Hayley Megan French and Carla Liesch showing a collection of hand-painted a-frame signs. These signs drew their inspiration from a bygone era Penrith Regional Gallery in Auburn—a collection of signs now located around & The Lewers Bequest the corner from the Peacock Gallery, in Ray Marshall 86 River Road, Emu Plains 2750. T (02) 4735- Reserve. These new signs in Makes Sense Together 1100. W www.penrithregionalgallery.org Free entry. are a meditation on place and community. They do H Daily 9.00 to 5.00. Visit website for exhibitions. not name places, but rather speak to a community that exists in the present, and where we want to be in the future. As a collection, the signs populate the Western Sydney University gallery, bringing together stories, experiences and Art Gallery aspirations of place in Western Sydney as the artists (Penrith, Werrington North) navigate building their own genuine sense AD Building, Penrith (Werrington North) Campus, of connection. Great Western Highway, Werrington 2747. T (02) 4620-3450. W virtualtours.westernsydney. edu.au/home H Mon-Fri 9.00 to 5.00. Parking $7 per day. July 2 to Sept 28 By the time I get to Puning, she’ll be rising, 600 years old – an exhibition featuring the photography of David Cubby, Dawne Fahey, Michaela Gamble and Enrico Scotece.

144 Sydney

New South Wales

146 Lake Macquarie City Art Gallery Newcastle First Street, Booragul 2284. T (02) 4921 0382 F (02) 4921 0329. E [email protected] W artgallery.lakemac.com.au Free entry. H Tues-Sun 10.00 to 4.30. July 28 to Sept 16 Central Coast Moving Histories / / Future Projections – this exhibition brings together some of Australia’s leading Gallery 139 female contemporary artists working across screen- based media. A dLux MediaArts exhibition toured by 139A Beaumont Street, Hamilton 2303. Museums & Galleries of NSW. Also, Yes yes yes yes: T 0434-886-450. W www.gallery139.com.au graphics from the 1960s and 1970s – Joe Tilson, H Thurs-Sat 11.00 to 4.00, Sun 11.00 to 2.00. Eduardo Paolozzi and John Cage. An Art Gallery of July5to22Drawn Out group show – Ben Gallagher, NSW touring exhibition. Cherie Wren, Maddyson Hatton, Jill Orr and Bruce Roxburgh. July 26 to 12 Abstracted group show – Andrew Shilham, Judy Hill, Belinda Street, Frank Murri, Justin Lees and Ainslie Ivin-Smith.

Joan Ross, Colonial Grab (still), 2014, digital animation, 7:38 mins Courtesy the artist, Michael Reid Gallery, Sydney and Lake Macquarie City Art Gallery The Lock Up 90 Hunter Street, Newcastle 2300. T (02) 4925-2265. W www.thelockup.org.au H Wed-Sat 10.00 to 4.00, Sun 11.00 to 3.00. Maitland Regional Art Gallery Ben Gallagher, work in progress Courtesy the artist and Gallery 139 (MRAG) 230 High Street, Maitland 2320. T (02) 4934-9859 Gosford Regional Gallery F 4933-1657. E [email protected] W www.mrag.org.au Cultural Director Brigette Uren. 36 Webb Street, East Gosford 2250. T (02) 4304- H Tues-Sun 10.00 to 5.00. 7550. E [email protected] W www.gosfordregionalgallery.com Free entry. H Daily 10.00 to 4.00. Newcastle Art Gallery (NAG) 1 Laman Street, Newcastle 2300. T (02) 4974-5100. E [email protected] W www.nag.org.au Gallery Director: Lauretta Morton. H Tues-Sun 10.00 to 5.00, 7 days during school hols. To July 23 Hunter Red: Corpus. July 7 to Aug 26 Patricia Wilson Adams: stain me with the intensity of black. Aug 4 to Oct 21 Kilgour Prize 2018.

New South Wales 147 The University Gallery Coffs Harbour Regional Gallery and Senta Taft-Hendry Museum Cnr Coff and Duke streets, Coffs Harbour 2450. of Oceanic Art T (02) 6648-4863. E [email protected] W www.coffsharbour.nsw.gov.au/gallery Free entry. University of Newcastle, University Drive, Callaghan H Tues-Sat 10.00 to 4.00. To July 7 Autumn 2308. T (02) 4921-5255. Selection is a new multi-layered exhibition of five E [email protected] Australian artists working in fabric, fibre, ceramics W www.newcastle.edu.au/universitygallery and painting, whose works traverse our world from H Wed-Fri 10.00 to 5.00, Sat 12.00 to 4.00. ground to forest to sky. Featuring new works from July 11 to Aug 24 Painting the Song. Kerry Johns, Frances Larder, Timna Taylor, Elizabeth Tinker and Glen Wilkinson. July 13 to Sept 8 David Watt Space Fairbairn: Drawn to Print & Aleph Geddis: hard/soft Northumberland House, cnr King and Auckland 2018. Line is the foundation of David Fairbairn’s streets, Newcastle 2300. T Office (02) 4921-5188. art:from a density of line work, form emerges. Gallery 4921-8733. E [email protected] Fairbairn’s large-scale portraiture experiments with W www.newcastle.edu.au/community-and-alumni/ etching. From the etched line – then corroded and arts-and-culture/watt-space-gallery H Wed-Sun transformed by the printing process – the face and 11.00 to 5.00. June 27 to July 15 (opening Thurs personality of each subject is revealed. The sculptural June 28, 6.30pm) Fine Art Honours – Anne Snell, works of Aleph Geddis live at the intersection of Sharon Ridsdale and Emily Sinclair, and works by traditional methods and modernist forms, informed by Fibres Textile and Ceramics students. July 17 to Aug the stylised naturalism of Pacific Northwest carving 5 (opening Wed July 18, 6.30pm) High Performing and the essence of Platonic solids. Students Program (HPS). Also, solo shows by Karen Bolden and Maggie Hall. Northern Rivers Bank Art Museum Moree 25 Frome Street, Moree 2400. T (02) 6757-3320. W www.bamm.org.au Free entry. H Mon-Fri 10.00 to 5.00, Sat 10.00 to 1.00. To Aug 18 The Long Paddock – Zanny Begg, Josephine Starrs and Leon Cmielewski discuss the past, present and future of Australia’s Travelling Stock Routes. Curated by Joni Taylor. July 6 to Aug 18, 50 Years – Impressions by Moree artists – prints by local artists supporting The Moree Freedom Ride Scholarship.

David Fairbairn, Large Head G.E No. 1, 2016, copper etching, aquatint, power tools and drypoint on Grey BFK paper, 160 x 121cm Courtesy the artist and Coffs Harbour Regional Gallery

148 New South Wales Glasshouse Regional Gallery Manning Regional Art Gallery Cnr Clarence and Hay streets, Port Macquarie 2444. 12 Macquarie Street, Taree 2430. T (02) 6592-5455. T (02) 6581 8888. W www.glasshouse.org.au E [email protected] H Tues Fri 10.00 to 5.00, Sat Sun 10.00 to 4.00. W mrag.midcoast.nsw.gov.au H Wed-Sat 10.00 to 4.00, Sun 1.00 to 4.00. June 28 to Aug 12 Grafton Regional Gallery Doug Moran National Portrait Prize, and Moran Contemporary Photographic Prize. 158 Fitzroy Street, Grafton 2460. T (02) 6642 3177. E [email protected] W www.graftongallery.nsw.gov.au H Tues Sat Muswellbrook Regional 10.00 to 4.00, Sun 10.00 to 2.00. To July 22 Arts Centre Iconic Australian Houses: an exhibition by Karen Cnr Bridge and William streets, Muswellbrook 2333. McCartney.Also,Captivating Fashions of Yesteryear, T (02) 6549-3800. and 30 Years of Collecting: The Second Decade. E [email protected] W www.muswellbrook.nsw.gov.au/index.php/mrac- Lismore Regional Art Gallery home H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 11 Rural Street, Lismore 2480. T (02) 6627 4600. 1.00, Mon by appt. July 8 to Aug 26 My Mother’s E [email protected] Endearment – Wadagingie, and The End of the Vine W www.lismoregallery.org To July 22 Frequency Red by Maude Butta. Also, A Survey of Small Sculpture by REDinc.Also,Standing Rock by Angus Mordant. by Paul Selwood, The Losing Game – Max Watters July 7 to Aug 26 From Here to There: Australian Collection, and Three Well Known Australians by Art & Walking. July 28 to Sept 23 The Hurford Martin Shaw. Hardwood Portrait Prize. Retrospect Galleries 52 Jonson Street, Byron Bay 2481. T (02) 6680-8825. E [email protected] W www.retrospectgalleries.com H Daily 9.30 to 5.30. Cutting-edge collectable art from established and emerging Australian artists and designers.

Angus Mordant, Oceti Sakown Camp, North Dakota, USA – Saturday, September 10th, 2016, archival pigment print, 51 x 34cm Courtesy the artist and Lismore Regional Art Gallery

Bowral & District Art Society invites entries for the 2018 Inaugural Belle Property Bowral Prize – My Highland Home

The interpretation of “My Highland First Prize: $3,000 (acquisitive, sponsor retains artwork) Home” can be very broad and range Second Prize: $1,500 from landscape, local cafe scenes, People’s Choice Prize: $500 gardens, farmland, parks, markets, Entry Deadline: 25 July, 2018 vineyards, animals, people; your vision Works Delivered: 8 August, 2018 10am-1pm of the Highlands. Opening and Sponsored by Di Dixon, Prize Presentation: Friday 10 August at 6.30pm Principal of Belle Property Bowral Exhibition Open: 10 to 19 August, 10am - 4pm daily Bowral Art Gallery, 1 Short Street, Bowral Entry forms available: www.bdasgallery.com/artists-opportunities Belle Property, 373 Bong Bong St, Bowral Bowral Art Gallery, 1 Short St, Bowral

New South Wales 149 Southern South Coast Highlands Bega Valley Regional Gallery Zingel Place, Bega 2550. T (02) 6499-2202. Bowral Art Gallery E [email protected] W gallery.begavalley.nsw.gov.au 1 Short Street, Bowral 2576. T (02) 4861-4093. facebook.com/begavalleyregionalgallery. E [email protected] W www.bdasgallery.com H Tues-Fri 10.00 to 4.00, Sat 9.00 to 12.00. www.facebook.com/bowralartgallery. H Daily 10.00 To Sept 8 Balnhdhurr – A Lasting Impression – to 4.00, closed Wed for change of exhibitions. The Yirrkala Print Space. In a remote corner of Arnhem Bowral Art Gallery, home of the Bowral & District Land sits Yirrkala Print Space, where, for over 20 Art Society and BDAS workshops. June 29 to July 8 years, the ancient craft of printmaking has not only Pirtek Still Life Prize. Sponsored by Pirtek Southern survived, but prospered. A celebratory exhibition of Highlands. July 12 to 17 (opening Fri July 13, 6pm) this print space, Balnhdhurr – A Lasting Impression Through Our Eyes II by Hetty Thompson and Susan is presented by Artback NT in association with Buku- Curtin. July 19 to 24 (opening Sat July 21, 3pm) Larrnggay Mulka Centre. The exhibition is a vibrant Serendipity by Wayne Davis and Friends. acknowledgement of the creative energies, talent and commitment of generations of Yolngu artists who have Sturt Gallery & Studios utilised and pushed the boundaries of such a medium Cnr Range Road and Waverley Parade, Mittagong to share significant cultural and historical stories. 2575. T (02) 4860-2083. E [email protected] An Artback NT touring exhibition. W www.sturt.nsw.edu.au H Daily 10.00 to 5.00. Sturt was established in 1941 and is a nationally Duck Print Fine Art significant and award winning centre for the teaching, 39-41 Wentworth Street, Port Kembla 2505. sale, production and exhibition of contemporary T (02) 4276-1135. W www.duckprintfineart.com.au Australian craft and design. Prints for sale, workshops available, custom printing + editions.

150 New South Wales Wollongong Art Gallery combining film, photographs, textile panels and costumes to enact a collective consciousness around Cnr Kembla and Burelli streets, Wollongong 2520. the ever increasing environmental threats facing T (02) 4227-8500 F 4226-5530. our planet. The exhibition is formulated as a direct E [email protected] response to Smith’s experience as artist in residence W www.wollongongartgallery.com H Tues-Fri 10.00 in a remote Indigenous community in the Guna Yala to 5.00, Sat-Sun 12.00 to 4.00, closed Mon and region of Panama. public hols. To July 29 Chromophilia – an exhibition connecting objects from the Gallery collection by colour across a range of media and collecting areas with poetry by Ali Jane Smith. To Aug 26 Jewels in the Crown – features masterpieces and much loved works from the Gallery’s collection. To Sept 9 The Gift: Remembering Bob Sredersas – celebrating the significant and generous gift by Bronius (Bob) Sredersas, a Lithuanian migrant and steel worker whose personal art collection became the impetus for the establishment of Wollongong Art Gallery. Curated by Anne-Louise Rentell. To Sept 23 Red Alert! – paintings and works on paper from the John South, Skyworld, 2018, video installation collection evoking sensations of warmth, passion Courtesy the artist and Blue Mountains City Art Gallery and desire in celebration of Wollongong Art Gallery’s Ruby Anniversary. To Nov 11 East Meets West – works from the collection by contemporary Asian and Australian artists who have responded to Asian culture within their practice as well as the Mann-Tatlow collection of Asian Art. Blue Mountains Blue Mountains City Art Gallery 30 Parke Street, Katoomba 2780. T (02) 4780-5410. E [email protected] W www.bluemountainsculturalcentre.com.au Adults $5/Conc. $3. Children under 16 free. H Mon-Fri 10.00 to 5.00, Sat-Sun 10.00 to 4.00. Public hols 10.00 to 2.00. June 30 to Aug 19 Operation Art is the premier state wide visual arts exhibition for students from Kindergarten to Year 10. It is a unique contemporary children’s exhibition which encourages students to create artworks for children in hospital. Operation Art is an initiative of NSW Department of Education and The Children’s Hospital at Westmead. June 30 to Aug 19 John South: Skyworld – through film and installation John Kevina-Jo Smith, Queen of the Turtles, 2017, C-type print, South (Barkindji) explores Aboriginal astronomy and 101 x 81cm Photograph: Sofie Iverson the cultural and spiritual mythologies surrounding Courtesy the artist and Blue Mountains City Art Gallery the night sky. South uses the waterlily as a symbol of connection between the Skyworld above and the earth below. A Blue Mountains City Art Gallery exhibition Lost Bear Gallery curated by Rilka Oakley. July 7 to Aug 19 Kevina-Jo 98 Lurline Street, Katoomba 2780. Smith: Never Give Up – an immersive installation, T (02) 4782-1220. E [email protected] W www.lostbeargallery.com.au Director: Geoff White. H Daily 10.00 to 5.00.

New South Wales 151 Nolan on Lovel Gallery 56a Lovel Street, Katoomba 2780. T (02) 4782-6231. E [email protected] W nolanonlovelgallery.com.au H Thurs-Sun 10.00 to 5.00. Norman Lindsay Gallery & Museum 14 Norman Lindsay Crescent, Faulconbridge 2776. T (02) 4751-1067. E [email protected] W www.normanlindsay.com.au H Daily 10.00 to 4.00. The Norman Lindsay Gallery is the home of the Magic Pudding and displays the work of artist and writer Norman Lindsay (1879-1969). Rex-Livingston Art + Objects 182-184 Katoomba Street, Katoomba 2780. T (02) 4782-9988. E [email protected] Rachel Ellis, Interior – Light on Wall, 2002, charcoal and wash on W www.rex-livingston.com Director: David paper, 28 x 27cm Rex-Livingston. H Thurs-Tues 10.00 to 5.00. Private collection Courtesy the artist and Bathurst Regional Art Gallery Broken Hill Regional Art Gallery Central 404-408 Argent Street, Broken Hill 2880. T (08) 8080-3440. E [email protected] W www.bhartgallery.com.au Entry by gold coin Tablelands donation. H Open daily. To July 29 Badger Bates and Justine Muller. To July 30 Desert Landscapes: Broken Hill and Beyond by Steffie Wallace (see ad Western page 150). Districts Greater NSW Bathurst Regional Art Gallery 70-78 Keppel Street, Bathurst 2795. T (02) 6333- 6555. W www.bathurstart.com.au Free entry. H Tues-Sat 10.00 to 5.00, Sun and public hols 11.00 to 2.00. To Aug 5 Sustaining Light by Rachel Ellis. A Bathurst Regional Art Gallery exhibition. Also, STEEL: art design architecture. A JamFactory touring exhibition. Justine Muller has taken the footprints of over 200 Wilcannia residents Courtesy the artist and Broken Hill Regional Art Gallery

152 New South Wales Ceramic Break Sculpture Park Orange Regional Gallery ‘Bondi’, Warialda 2402. T (02) 6729-4147. 149 Byng Street, Orange 2800. T (02) 6393-8136. E [email protected] E [email protected] W www.org.nsw.gov.au W www.cbreaksculpturepark.com.au H Thurs-Sun H Daily 10.00 to 4.00. Closed Christmas Day, Boxing 10.00 to 5.00, or by appt. Continuing through July Day and Good Friday. is our annual Myall Creek Memorial Exhibition showcasing artworks by Indigenous artists Colin Suki & Hugh Gallery Isaacs, Brian Irving, Nick Levy, Elenore Harrison, 38A Gibraltar Street, Bungendore 2621. Jarrah Isaacs and Diane Marlow. T (02) 6238-1398. E [email protected] W www.sukihugh.com.au H Thurs-Sun 10.00 Cowra Regional Art Gallery to 4.00. June 30 to Aug 12 Studies with Light 77 Darling Street, Cowra 2794. T (02) 6340-2190. by Kirstie Rea and Lucy Palmer – this exhibition E [email protected] showcases the works of two exceptional artists, both W www.cowraartgallery.com.au Admission free. fascinated with light; Rea uses reflections captured H Tues-Sat 10.00 to 4.00, Sun 2.00 to 4.00. within a sheet of glass to capture a momentary view July 21 to Sept 2 the gallery reopens with Remember of a place, whereas Palmer creates sculptural forms me: the lost diggers of Vignacourt – an Australian which can hold and throw light. The two bodies of War Memorial touring exhibition. work speak of an interconnection between the idea that light can be used as a material, and that an Goulburn Regional Art Gallery artwork can be an act of experiencing. Goulburn Mulwaree Council, Civic Centre, Cnr Bourke and Church streets, Goulburn 2580. T (02) 4823- 4494. E [email protected] W www.grag.com.au Free entry. H Mon-Fri 10.00 to 5.00, Sat 1.00 to 4.00. June 29 to Aug 19, 2017 Archibald Prize.

ϐ 167 Banna Avenue, Griffith 2680. T (02) 6962- 8444. E [email protected] W www.griffithregionalartgallery.com.au H Wed-Fri 10.00 to 5.00, Sat-Sun 11.00 to 2.00. To July 22 For Country, For Nation. A touring exhibition from the Kirstie Rea, Expanded vision, 2018, digital print and folded glass, Australian War Memorial, Canberra. 78 x 115 x 10cm Photograph: David Paterson Murray Art Museum Albury Courtesy the artist and Suki & Hugh Gallery (MAMA) 546 Dean Street, Albury 2640. T (02) 6043-5800. Western Plains Cultural Centre E [email protected] Dubbo Regional Gallery The Armati Bequest, Dubbo W mamaalbury.com.au H Mon-Fri 10.00 to 5.00, Regional Museum and Community Arts Centre, 76 Thurs 10.00 to 7.00, Sat-Sun and public hols Wingewarra Street, Dubbo 2830. T (02) 6801-4444. 10.00 to 4.00. To July 8 Michael Riley. To July 22 W www.westernplainsculturalcentre.org National Photography Prize 2018. To Dec 31 Land H Daily 10.00 to 4.00, Fri 10.00 to 6.00. & Title. July 5 to Dec 9 Mechelle Bounpraseuth: To Aug 12 ACO Virtual. To Aug 26 Bowerbird: Westside Story. Clinton Bradley and the Art of Collecting. To Sept 2 Michelle Nikou: aeiou. June 30 to Sept 2 Sarah New England Regional McEwan: Unbind Me. Art Museum 106-114 Kentucky Street, Armidale 2350. T (02) 6772-5255. E [email protected] W www.neram.com.au H Tues-Sun 10.00 to 4.00.

New South Wales 153 Australian Capital Territory

154 Canberra Museum and Gallery Civic Cnr London Circuit and Civic Square, Canberra City 2600. T (02) 6207-3968. W www.cmag.com.au H Mon-Fri 10.00 to 5.00, Sat-Sun 12.00 to 4.00. Inner North Craft ACT Craft and Design Centre ANCA Gallery Level 1, North Building, 180 London Circuit, 1 Rosevear Place, Dickson 2602. T (02) 6247-8736. Canberra 2601. T (02) 6262-9333. E [email protected] W www.anca.net.au E [email protected] W www.craftact.org.au H Wed-Sun 12.00 to 5.00. July 5 to 15 (opening H Tues-Fri 10.00 to 5.00, Sat 12.00 to 4.00. Thurs July 5, 6pm) PIN8 an exhibition of contemporary miniature wearable art. Artists include Tamsin McLure, Sarah Murphy, Hannah Gason, Nancy Sever Gallery Valerie Kirk and more. July 18 to Aug 5 (opening Gorman Arts Centre, B Hall, cnr Batman and Currong Wed July 18, 6pm) Trees – Sharon Peoples, Wendy streets, Braddon 2604. T (02) 6182-0055. Dodd, Janet Meaney, Marli Popple, Susan Hey E [email protected] and Deborah Faeyrglenn – a reflection of six artist’s W www.nancysevergallery.com.au experience of seeing, being with and listening to trees H Wed-Sun 11.00 to 5.00. using textiles, paint, drawing, sound and video. Acton NewActon ANU Drill Hall Gallery Kingsley Street (off Barry Drive), Acton 2601. T (02) 6125-5832. E [email protected] W dhg.anu.edu.au Director: Terence Maloon. Free admission. H Wed-Sun 10.00 to 5.00. June 9 to July 29 Hilarie Mais, John Nixon and Gail Nichols. ANU School of Art Gallery 105 Childers Street, Acton 2602. T (02) 6125-5841. E [email protected] W soa.anu.edu.au H During Main Gallery exhibitions Tues-Fri 10.30 to 5.00. Closed Sat-Mon and public hols, unless advertised. CSIRO Discovery Centre Gallery North Science Road, Acton 2601. T (02) 6246-4646. E [email protected] H Mon-Fri 9.00 to 5.00. July 18 to Aug 15 (opening Wed July 18, 5.30 pm) BALANCE by Nic Mason. www.nicmasonartist.com

Sharon Peoples, Laced with Grevillea Robusta, 2018, machine Nishi Gallery embroidered; rayon, rayon polyester thread, 142 x 84cm 17 Kendall Lane, NewActon 2601. Courtesy the artist and ANCA Gallery T (02) 6287-6170. E [email protected] W newacton.com.au/place/nishi-gallery H Wed-Sun Canberra Contemporary Art 11.00 to 3.00. To July 22 The Inner Apartment – Space, Gorman Arts Centre Shireen Taweel, Hoda Afshar and Leila El Rayes. 55 Ainslie Avenue, Braddon 2612. T (02) 6247-0188. E [email protected] W www.ccas.com.au H Tues-Sat 11.00 to 5.00.

Australian Capital Territory 155 Canberra Glassworks Foreshore 11 Wentworth Avenue, Kingston 2604. T (02) 6260-7005. E [email protected] W www.canberraglassworks.com Free entry. Southside H Wed-Sun 10.00 to 4.00. To Aug 12 Confluence – Annette Blair, GW Bot, Nell, Paul House, Jeremy Beaver Galleries Lepisto, Peter Nilsson, Not, Tom Rowney, Luna Ryan and Nick Stranks. Throughout history, artists have 81 Denison Street, Deakin, Canberra 2600. worked with like-minded individuals as collectives, T (02) 6282-5294. E [email protected] collaborators and mentors. When artists working W www.beavergalleries.com.au Directors: Martin in different genres and unrelated forms collide and & Susie Beaver (member of ACGA). H Tues-Fri spark new ideas, the end result can be breathtaking. 10.00 to 5.00, Sat-Sun 9.00 to 5.00. Canberra’s Confluence embraces the results of the collective largest private gallery featuring regular exhibitions of exploration of glass by pairing experienced glass artists contemporary paintings, prints, sculpture, glass and with those who are less familiar with the medium. ceramics by established and emerging Australian artists. July 26 to Aug 12 nostalgia prints by Sophia Szilagyi. Also, Mysteries of the heart paintings and works on paper by Madeleine Winch. Canberra Contemporary Art Space, Manuka 19 Furneaux Street, Manuka 2603. T (02) 6247-0188. E [email protected] W www.ccas.com.au/ccas-manuka H Fri-Sun 11.00 to 5.00. June 28 to July 8 On The Air by Ellie Chalmers-Robinson. July 12 to 22 The Memory Within by Naomi Taylor Royds. Annette Blair, A Place for Everything, 2017, blown and hot sculpted glass, glass enamel Photograph: Adam McGrath Courtesy the artist, Beaver Galleries, Australian Capital Territory and Canberra Glassworks M16 Artspace 21 Blaxland Crescent, Griffith 2603. T (02) 6295-9438. E [email protected] W www.m16artspace.com.au H Wed-Sun 12.00 to 5.00. July 5 to 22 Gallery 1a: Singular Archivists – Llewellyn McGarry, Dierdre Pearce, Isobel Rayson, Alison Moeller and Kate McCambridge. Gallery 1b: Nexus by Brian Hincksman. Gallery 2: Project Reflect by Allison Jonas Young. Gallery 3: Amalgam by Phil Alldis. July 26 to Aug 12 Gallery 1: Studio Artists’ Exhibition 2018 – M16 Artspace studio artists. Gallery 2: 210 DEDREES – Studio Artists of Canberra Art Workshop. Gallery 3: Hands On Studio show – artists of Hands on Studio. July 28, 11.30- 4pm M16 Artspace Opening Studio.

Naomi Taylor Royds, Chinese Takeaway, rescued objects, aquasand and cement Courtesy the artist and Canberra Contemporary Art Space, Manuka

156 Australian Capital Territory Megalo Print Studio + Gallery 21 Wentworth Avenue, Kingston 2604. T (02) 6232- Greater 6041. E [email protected] W www.megalo.org H Tues to Sat 9.30 to 5.00. Canberra National Gallery of Australia (NGA) Belconnen Arts Centre Parkes Place, Parkes, Canberra 2600. 118 Emu Bank, Belconnen 2617. T (02) 6240-6411. E [email protected] T (02) 6173-3300. E [email protected] W www.nga.gov.au Admission to the permanent W www.belconnenartscentre.com.au collection is free. H Daily 10.00 to 5.00. To July 22 H Tues-Sun 10.00 to 4.00. Visit the gallery website Cartier: The Exhibition. To Aug 26 Over the rainbow for exhibition program. by Rachel Maclean, and Club Ate: Ex Nilalang. To Sept 24 Picasso: The Vollard Suite.ToDecArt Stirato Gallery Deco. From July 14 Andrew Rogers – a display 1/21 Iron Knobb Street, Fyshwick 2609. of maquettes of major works 1995-2015 for the T 0430-320-757. E [email protected] permanent collection of the NGA (see ad page 3). W www.stiratogallery.com H Mon-Sat 8.30 to 6.00. July 25 to 29 Gallery One and Gallery Two: FIELD National Library of Australia OF VISION a Bluethumb PopUp exhibition featuring Parkes Place, Canberra 2600. T (02) 6262-1111. Canberra artists – Crane, Trudinger, Hadfield, Fogarty, W www.nla.gov.au Free entry. H Daily 10.00 to 5.00. Osmotherly, Hill, Duke, Baird, Basnett and Connors. National Portrait Gallery Strathnairn Arts King Edward Terrace, Parkes 2600. 90 Stockdill Drive, Holt 2615. T (02) 6254-2134. T (02) 6102-7000. E [email protected] E [email protected] W www.strathnairn.com.au W www.portrait.gov.au H Daily 10.00 to 5.00. Free entry, all welcome. H Thurs-Sun 10.00 to 4.00. June 29 to Oct 1 So Fine: Contemporary women June 28 to July 22 Sanctuary: A Year at Mulligans artists make Australian history – featuring new works Flat paintings by Emily Birks. July 5 to Aug 12 from ten women artists reinterpreting and reimagining Barton Estate Drawing Prize. elements of Australian history. Forming part of the Portrait Gallery’s 20th birthday celebrations, the exhibition enriches the contemporary narrative around Australia’s history and biography, reflecting the tradition of storytelling in our country. Ticketed: $10/$8/$5. See ad page 7.

Linde Ivimey, The Girls, Zoe Davis and Linde Ivimey, 2018, steel Emily Birks, Bush Stone Curlew, 2017, ink on paper armatures, acrylic resin, cast and natural human, sheep turkey, fox, Courtesy the artist and Strathnairn Arts chicken and snake bones, earth, paper, natural fibre, dyed cotton, dyed and sewn viscera Courtesy the artist and National Portrait Gallery Tributary Projects Unit 9 Molonglo Mall, 105 Newcastle Street, Fyshwick 2609. E [email protected] W www.tributaryprojects.xyz H Thurs-Sun 11.00 to 5.00, or by appt.

Australian Capital Territory 157 Tasmania

158 The Henry Jones Art Hotel Hobart 25 Hunter Street, Hobart 7000. T (03) 6210-7700. E [email protected] W www.thehenryjones.com Showcasing leading and emerging Tasmanian artists with a changing display of original contemporary Sullivans Cove artworks. Mona Battery Point Museum of Old and New Art 655 Main Road, Berriedale, Hobart 7011. Art Mob T (03) 6277-9900. E [email protected] 29 Hunter Street, Hobart 7000. T (03) 6236-9200, W www.mona.net.au Visit website for details. 0419-393-122. E [email protected] To Feb 4 The Unmanned: Fabien Giraud and W www.artmob.com.au Director: Euan Hills. Raphaël Siboni: Part Two. To April 22, 2019 ZERO. H Daily 10.00 to 6.00. Aboriginal fine art, including Tasmanian Aboriginal artists. Colville Gallery 91a Salamanca Place, Hobart 7004. T (03) 6224- 4088, 0419-292-626. E [email protected] W www.colvillegallery.com.au H Daily 10.00 to 5.00. June 29 to July 18 Native Engagement by Kylie Elkington. July 27 to Aug 7 Tasman Island by Luke Wagner. July 29 to Aug 7 Gallery 2: Characters by Alan Young. Despard Gallery Level 1, 15 Castray Esplanade, Hobart 7000. T (03) 6223-8266. E [email protected] Fabien Giraud and Raphaël Siboni, 1953 – The Outlawed, The Unmanned Season 1, Episode 3, 2018, HD video, 13mins W www.despard-gallery.com.au H Mon-Fri 11.00 © the artists to 6.00, Sat 10.00 to 4.00, Sun 11.00 to 4.00. Courtesy the artists and Mona – Museum of Old and New Art June 27 to July 22 (opening Fri June 29, 5.30pm) The Crossings by Anne Morrison. July 25 to Aug Plimsoll Gallery 19 (opening Wed July 25, 5.30pm) Half Fool, Half Entity by Wayne Brookes. School of Creative Arts, University of Tasmania Hadley’s Orient Hotel Hunter Street, Hobart 7000. T (03) 6226-4300. 34 Murray Street, Hobart 7000. T (03) 6237-2999. E [email protected] E [email protected] W www.utas.edu.au/creative-arts/events/plimsoll- W www.hadleysartprize.com.au July 21 to Aug 25 gallery H Daily 12.00 to 5.00 during exhibitions, Hadley’s Art Prize Finalists’ Exhibition. closed on Tues and public hols. July 6 to 12 (opening For prize-related events and accommodation Fri July 6, 5.30pm) Higher Degrees by Research packages visit hadleyshotel.com.au PhD examination exhibition – Antonia Aitken and David Edgar. July 21 to 30 (opening Fri July 20, 5.30pm) Higher Degrees by Research PhD Handmark Gallery examination exhibition – Nathan Taylor. Unique Tasmanian Art & Design, 77 Salamanca Place, Hobart 7000. Also, 2 Russell Street, Evandale, 7212. T Hobart: (03) 6223-7895, Salamanca Arts Centre Evandale: (03) 6391-8193. 65-77 Salamanca Place, Hobart 7000. E Hobart: [email protected], T (03) 6234-8414. E [email protected] Evandale: [email protected] W www.salarts.org.au H Daily 10.00 to 5.00. W www.handmark.com.au Hobart: July 6 to 23 July 2 to 31 Where To Now by Tania Price – Black and White – David Edgar, Julie Payne, Ella considers what happens when ubiquitous media Noonan and Luisa Romeo. Also, new sculpture by images are translated through paint and through the Sally Curry. July 27 to Aug 13 Emily Blom and hand of the artist. Also, Angry Underwear by Tania Katina Gavalas – new paintings and works on paper. Ferrier. July 26 to Aug 8 Reclaimed: Objects and Evandale: to July 18 ’Still Life’ Exhibition – new Images from Home by Stephanie Theobald and works. July 22 to Aug 15 Kit Hiller’s 70th Birthday Bronwyn Theobald. Exhibition – prints and paintings.

Tasmania 159 Tasmanian Museum and Art Gallery Launceston Dunn Place (enter via the Watergate), Hobart 7000. T (03) 6165-7000. E [email protected] W www.tmag.tas.gov.au H Tues-Sun 10.00 to 4.00 Academy Gallery closed Mon, Good Friday, Anzac Day and Christmas School of Creative Arts, Academy of the Arts, Day. To July 22 Lola Greeno: Cultural Jewels. To July University of Tasmania, Invermay Road, Inveresk, 29 A Journey to Freedom. Part of Dark Mofo 2018. Launceston 7250. T (03) 6324-4410. E [email protected] W www.utas.edu.au/creative-arts Director: Dr Malcom Wagner Framemakers Bywaters. Free admission. H Mon-Fri 9.00 to 5.00, 72 Brisbane Street, Hobart 7000. T (03) 6234-8599. closed weekends and public hols. July 16 to Sept 7 E [email protected] The Car Show, curated by Jason Lavroff. W www.wagnerframemakers.com.au Wagner Also, Towards an Origin by Michael Kay, curated by Framemakers offers a fresh and contemporary Dr. Malcom Bywaters. approach to fine art picture framing. Queen Victoria Museum & Art Gallery Art Gallery at 2 Wellington Street, and Museum at North Hobart 2 Invermay Road, Launceston 7250. T (03) 6323-3777. W www.qvmag.tas.gov.au Bett Gallery Hobart H Daily 10.00 to 5.00. Art Gallery: to Aug 5 Bett Gallery is moving to Level 1, 65 Murray Street, Community Collector – the eclectic treasures of Hobart 7000. T (03) 6231-6511. Launceston’s Dr Eric Ratcliff. To Sept 2 Artist and the E [email protected] W www.bettgallery.com.au Collection: Material Memories – Susan Buchanan, Director: Emma Bett (member of ACGA). H Mon-Sat Janine Combes, Penelope Davis, Eli Giannini, Robyn 11.00 to 6.00. July 27 to Aug 17 (opening Sat July Pelan and Sarah Stubbs. To Oct 7 Landmark by 28, 6-10pm) On a clear day by Pat Brassington. Ilona Schneider – haunting yet beautiful depictions Also, Mistake by Amanda Davies. of the Tasmanian landscape exploring humanity’s uses and imprints. To Nov 11 Disappearing into Being by Robyn McKinnon – one of Tasmania’s most Contemporary Art Tasmania important contemporary artists, McKinnon has a 27 Tasma Street, North Hobart 7000. stylistically diverse practice spanning more than 40 T (03) 6231-0445. E [email protected] years. Museum: to Oct 28 Spiders – this is a face-to- W www.contemporaryarttasmania.org H Wed-Sun face interactive encounter with real spider specimens 12.00 to 5.00. To July 15 Delay by James Newitt. including live Australian Tarantulas, Giant Water Presented as part of Dark Mofo 2018. Spiders and deadly Funnel-webs and Redbacks. Sawtooth ARI Level 1, 160 Cimitiere Street, Launceston 7250. T (03) 6331-2777. E [email protected] W www.sawtooth.org.au Director: Paul Eggins Free entry. H Wed-Fri 12.00 to 5.00, Sat 10.00 to 2.00. North West James Newitt, I go further under, 2018, film still Courtesy the artist and Contemporary Art Tasmania Coast Burnie Regional Art Gallery Burnie Arts & Function Centre, Wilmot Street, Burnie 7320. T (03) 6430-5875. E [email protected] W www.burniearts.net H Mon-Fri 10.00 to 4.30, Sat-Sun and public hols 1.30 to 4.00. To July 29 Tasmanian Naivists. Also, A Stitch in Time, and 2018 Betta Milk Burnie Wearable Paper Art Competition – paper on skin.

160 Tasmania Opening of ‘Tasmanian Naivists’ at Burnie Regional Art Gallery, 2018 Photograph: Grant Wells Courtesy the Burnie Regional Art Gallery Devonport Regional Gallery 45-47 Stewart Street, Devonport 7310. T (03) 6424-8296. E [email protected] W www.devonportgallery.com Free entry. H Mon-Fri 10.00 to 5.00, Sat 12.00 to 5.00, Sun and public hols 1.00 to 5.00. July 7 to Aug 19 Main Gallery: Play On: The Art of Sport / Ten Years of the Basil Sellers Art Prize. A NETS Victoria and Ian Potter Museum of Art touring exhibition.

Lauren Brincat, 10 metre platform (still), 2012, single-channel HD video Courtesy the artist, Anna Schwartz Gallery, Melbourne and Devonport Regional Gallery

Tasmania 161 South Australia

162 Adelaide Central Gallery Adelaide 7 Mulberry Road, Glenside 5065. T (08) 8299-7300. E [email protected] W www.acsa.sa.edu.au H Mon, Tues Thurs-Fri 9.00 to 5.00, Wed 9.00 to ACE Open 6.45. After hours by appt. July 9 to Aug 4 Her Name Lion Arts Centre, North Terrace (West End), Kaurna – Kay Lawrence, Pierre Mukeba, Cynthia Schwertsik Yarta 5000. T (08) 8211-7505. and Jane Skeer. A sensitive contemplation on the E [email protected] W www.aceopen.art fabric of female identity. These artists deal with the Free admission. H Tues-Sat 11.00 to 4.00. South way in which women are represented, regarded and Australia’s leading organisation for contemporary remembered. By turns, evocative, powerful and witty, visual art and artists. To July 7 Into My Arms – the works on display examine the threads of family amira.h., Katherine Botten, Eugene Choi, Matt relationships, the recollection of past selves, and the Huppatz, Lonelyspeck, Grace Marlow, Sione Monu, politics of small business. Kate Power & Susie Fraser and Athena Thebus. July 28 to Sept 15 The Garden by Julia McInerney. Also, SONGS FOR A ROOM by Gerry Wedd.

Gerry Wedd, works in progress, 2018 Photograph: Michael Mason Courtesy the artist and ACE Open

Pierre Mukeba, Christine Kitenge, 2016, brush pen and fabric applique on cotton, 230 x 112cm SPECIALISING IN SENNELIER OIL PAINTS, WATERCOLOURS, Courtesy the artist and Adelaide Central Gallery PASTELS, DRAWING INKS & BELGIAN LINEN. ALSO STOCKING ART SPECTRUM, DANIEL SMITH, Anne & Gordon Samstag ARCHES, LANGRIDGE, CONTE, LUKAS PLUS MANY MORE. Museum of Art 83 Commercial Road, Port Adelaide SA 5015 Ph: (08) 8241 0059 • Fax: (08) 8241 0058 University of South Australia Open: Monday-Friday 8.30-5.00, Saturday 9.00-2.00 55 North Terrace, Adelaide 5000. T (08) 8302-0870. [email protected] • www.portartsupplies.com.au E [email protected] W www.unisa.edu.au/samstagmuseum Free admission, all welcome. H Tues-Fri 10.00 to 5.00, Sat 12.00 to 5.00. Closed public hols and during exhibition changeovers. To Aug 31 Aldo Iacobelli: A Conversation With Jheronimus. Also, Tracey Moffatt & Gary Hillberg: Montages: The Full Cut 1999-2015.

South Australia 163 Art Gallery of South Australia Hugo Michell Gallery North Terrace, Adelaide 5000. T (08) 8207-7000. 260 Portrush Road, Beulah Park 5067. W www.artgallery.sa.gov.au Free entry. H Daily 10.00 T (08) 8331-8000 F 8331-7000. to 5.00. Guided tours daily at 11.00 and 2.00. To E [email protected] July 29 Colours Of Impressionism: Masterpieces W www.hugomichellgallery.com H Tues-Fri 10.00 From The Musée d’Orsay – charts the revolution of to 5.00, Sat 11.00 to 4.00, or by appt. To July 14 colour that lies at the very heart of Impressionism Living Rocks by James Darling and Lesley Forwood. and includes master works by Monet, Renoir, Manet, Also, Spurious Natures by Sue Kneebone. July 19 to Morisot, Pissarro and Cézanne, among many others. Aug 24 Tactile Site by Tim Sterling. July 19 to Aug Set against the backdrop of the Art Gallery of South 25 We use our Kapurta (heads) for looking after Australia’s 19th century Elder Wing, this major things – Yarrenyty Arltere Artists. exhibition includes more than 65 Impressionist masterpieces from the renowned collection of the JamFactory Musée d’Orsay in Paris. Book tickets online at artgallery.sa.gov.au See ad page 46. Contemporary Craft & Design 19 Morphett Street, Adelaide 5000. T (08) 8410-0727. W www.jamfactory.com.au H Daily 10.00 to 5.00. July 27 to Sept 16 JamFactory Icon 2018 – Clare Belfrage: Measuring Time. Kerry Packer Civic Gallery at the Bob Hawke Prime Ministerial Centre UniSA Hawke Building, Level 3, 55 North Terrace, Adelaide 5000. T (08) 8302-0371. W www.hawkecentre.unisa.edu.au H Mon-Fri 9.00 Camille Pissarro, France, 1830-1903, Allée de la Tour-du-Jongleur to 5.00, Thurs 9.00 to 7.00. To July 10 SA Refugee et maison de M. Musy, Louveciennes (Tour-du-Jongleur Lane and Week Youth Poster Exhibition – features posters M.Musy’s house, Louveciennes), c1872, oil on canvas, 52 x 81cm created by students that celebrate the UN International Musée d’Orsay, Paris, France ©photo Musée d’Orsay / rmn Courtesy Art Gallery of South Australia Refugee Convention by communicating how refugees are welcomed, become part of and contribute to the Australian ‘family’. July 13 to Aug 1 Throw the Dice – FELTspace features a diverse range of artworks by local emerging 12 Compton Street, Adelaide 5000. T 0418-267-005. artists experiencing mental illness, curated by Elyas E [email protected] W www.feltspace.org Alavi and with the support of Neami National. H Wed-Thurs 1.00 to 4.00, Fri 1.00 to 7.00, Sat 10.00 to 4.00, or by appt. FELTdark hours Wed-Sat SASA Gallery Dusk to 12.00am. July 5 to 21 Front Gallery: A Kind of Collective Breathing by Anna Dunnill. University of South Australia, Level 2 Kaurna Building, Back Gallery: Yamano Seijaku (Mountain Silence) by cnr Hindley Street and Fenn Place, Adelaide 5000. Alice Blanch. FELTdark: Window by Laura Moore. T (08) 8302-9274. E [email protected] W www.unisa.edu.au/sasa-gallery H Mon-Fri 11.00 to 5.00. Closed public hols and during exhibition GAGPROJECTS | changeovers. Greenaway Art Gallery 39 Rundle Street, Kent Town 5067. Sister Gallery T (08) 8362-6354. E [email protected] 26 Sixth Street, Bowden 5007. W gagprojects.com Director: Paul Greenaway. E [email protected] H Tues-Fri 11.00 to 6.00, Sat-Sun 12.00 to 5.00. W www.sistergallery.com.au July 25 to Aug 26 Pierre Mukeba, Julia Robinson, www.facebook.com/sistergallerysister Darren Siwes and James Tylor. SALA Festival. Artist-run gallery and project space Sister Gallery is a Fontanelle Gallery and Studios supported project. Heartland Studio To July 20 Gallery 1: Army of Me by India Kenning. 558 Marion Road, Plympton Park 5038. T 0458-742-715. W www.facebook.com/Jungle- State Library of South Australia Phillips-84033841545 H Wed-Sun 10.00 to 3.00. North Terrace and Kintore Avenue, Adelaide 5000. Jungle Phillips and Frantastic Fran. T (08) 8207-7250. W www.slsa.sa.gov.au H Mon-Wed 10.00 to 8.00, Thurs-Sun 10.00 to 5.00. To Aug 12 To Tell Another’s Story: Australian Refugee Association Portrait Exhibition. Featuring portraits of local refugees by South Australian artists.

164 South Australia Burra Regional Art Gallery 5-6 Market Street, Burra 5417. T (08) 8892-2411. W www.burragallery.com H Tues-Sun 1.00 to 4.00. To July 15 Main Room: The Beauty of Biology by Hellen Bakhoff. Bence Room: Genius Loci of the Mid North by Sue Michael. July 19 to Aug 26 Main & Bence: Here, there, everywhere – SALA: Cait Wait and the Warraweena Artists.

ϐ Seppeltsfield, 730 Seppeltsfield Road, Seppeltsfield 5355. T (08) 8562-8149. W www.jamfactory.com.au H Daily 11.00 to 4.00. July 17 to Sept 16 FUSE Glass Prize. Kapunda Community Gallery 67-69 Main Street, Kapunda 5373. E [email protected] W www.kapundagallery.com Free entry, wheelchair access. H Mon-Sat 10.00 to 4.00, Sun 10.00 to 3.30. To July 22 Penguin Bloom photography – Kapunda Monday Art Group. July 26 to Sept 2 Open Exhibition for SALA – ‘Urban Life – Still Life’.

Leah Jeffries, Zabair Safi, 2018, oil on masonite Courtesy the artist and State Library of South Australia SA Regional Tandanya – National Aboriginal Cultural Institute Ascot Theatre Gallery 48 Graves Street, Kadina 5554. T (08) 8821-2404. 253 Grenfell Street, Adelaide 5000. W www.coppercoast.sa.gov.au H Mon-Fri 10.00 to T (08) 8224-3200. W www.tandanya.com.au 4.00, Sat 10.00 to 12.00. To July 24 Country Arts Established in 1989. Australia’s oldest Aboriginal- SA – Craft Anonymous. owned and managed multi-arts centre. Belalie Art Gallery 6 Irvine Street, Jamestown 5491. T (08) 8664-0455, 8664-1567. W www.visitjamestown.com.au/project/ Barossa Valley belalie-art-gallery The gallery hosts a vast range of curated exhibitions all year round. At other times the Adelaide Hills gallery’s own collection is on display. Millicent Gallery Civic Centre, Ridge Terrace, Millicent 5280. Greater T (08) 8733-0903. E [email protected] W www.wattlerange.sa.gov.au www.facebook.com/MillicentLibraryGallery H Tues Adelaide and Fri 9.00 to 5.30 and 6.30 to 8.30, Wed-Thurs 9.00 to 5.30, Sun 2.00 to 4.00. Barossa Regional Gallery 3 Basedow Road, Tanunda 5352. T (08) 8563-0849. Port Pirie Regional Art Gallery E [email protected] W www.barossagallery.com 3 Mary Elie Street, Port Pirie 5540. H Daily 11.00 to 4.00. To July 23 The Colour of T (08) 8633-0681. W pprag.org.au H Mon-Fri 9.00 Water by Gaynor Hartvigsen and Mel Bone-Manser. to 5.00, Sat-Sun and public hols 11.00 to 3.00. Closed Good Friday and Christmas Day. To Aug 2 Wanton, Wild and Unimagined by Alison McDonald.

South Australia 165 Western Australia

166 with WA’s South Coast. The artists initially shared the transformative, life-affirming experiences of raising Fremantle families and building homes on a shared property in the bush. Subsequently they have each developed Artitja Fine Art a visual language to interpret the natural heritage of the country they know so well, and their relationship South Fremantle, 6162. T (08) 9336-7787, to it. Both utilise natural materials and work across 0418-900-954. E [email protected] a wide range of media. Running Deep encompasses W www.artitja.com.au Directors: Anna Kanaris and print making, artist books, sculpture, dyed and Arthur Clarke. H By appt. Call or email to view art embroidered textiles and video. in a relaxed environment. Artitja Fine Art holds up to four external exhibitions a year, details of which can be found on their website. Recipients: Outstanding Cultural Enterprise award 2017 Fremantle Business Awards. July 8 to 15 Our Place Our Time. Check website for exhibition details. Fremantle Arts Centre 1 Finnerty Street, Fremantle 6160. T (08) 9432-9555. E [email protected] W www.fac.org.au Free entry. H Daily 10.00 to 5.00. To July 15 Rachael Dease: Like Embracing Ice – accomplished WA sound artist and composer Rachael Dease has scored a work with audio captured from Rachael Dease, Like Embracing Ice (Ytre Norskøya Votive #11) the depths of the Arctic Sea, using hydrophones (detail), 2017 floating under drifting icebergs and microphones Photograph: Rachael Dease lowered into glacial cracks. Also, Caspar Fairhall: Courtesy the artist and Fremantle Arts Centre Nine times the space that measures day and night – crisp, vibrant colour and rich surfaces characterise Heathcote Museum and Gallery Caspar Fairhall’s (WA) paintings, which draw on Swan House, Heathcote Cultural Centre, 58 Duncraig both geometric abstraction and the often complex Road, Applecross 6153. T (08) 9364-5666. spatial structures of late Renaissance and Baroque E [email protected] art. This suite of large paintings were conceived as a W www.heathcotewa.com/heathcotegallery H Tues-Fri meditation on the nature of landscape and our place 10.00 to 3.00, Sat-Sun 12.00 to 4.00. To July 22 in geological time. Also, Semiconductor – UK artists The Isthmus by Jon Tarry and Cameron Robbins. Ruth Jarman and Joe Gerhardt bring two of their July 28 to Sept 2 (opening Fri July 27, 6-8pm) works ‘Brilliant Noise’ and ‘Black Rain’ to FAC. They DOUBLE BRICK. seek to extend our experience of the natural world, delving into and creating visual interpretations of unseen worlds by transforming and stitching together Japingka Gallery images of scientific data. Also, Gifted – recognises 47 High Street, Fremantle 6160. T (08) 9335-8265. a generous donation of 17 prints and paintings E [email protected] W JapingkaAboriginalArt.com by senior WA and Fremantle-based artists to the H Open daily. To July 11 Gallery 1: Land and Sky: City of Fremantle Art Collection by longstanding Warlpiri Artists. Gallery 2: Ömie Artists from Papua Fremantle resident and art collector, Mary Harrison New Guinea + Tjanpi Desert Weavers. From July 20 Hill, in recognition of her husband Chris Hill, who Gallery 1: Lockhart River Artists – Fiona Omeenyo died suddenly in 2014. Chris Hill was a significant and Rosella Namok. Gallery 2: Edward Blitner: advocate and supporter of contemporary WA and Freshwater Billabongs. Balinese artists. July 21 to Sept 8 Bush Women: 25 years on. FAC restages the ground-breaking show Moores Building Bush Women: Fresh Art from Remote WA, the first exhibition to focus on the practices of key Aboriginal Contemporary Art Gallery artists in the Kimberley and Western Desert – Paji 46 Henry Street, Fremantle 6160. Honeychild Yankkarr, Daisy Andrews, Queenie T (08) 9432-9898. E [email protected] McKenzie, Kanytjuri Bates, Tjingapa Davies and W www.fac.org.au/about/moores-building Mary McLean. Bush Women is co-curated by John H Daily 10.00 to 4.00. June 30 to July 15 (opening Kean and FAC’s Erin Coates. Also, Running Deep: Fri June 29, 6pm) The End of Summer is the fourth Holly Story and Kati Thamo | City of Fremantle solo exhibition by Frans Bisschops and explores a Art Collection – looks at the practices of senior WA modern life by the sea - summer, sun, sharks, love, artists Holly Story and Kati Thamo through the lens broken hearts, new weather, suntans and surf. Oil and of their enduring friendship and creative engagement acrylic paintings merging contemporary beach scenes with elements of 20th century Australian beach culture. July 21 to Aug 5 (opening Fri July 20, 6pm) Mindscapes 2018 are the latest works by members

Western Australia 167 of the Contemporary Australian Surrealist Movement There Is (CASM). Artists David Foster, Denise Markus, Ernst 49 Stuart Street, Northbridge 6003. Shneider, Janie Benzie, Jill Bond, Jyoti McKie, Marie T (08) 9228-4111. W www.instagram.com/_there_is_ Lochman, Steven Pegg, Jana Vodesil-Baruffi and July 18 to Aug 10 Drink Heart | Cool Eyes by Joshua Gabriela Himstedt, showcase a huge variety of styles, Webb – new abstract sculptures. talents and mediums from this group and ranges from fantasy to surrealist works. Wanneroo Gallery Wanneroo Library and Cultural Centre, 3 Rocca Way, Wanneroo 6065. W wanneroo.wa.gov.au/ wanneroogallery Free entry. H Mon-Sat 10.00 to Perth City 4.00, closed Sun and public hols. Art Gallery Of Western Australia Perth Cultural Centre, James Street Mall, Perth 6000. T (08) 9492-6600 F 9492-6655. Subiaco W www.artgallery.wa.gov.au Free entry unless stated otherwise. H Wed-Mon 10.00 to 5.00 (closed Tues). To July 16 Year 12 Perspectives 2017 – showcases Lawrence Wilson Art Gallery work by some of the best, brightest and most talented UWA, 35 Stirling Highway (cnr Fairway), Crawley graduating high school artists in WA. Vote for your 6009. T (08) 6488-3707. E [email protected] favourite work in the Act-Belong-Commit People’s W lwag.uwa.edu.au H Tues-Sat 11.00 to 5.00. Choice Award. To Aug 13 WA Now: Babanyu (Friends To July 7 In Light of Shadows – focusing on the for life) by Julie Dowling takes a step back in time to Berndt Museum’s Asian Collection, In Light of a period (1993-2005) when First Nation Badimaya Shadows encourages audiences to question the artist, Dowling, emerged as one of the most important meaning of light and/or darkness in relation to other artists in Western Australia and the country. To Sept cultures and within themselves. To Aug 18 Stewart 17 Chinese Ceramics Revealed, 5th Century BC- Scambler: Fragment – Scambler presents a new 1983: Highlights from the Yuen Collection – drawing body of work, a striking assembly of large-scale from a significant recently revealed private collection sculptural forms and murals inspired by his recent in Perth, this exhibition presents an overview of over journey through the Pilbara and Kimberley. Also, 60 Chinese ceramic objects of superb artistic quality, Modern Australian Landscapes, 1940s-1960s: ranging from the Warrior State period (5th century Works from the University of Western Australia Art BCE) to the late 20th century, thus highlighting Collection – explores the modern landscape tradition the path of its production, with its similarities and in Australian art, through works in the University differences, for nearly 2,500 years. Now showing of Western Australia Art Collection. Also, Authentic AGWA Collection – Five paths, many journeys – with Determination – Brigid Noone applies her unique more than 17,500 works in the AGWA Collection, methodology, an experimental hybrid of artistic and take a tour through time starting with AGWA Historical curatorial processes, to the Cruthers Collection of through to AGWA Modern and AGWA Contemporary. Women’s Art. July 21 to Dec 8 Stockyards and Immerse yourself in WA art by visiting the WA Saddles: A story of Gibb River Station – explores the Journey gallery featuring art pieces from the 1920s to lives of those living and working on the remote cattle today or view AGWA Six Seasons, a space dedicated station of Gibb River in the East Kimberley region from to Indigenous art. the early 1900s until the 1990s. Presented by the Berndt Museum. Perth Institute of Contemporary Arts (PICA) Linton & Kay Galleries Perth Cultural Centre, 51 James Street, Perth 6000. Subiaco T (08) 9228-6300. E [email protected] 299 Railway Road (cnr Nicholson Rd), Subiaco 6008. W www.pica.org.au Free entry. H Tues-Sun 10.00 to T (08) 9388-3300. E [email protected] 5.00. To July 15 Hatched: National Graduate Show W www.lintonandkay.com.au H Mon-Sat 10.00 to 2018 – features work by recent art graduates selected 4.00, Sun 11.00 to 4.00. To July 8 Antelands by from 23 different tertiary institutions across Australia. Stephanie Reisch. July 14 to Aug 5 Anti Gravity by Hatched will once again test the pulse of Australia’s Stephen Glassborow. emerging arts scene while acting as an important platform for the next generation of Australian artists. From painting, sculpture and drawing, to installation, video, and sound work, this exhibition offers an intriguing snapshot of current contemporary art practices in Australia.

168 Western Australia Regional Bunbury Regional Art Gallery 64 Wittenoom Street, Bunbury 6230. T (08) 9792-7323. E [email protected] W www.brag.org.au H Daily 10.00 to 4.00. To July 8 Curating Connection: Art, Language & Country. To Aug 5 Claire Kastelan: Beneath the Red. To Aug 19 Emily Hornum: Do you think of that when you feel lonely or sad? To Aug 26 Helen Seiver: Are We There Yet? Geraldton Regional Art Gallery 24 Chapman Road, Geraldton 6530. T (08) 9956-6750. E [email protected] W artgallery.cgg.wa.gov.au H Mon-Sat 10.00 to Stephanie Reisch, Amazonica, 2018, oil on canvas, 120 x 120cm 4.00, public hols 1.00 to 4.00. To Aug 4 Wonderwall © the artist by Kevin Robertson. Also, Angela Stewart new works, Courtesy the artist and Linton & Kay Galleries You Made Me Do It, and Bead Friends Forever. Linton & Kay Galleries West Perth 11 Old Aberdean Place, West Perth 6005. T (08) 6465 4314. E [email protected] W www.lintonandkay.com.au H Mon-Sat 10.00 to 4.00. Greater Perth John Curtin Gallery Building 200, Curtin University, Kent Street, Bentley 6102. T (08) 9266-4155. E [email protected] W www.johncurtingallery.curtin.edu.au Free entry. H Mon-Fri 11.00 to 5.00, Sun 12.00 to 4.00. Linton & Kay Galleries Mandoon Estate Gallery 10 Harris Road, Cavisham 6055. T (08) 6465- Angela Stewart, Sapience 10, oil on board 4314. E [email protected] Courtesy the artist and Art Collective WA W www.lintonandkay.com.au H Fri-Sun and public hols 11.00 to 5.00. Margaret River Gallery Shop 4, 1 Charles West Avenue, Margaret River Mundaring Arts Centre 6285. T (08) 9757-2729. 7190 Great Eastern Hwy, Mundaring 6073. E [email protected] T (08) 9295-3991. W www.margaretrivergallery.com.au H Mon-Sat E [email protected] 10.00 to 5.00, Sun 10.00 to 3.00. W www.mundaringartscentre.com.au Free entry. H Tues-Fri 10.00 to 5.00, Sat-Sun 11.00 to 3.00, Port Hedland closed Mon and public hols. To July 15 Gallery 1: Courthouse Gallery Woldendorp: A Black and White Retrospective. Gallery 2: Silent Synchronicity – Artist in Residence, 16 Edgar Street, Port Hedland T (08) 9173-1064. Stephanie Reisch. E [email protected] W www.form.net. au/project/port-hedland-courthouse-gallery H Mon-Fri 9.00 to 4.30, Sat 9.00 to 3.00.

Western Australia 169 Northern Territory

170 Godinymayin Yijard Rivers Arts Northern Centre for and Cultural Centre Contemporary Art (NCCA) Stuart Highway, Katherine East 0850. Vimy Lane, Parap 0820. T (08) 8981-5368. T (08) 8972-3751. E [email protected] W nccart.com.au H Mon-Fri 10.00 to 4.00, W www.gyracc.org.au H Tues-Fri 10.00 to 5.00, Sat Sat 10.00 to 2.00, or by appt. Closed public hols. 10.00 to 3.00. To July 21 Fercund Fertile Worlds. The Northern Centre for Contemporary Art delivers leading local, national and international contemporary art to Darwin. July 6 to Aug 7 (opening Fri July 6, 6pm) Mind The Gap by Kristian Laemmle-Ruff – a somewhat dark and politically charged meditation on Darwin the gap between Australian cultures. It is not asking us to close the gap, to homogenise or assimilate; ANKAAA The Association of rather it asks us to acknowledge the gap, nurture the gap, celebrate the diversity rather than deny its Northern, Kimberley and existence. Mind the Gap encourages us to imagine Arnhem Aboriginal Artists a future with deeper reconciliation and stronger Frog Hollow Centre for the Arts, 56 McMinn Street, acknowledgment of our true history rather than having Darwin 0801. T (08) 8981-6134. our heads in the sand. E [email protected] W www.ankaaa.org.au Working together to keep art, country and culture strong since 1987. Association of Northern, Kimberley and Arnhem Aboriginal Artists (ANKAAA). Charles Darwin University Art Gallery Kristian Laemmle-Ruff, Pine Gap (a photograph of the centre of Australia), 2014, 1 of 5 + AP, Duratran print in Blackwood light- Ground Floor, Building Orange 12, Casuarina box, 128 x 37 x 18.5cm Campus, Darwin 0909. T (08) 8946-6621. Courtesy the artist and Northern Centre for Contemporary Art W cdu.edu.au/artgallery H Wed-Fri 10.00 to 4.00, Sat 10.00 to 2.00. Visit our website for programs Outstation Gallery and events. To July 21 Yidumduma Bill Harney – Bush Professor. 8 Parap Place, Parap, Darwin 0820. T (08) 8981-4822. W www.outstation.com.au Outstation Gallery works directly with art centres in Museum and Art Gallery of the the presentation and promotion of Indigenous art from Northern Territory (MAGNT) the Tiwi Islands, Arnhem Land, the Western Desert, 19 Conacher Street, The Gardens, Darwin 0820. the Kimberley and Central and South Australia. T (08) 8999-8264. E [email protected] June 30 to July 24 Papunya Tjupi. W www.magnt.net.au Free entry. H Daily 10.00 to 5.00. To July 15 Defying Empire 3rd National Tactile Arts – Contemporary Indigenous Art Triennial. To Feb 17, 2019 Out of the Craft Studios and Gallery Dark: From the MAGNT Collection (see ad page 32). From June 30 Unruly Days Territory life 1911-1921. 19 Conacher Street (located in the grounds of the Showing now Feeling For Pattern: 50 Years of Museum and Art Gallery of NT), Fannie Bay 0810. Tiwi Pottery. T (08) 8981-6616. E [email protected] W www.tactilearts.org.au H Tues-Sun 10.00 to 4.00. Tactile Arts is a not-for-profit, member based, community arts organisation supporting artists and artisans throughout the Top End of Australia.

Blackstone Tjanpi Weavers, Tjanpi Grass Toyota, 2005, mixed media MAGNT, Telstra Collection Courtesy the artists and Museum and Art Gallery of the Northern Territory

Northern Territory 171 Desart Alice Springs Association of Central Australian Aboriginal Art Aboriginal Art Association and Craft Centres of Australia 11/54 Todd St Mall (upstairs in Reg Harris Lane), Alice Springs 0870. T (08) 8953-4736. T (02) 9716-7953. E [email protected] E [email protected] W desart.com.au W aboriginalart.org.au www.facebook.com/desart.inc Art centre members are www.facebook.com/AboriginalArtAssociation The community-based enterprises, owned and managed Aboriginal Art Association of Australia (AAAA) serves by Aboriginal people in their communities. They and represents artists, individuals and organisations provide economic, social and cultural benefits. Desart that produce, promote, protect or support Aboriginal members represent approximately 8000 artists, from art and the cultures that create and nurture that art. 16 distinct language groups spread across the Central desert region of Australia. Araluen Arts Centre Larapinta Drive, Alice Springs 0870. Tjanpi Desert Weavers T (08) 8951-1122. E [email protected] 3 Wilkinson Street, Alice Springs 0870. W araluenartscentre.nt.gov.au H Daily 10.00 to 4.00. T (08) 8958-2377. E [email protected] To July 15 (opening Fri June 29, 6pm) Alice Springs W www.tjanpi.com.au www.facebook.com/Tjanpi Beanie Festival – the nationally iconic festival sees H Mon-Fri 10.00 to 4.00. Tjanpi represents more thousands of beanies descend on Alice Springs. July than 400 Aboriginal women artists from 26 remote 13 to Aug 19 (opening Fri July 13, 6pm) Woomera communities on the NPY lands. See website for photographic series by Kristian Laemmle-Ruff. details. Watch This Space ARI 8 Gap Road, Alice Springs 0870. T (08) 8952-1949. E [email protected] W www.wts.org.au H Wed-Fri 12.00 to 5.00, *Sat 10.00 to 2.00 *during exhibitions. Showcasing local, interstate and international emerging and established artists. June 30 to July 14 (opening Sat June 30, 3pm) Seen from here and just out there by Emma Collard. Game, set, match – a spoken word and video event in three parts: July 11, 12 and 13, 6pm each evening. July 18 to 21 Pop-up exhibition by Cecile Galiazzo July 27 to Aug 11 (opening Fri July 27, 6pm) To travel some distance with concrete: a short story exhibition by Priscilla Beck. Kristian Laemmle-Ruff, Events Field II, 2017, C-type print in red frame, 85 x 65 x 3cm Courtesy the artists and Araluen Arts Centre Artback NT Arts Development and Touring 67 Bath Street, Alice Springs 0871. T (08) 8953-5941. W www.artbacknt.com.au Artback NT is the Northern Territory’s arts development and touring agency. The visual arts program works with individuals, groups and arts- based organisations to present and tour dynamic and exciting visual arts exhibitions nationally and within the Northern Territory with a focus on the development and promotion of Northern Territory artists.

172 Northern Territory Queensland

173 FireWorks Gallery Brisbane 52a Doggett Street, Newstead 4006. T (07) 3216-1250. E [email protected] W www.fireworksgallery.com.au H Tues-Fri 10.00 Andrew Baker Art Dealer to 6.00, Sat 10.00 to 4.00. To Aug 4 Anniversary 26 Brookes Street, Bowen Hills 4006. T (07) 3252- Group Show. 2292, 0412-990-356. E [email protected] W www.andrew-baker.com H Wed-Sat 10.00 to Graydon Gallery 5.00, or by appt. Paintings, photographs, prints 29 Merthyr Road, New Farm 4005. and sculptures by leading contemporary Australian, T 0418-740-467. E [email protected] Melanesian and Polynesian artists, including: Lincoln W www.graydongallery.com.au A modern rental Austin, Leonard Brown, Michael Cook, Karla art gallery space ideal for short term exhibitions Dickens, Ruki Famé (PNG), Fiona Foley, Simon showcasing all art mediums from established, Gende (PNG), Taloi Havini (Bougainville), Dennis emerging and group artists. Nona (Torres Strait), Ömie Artists (PNG), Michel Tuffery (New Zealand/Polynesia), Katarina Vesterberg and William Yang. To July 21 Novus florilegium Jan Manton Art (New gathering of flowers) by Katarina Vesterberg. Contemporary Australian Aug 2 to 5 Melbourne Art Fair: Warrior women by + International Art Karla Dickens. 1/93 Fortescue Street, Spring Hill 4000. T (07) 3831-3060, 0419-657-768. Brisbane Powerhouse E [email protected] W www.janmantonart.com 119 Lamington Street, New Farm 4005. Director: Jan Manton. H Wed-Fri by appt, Sat T (07) 3358-8600. E [email protected] 10.00 to 4.00 no appt required. Jan Manton Art W www.brisbanepowerhouse.org June 30 to July has a changing program of leading and emerging 22 World Press Photo 2018 exhibition. Profiling the contemporary artists. July 4 to 28 Capricious Forms globe’s top press photographers and press photos by Simon Degroot. in categories ranging from news to nature and portraiture. See ad pages 12 and 13.

Simon Degroot, Capricious Forms Blue, 2018, oil on canvas, 107.5 x 122.5cm Courtesy the artist and Jan Manton Art Jan Murphy Gallery 486 Brunswick Street, Fortitude Valley 4006. T (07) 3254-1855. E [email protected] W www.janmurphygallery.com.au Director: Jan Murphy. H Tues-Sat 10.00 to 5.00 or by appt. To July 21 Fred Fowler. July 24 to Aug 18 Heidi Yardley.

174 Queensland Mitchell Fine Art 86 Arthur Street, Fortitude Valley 4006. T (07) 3254- 2297. E [email protected] W www.mitchellfineartgallery.com H Mon-Fri 10.00 to 5.30, Sat 10.00 to 5.00. June 27 to July 21 Women of Utopia. July 25 to Aug 18 Geoff Todd. Also, Ningurra Napurrula.

Violet Petyarre, Mountain Devil Lizard, 2018, acrylic on linen, 90 x 90cm Courtesy the artist Mitchell Fine Art Museum of Brisbane Level 3, Brisbane City Hall, Adelaide and Ann streets, King George Square, Brisbane 4000. T (07) 3339-0800. E [email protected] W www.museumofbrisbane.com.au Free entry. H Daily 10.00 to 5.00, Fri 10.00 to 7.00. To Sept 2 Our Collection: Voice in Action. To Oct 14 BRISTOPIA. To Oct 28 Life in Irons: Brisbane’s Convict Stories. Petrie Terrace Gallery home of the RQAS Unit 3, 162 Petrie Terrace, Brisbane 4000. T (07) 3367-1977. E [email protected] W www.rqas.com.au Welcomes membership from professional and hobby artists, open and members exhibitions, workshops, private gallery hire, corporate and event hire. July 17 to 29 (opening Sun July 22, 12pm) Cutting Both Sides of the Line hand-coloured relief block prints by Wayne Singleton. See ad this page.

Queensland 175 Philip Bacon Galleries QUT Art Museum 2 Arthur Street, Fortitude Valley 4006. T (07) 3358- 2 George Street, QUT Gardens Point Campus (next to 3555. E [email protected] the City Botanic Gardens), Brisbane 4000. W www.philipbacongalleries.com.au H Tues-Sat T (07) 3138-5370. E [email protected] 10.00 to 5.00. Philip Bacon Galleries is the largest W www.artmuseum.qut.edu.au Free entry. H Tues-Fri and most established dealing gallery in Brisbane. We 10.00 to 5.00, Sat-Sun 12.00 to 4.00. Visit website have a large selection of important 19th century, 20th for programs and events. To Aug 26 Abstraction: century and contemporary paintings and sculptures in Celebrating Australian Women Abstract Artists – stock. July 3 to 28 Ray Crooke. examines ways that Australian women artists have championed abstraction in the 21st century. A Queensland Art Gallery | Gallery National Gallery of Australia exhibition. Also, Salon de Fleurus – a contemporary reconstruction of Gertrude of Modern Art (QAGOMA) Stein’s Parisian salon that existed from 1904-34. Stanley Place, Cultural Precinct, South Bank Brisbane 4101. T (07) 3840-7303 F 3844-8865. W www.qagoma.qld.gov.au Free entry, unless Redland Art Gallery otherwise stated. H Daily 10.00 to 5.00. Capalaba QAG: to Aug 12 Problem-Wisdom: Thai Art in the Capalaba Place, Noeleen Street, Capalaba 4157. 1990s. To Sept 2 Judith Wright: In the Garden of T (07) 3829-8899. E [email protected] Good and Evil. To Oct 7 Tony Albert: Visible. Ongoing W artgallery.redland.qld.gov.au Free admission. Australian Collection Reimagined. GOMA: to July H Mon-Wed, Fri 8.30 to 5.00, Thurs 8.30 to 7.30, 29 Measures of Distance, and Time and Tides: Art Sat 9.00 to 4.00. To July 10 Gadal Gajal Bujonga in the Torres. To Aug 5 Patricia Piccinini: Curious Quandamookajen: Salt Water Murris Quandamooka. Affection (see ad inside back cover). Ticketed. Also, July 14 to Aug 21 Apomogy by Rachel Burke. Patricia Piccinini: Curious Creatures’ Children’s Art Centre Project. GOMA Children’s Art Centre: to Oct 7 Redland Art Gallery Tony Albert: We Can Be Heroes. Cleveland Cnr Middle and Bloomfield streets, Cleveland 4163. T (07) 3829-8899. E [email protected] W artgallery.redland.qld.gov.au Free admission. H Mon-Fri 9.00 to 4.00, Sun 9.00 to 2.00. To July 15 #luvRedlands and Material Matters by Kay S Lawrence. July 22 to Aug 26 Between Nature and Sin by David Griggs. Suzanne O’Connell Gallery 93 James Street, New Farm 4005. T (07) 3358-5811, 0400-920-022 F 3358-5813. E [email protected] Tony Albert, David C Collins and Nikisha Nelson, Warakurna W www.suzanneoconnellgallery.com Member Superheroes #4, 2017, archival pigment print on paper, 100 x 150cm of ACGA. H Wed-Sat 11.00 to 4.00, or by appt. Courtesy the artist and Queensland Art Gallery Specialising in contemporary Australian Indigenous art. Representing leading Aboriginal artists; works Queensland College of Art include paintings, fibre and wood carvings. Project Gallery Ground floor (level 2), Webb Centre (SO2) at the QCA South Bank campus, 226 Grey Street, Southbank 4101. W www.jugglers.org.au/marie-ellis Aug 3 to 17 (opening and winners announcement Fri Aug 3, 6pm) Marie Ellis OAM Prize for Drawing 2018. See ad page 174.

176 Queensland The University of Queensland Art Museum Gold Coast James and Mary Emelia Mayne Centre (Building 11), University Drive, The University of Queensland, St Lucia 4067. T (07) 3365-3046. Anthea Polson Art E [email protected] Shop 120 Marina Mirage, 74 Seaworld Drive, Main W www.artmuseum.uq.edu.au H Daily 10.00 to Beach 4217. T (07) 5561-1166. 4.00. July 28 to Nov 11 Defying Empire – bringing E [email protected] together works by 30 contemporary Aboriginal W www.antheapolsonart.com.au Director: Anthea and Torres Strait Islander artists from across the Polson. H Daily 10.00 to 6.00. July 7 to 21 The country, Defying Empire: 3rd National Indigenous Still of Day by Cathy Quinn. July 28 to Aug 11 New Art Triennial commemorates the 50th anniversary Works by Martin Edge. of the 1967 Referendum that recognised Aboriginal people as Australians for the first time. It highlights Gallery at HOTA the strength and resilience of Australia’s Indigenous HOTA, Home of the Arts people since first contact, through to the historical Home of the Arts, 135 Bundall Road, Surfers Paradise fight for recognition and ongoing activism in the 4217. T (07) 5588-4067. E [email protected] present day. Aug 18 to Nov 25 Shirley Macnamara: W www.hota.com.au Free entry. H Mon-Sun 10.00 Layered threads. ‘A landscape of spinifex rings’ is how to 5.00. To July 15 We are Gold Coast: works from this acclaimed senior Indigenous artist from north- the Gallery at HOTA collection. July 21 to Sept 9 A west Queensland describes the suspended woven World View: The Tim Fairfax Gift. work that forms the centrepiece of her exhibition. Working with Triodia (spinifex), a native grass common to this arid landscape, Shirley Macnamara’s Lorraine Pilgrim Gallery contemporary fibre art stands for generations of Studio 87, 87 Ridgeway Avenue, Southport 4215. traditional knowledge, the resilience of her people, T (07) 5532-7170, 0418-767-495. and the need to care for Country. In works comprising E [email protected] spinifex, emu feathers, bone and ochre, the artist W www.lorrainepilgrim.com H Mon-Fri 10.00 draws attention to the environment and the histories to 5.00, weekends by appt. To July 30 Broome concerning her people, including Aboriginal military Sketchbook: An artist in residency at Roebuck Bay service. Macnamara’s woven vessel, Nyurruga sketches, paintings and drawings by Deb Mostert. Muulawaddi, which won the Wandjuk Marika Memorial 3D Award at the 34th Telstra National Aboriginal and Torres Strait Islander Art Awards in 2017, is a highlight of the exhibition. Curated by Sunshine Michele Helmrich. Coast Montville Art Gallery 138 Main Street, Montville 4560. T (07) 5442-9211. E [email protected] W www.montvilleartgallery.com.au H Daily 10.00 to 5.00. Through July featuring the work of Wayne Malkin. See ad page 178. Noosa Regional Gallery Ground floor, 9 Pelican Street (PO Box 141), Riverside, Tewantin 4565. T (07) 5329-6145. E [email protected] W www.noosaregionalgallery.com H Tue-Fri 10.00 to 4.00, Sat-Sun 10.00 to 3.00 closed Mon, public hols and during exhibition changeovers. To July 15 Otherworldy by Bliss Cavanagh. Stevens Street Gallery 2 Stevens Street, Yandina 4561. T 0448-051-720. E [email protected] Jason Wing, Captain James Crook, 2013 W www.stevensstreetgallery.com.au H Wed-Sat 9.00 National Gallery of Australia, Canberra, Purchased 2013 to 1.00, or by appt. Courtesy the artist, National Gallery of Australia, Canberra and University of Queensland Art Museum

Queensland 177 Yandina Historic House Lapunyah Art Gallery 3 Pioneer Road, Yandina 4561. T (07) 5472-7181. 80-86 Heeney Street, Chinchilla 4413. E [email protected] T (07) 4668-9908. E [email protected] W www.yandinahistorichouse.com.au Art Gallery W www.facebook.com/pages/Chinchilla-White-Gums- Co-ordinator: Fiona Groom [email protected] Art-Gallery H Mon-Fri 10.00 to 4.00, Sat 9.00 to H Daily 9.30 to 2.30. Gallery, craft shop, local 12.00. Closed Sun and public hols. A community-run history, local art and artists. art gallery in rural Queensland hosting several exhibitions and competitions each year. Managed by the Lapunyah Art Gallery Inc. Committee, maintained by volunteers. South East Logan Art Gallery Cnr Wembley Road and Jacaranda Avenue, Logan Central 4114. T (07) 3412-5519. Region W www.logan.qld.gov.au/artgallery H Tues-Sat 10.00 to 5.00. To July 21 Envisage-unseen rhythms by Davson Gallery Rachael Lee. Lockyer Valley Cultural Centre, 34 Lake Apex Drive, Gatton 4343. T 0416-026-426. Toowoomba Regional E [email protected] W www.davsonarts.com Art Gallery H Mon-Fri 9.00 to 5.00, Sat 9.00 to 12.00, or by 531 Ruthven Street, Toowoomba 4350. appt. Through July Celebrations by Sharon Davson. T (07) 4688-6652 F 4688-6895. E [email protected] See ad page 179. W www.tr.qld.gov.au/trag Free admission. H Tues-Sat 10.00 to 4.00, Sun 1.00 to 4.00, closed Gympie Regional Gallery Mon and public hols. June 30 to Aug 5 Storytelling: 39 Nash Street, Gympie 4570. T (07) 5481-0733 Celebrating Indigenous Artists. July 7 to Aug 26 F 5483-8904. E [email protected] Montages: The Full Cut, 1999-2015 – Tracey W www.gympie.qld.gov.au/gallery H Tues-Sat 10.00 Moffatt and Gary Hillberg. Montages: The Full Cut, to 4.00. The gallery promotes the development of the 1999-2015 was developed by Artspace, Sydney and arts as an integral part of the lives and industry of the is touring nationally in partnership with Museums & local community. Galleries of NSW. Ipswich Art Gallery d’Arcy Doyle Place , Nicholas Street (between Brisbane and Limestone streets, Ipswich 4305. T (07) 3810-7222. E [email protected] W www.ipswichartgallery.qld.gov.au Free entry unless stated otherwise. H Daily 10.00 to 5.00 (unless stated otherwise). To July 22 Foreign Bodies new work by Christopher Trotter. To Aug 26 Silver & Gold: Unique Australian Objects 1830-1910. Also, Ipswich House Portraits From The Collection. To Oct 14 19th & 20th Century Works. Tracey Moffatt & Gary Hillberg, Other (still), 2010, looped video, sound / 7 mins Courtesy the artist, Roslyn Oxley9 Gallery, Sydney, Tyler Rollins Fine Art, New York and Toowoomba Regional Art Gallery

138 Main S ree , Mon ville 4560 07 5442 9211 mon ar @mon ar .com.au www.mon villear gallery.com.au Daily 10.00 o 5.00 Wayne Ma kin, Turbulence #19, oi on canvas, 80 x 190cm

178 Queensland

Gab Titui Cultural Centre Far North Cnr Blackall Street and Victoria Parade, Thursday Island 4875. T (07) 4069-0888. E [email protected] W www.gabtitui.com.au Artspace Mackay H Mon-Fri 9.00 to 4.30, Sat 10.00 to 3.00. Civic Precinct, cnr Gordon and Macalister streets, July 26 to Sept 8 Indigenous Art Award – showcasing Mackay 4740. T (07) 4961-9722. new works by artists throughout the Torres Strait and E [email protected] Northern Peninsula area of Australia. See ad page 19. W www.artspacemackay.com.au Free admission. H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 3.00. KickArts Contemporary Arts To Aug 5 Hold this closely: John Honeywill. To Aug 96 Abbott Street, Cairns 4870. T (07) 4050-9496. 19, 2018 Libris Awards: The Australian Artists’ Book E [email protected] W www.kickarts.org.au Prize. Also, The Wall: Luke Mallie. H Mon-Sat 10.00 to 5.00. KickArts is regional Queensland’s leading contemporary visual arts Bundaberg Regional Galleries organisation and presents a program of local, national 1 Barolin Street, Bundaberg 4670. T (07) 4130-4750. and international artists. E [email protected] W www.bundabergregionalgalleries.com.au H Mon-Fri 10.00 to 5.00, Sat-Sun and public hols 9.00 to 1.00. To July 8 Remember Me: The Lost Diggers of Vignacourt – Australian War Memorial. Western To Aug 5 The Last Decade by Hobie Porter. Also, Cut Together by Simon Degroot. July 11 to Aug 26 District Different Strokes by Maggie Spenceley, Carmel Birchley and Colleen Helmore. Dogwood Crossing, Miles Cairns Art Gallery 81 Murilla Street, Miles 4415. T (07) 4628-5330. E [email protected] Cnr Abbott and Shields streets, Cairns 4870. W www.dogwoodcrossing.com Free entry. H Mon-Fri T (07) 4046-4800. 9.00 to 5.00, Sat 10.00 to 2.00, closed Sun. To July E [email protected] 16 John Mullins Memorial Art Gallery: People Like Us W www.cairnsartgallery.com.au H Mon-Fri 9.00 to – a new media exhibition curated by UNSW Galleries 5.00, Sat 10.00 to 5.00, Sun 10.00 to 2.00. July 6 Director Felicity Fenner. A National Exhibitions Touring to Sept 23 Continental Drift – Black / Blak art from Support Australia exhibition developed by UNSW South Africa and north Australia. Galleries and toured by Museums & Galleries of NSW. See ad pages 8 and 9. The National Touring Initiative is supported by the Australian Government through the Australia Council, Cairns Indigenous Art Fair 2018 its principal arts funding body, and by the Visual Arts Cairns Cruise Liner Terminal and Craft Strategy, an initiative of the Australian, State and Territory Governments. Curved Wall: Miles High W ciaf.com.au July 13 to 15 CIAF: Cairns Indigenous Showcase – an exhibition of artwork created by Miles Art Fair – Australia’s premier Indigenous art fair. State High School Visual Art Students. Presenting art, dance, music, fashion. Free and ticketed events. Opening night Thurs July 12. See ad page 22.

Cairns Indigenous Art Fair 2017 Photograph: Lovegreen Photography

180 Queensland ACQUISITIVE SECOND FIRST PRIZE PRIZE $15,000 $4,000

THIRD PRIZE $2,500

THE MEREDITH FOXTON PEOPLE’S CHOICE AWARD $500

DETAILS & ONLINE ENTRY FORM www.redlandartawards.org.au ENTRIES CLOSE Monday 23 July 2018 EXHIBITION Sunday 2 September – Sunday 14 October 2018 Redland Art Gallery, Cleveland Cnr Middle and Bloomﬁeld Streets, Cleveland Q 4163

Proudly sponsored by

Redland Art Gallery is an initiative of Redland City Council, dedicated to the late Eddie Santagiuliana Artist Index

182 (((20hz))) RMIT Gallery MEL Bonson, Samson Vivien Anderson Gallery MEL Cranstoun, Sam Mornington Peninsula MEL Aarli Koorie Heritage Trust MEL Booth, Peter RMIT Gallery MEL Crawford, Roger Watters Gallery SYD Abicare, Fiona Sarah Scout MEL Booth, Soloman Mornington Peninsula MEL Cress, Fred Annette Larkin Fine Art SYD Acker, Kathy AIRspace Projects SYD Bostock, Euphemia Boomalli Aboriginal SYD Crewdson, Gerard BLINDSIDE MEL Adams, Patricia Wilson Newcastle Art Gallery NSW Bostock, Tracey Boomalli Aboriginal SYD Croce, Beth RMIT Gallery MEL Adeney, Ally 541 Art Space SYD Boston, Paul Niagara Galleries MEL Croft, Brenda L. Niagara Galleries MEL Adorned Mosman Art Gallery SYD Bosun, David Mornington Peninsula MEL Crooke, Ray Fellia Melas Gallery SYD Afshar, Hoda Nishi Gallery ACT Bot, GW Canberra Glassworks ACT Crooke, Ray Philip Bacon Galleries QLD Agnew, Rose RMIT Gallery MEL Botten, Katherine ACE Open SA Cross, Dean Incinerator Gallery MEL Ahern, Colleen Chapter House Lane MEL Bounpraseuth, Mechelle MAMA NSW Crowe, Rowena Swamp Gallery SYD Aitken, Antonia Plimsoll Gallery TAS Bowen, Dean Montalto Sculpture Prize VIC Cubby, David Western Sydney SYD Albert, Tony QAG/GOMA QLD Bowen, Dean Whitehorse Art Space MEL Cullen, Adam Cullen MEL Alexander, Jane RMIT Gallery MEL Bowen, Dean Wishart Gallery VIC Cummings, Elisabeth Delmar Gallery SYD Ali, Khadim Mosman Art Gallery SYD Bowman, Katy Yarra Sculpture Gallery MEL Cummins, Marlene Boomalli Aboriginal SYD Alkanofer Collective in.cube8r MEL Bradbeer, Godwin Mornington Peninsula MEL Curry, Sally Handmark Gallery TAS Alldis, Phil M16 Artspace ACT Brannan, Mitchel Alternating Current MEL Curtin, Susan Bowral Art Gallery NSW amira.h. ACE Open SA Brassington, Pat Arc One MEL Cuthbertson, Mark Montalto Sculpture Prize VIC Amor, Rick Niagara Galleries MEL Brassington, Pat Bett Gallery Hobart TAS Dadfar, Farnaz Flinders Lane Gallery MEL Anceschi, Eros Metropolis Gallery VIC Brassington, Pat Ten Cubed MEL Daniels, Craig Tacit Galleries MEL Anderson, John Australian Galleries MEL Breninger, Warren Charles Nodrum Gallery MEL Darkson, Brad Incinerator Gallery MEL Ando, Kiki AIRspace Projects SYD Brennan, Angela Niagara Galleries MEL Darling, James Hugo Michell Gallery SA Andrew, Brook Geelong Gallery VIC Bridgewater, Robert Niagara Galleries MEL Dáša Ceramics Modern Times MEL Andrew, Brook MADA MEL Bridle, Celia Tacit Galleries MEL Davern, Anna Bundoora Homestead MEL Andrews, Daisy Fremantle Arts Centre WA Briscoe, Kate Mornington Peninsula MEL Davies, Amanda Bett Gallery Hobart TAS Anwar, Rushdi Incinerator Gallery MEL Brookes, Wayne Despard Gallery TAS Davies, Tjingapa Fremantle Arts Centre WA Archer, Suzanne Delmar Gallery SYD Brown, Jane Mornington Peninsula MEL Davis, Charmaine Boomalli Aboriginal SYD Armanious, Hany Roslyn Oxley9 Gallery SYD Brown, Leonard Andrew Baker Art Dealer QLD Davis, Hugh Incinerator Gallery MEL Armstrong, Benjamin Tolarno Galleries MEL Brown, Margaret Boomalli Aboriginal SYD Davis, Penelope Queen Victoria Museum TAS Arnold, Raymond Mornington Peninsula MEL Browne, Andrew Geelong Gallery VIC Davis, Robert Lee Carlisle Street Arts Space MEL Artists, Ömie Andrew Baker Art Dealer QLD Buchanan, Susan Queen Victoria Museum TAS Davis, Wayne Bowral Art Gallery NSW Aspland, Chris Steps Gallery MEL Budge, Kirsty Chapter House Lane MEL Davson, Sharon Davson Gallery QLD Atkins, Peter Mornington Peninsula MEL Burdett, Deborah STACKS Projects SYD Day, Liz Articulate Project Space SYD Austin, Lincoln Andrew Baker Art Dealer QLD Burgess, Robyn Tacit Galleries MEL Dean, Tamara Martin Browne SYD Avila, Marynes Montalto Sculpture Prize VIC Burke, Rachel Redland Art Gallery QLD Dease, Rachael Fremantle Arts Centre WA Aydemir, Cigdem Mosman Art Gallery SYD Burton, Jane William Mora Galleries MEL Debono, Ann Geelong Gallery VIC Babbarra Women’s Centre Koorie Heritage Trust MEL Busch, Wendy Westend Art Space MEL Degroot, Simon Bundaberg Regional QLD Bahng, Chris Bundoora Homestead MEL Butler, Kieran STACKS Projects SYD Degroot, Simon Jan Manton Art QLD Baird, Jennifer Stirato Gallery ACT Butta, Maude Muswellbrook Regional NSW Designs, Gilimbaa Koorie Heritage Trust MEL Baker, Alec ACCA MEL Byrnes, Richard Robin Gibson Gallery SYD Dettmer, Matthew Deakin Downtown MEL Bakhoff, Hellen Burra Regional SA Cage, John Lake Macquarie City NSW deVille, Julia RMIT Gallery MEL Balarinji Designs Koorie Heritage Trust MEL Calway, Caroline Hawthorn Studio MEL Dewhurst, Parris Articulate Project Space SYD Ball, Charmaine Heathcote Museum WA Campbell, Cressida Fellia Melas Gallery SYD Diamandis, George BlackCat Gallery MEL Balletta, Jessie Red Gallery MEL Campbell, Jon Geelong Gallery VIC Dickens, Karla Andrew Baker Art Dealer QLD Baluk Arts fortyfivedownstairs MEL Campbell, Jon Mornington Peninsula MEL Dickerson, Robert Fellia Melas Gallery SYD Bancroft, Bronwyn Boomalli Aboriginal SYD Carney, Ann Art Space on Concourse SYD Dixon, Nadeena Boomalli Aboriginal SYD Bancroft, Ella Noah Boomalli Aboriginal SYD Carroll, Ben Montalto Sculpture Prize VIC Dodd, Wendy ANCA ACT Bancroft, Rubyrose Boomalli Aboriginal SYD Carroll, Genevieve Articulate Project Space SYD Done, Ken Ken Done SYD Bankstown Koori Elders Kerrie Lowe Gallery SYD Carroll, Rachel Frances Keevil Gallery SYD Dono, Heri RMIT Gallery MEL Barkley, Glenn Niagara Galleries MEL Castleden, Susanna Mornington Peninsula MEL Dowling, Julia Niagara Galleries MEL Barry, Archie Flinders Lane Gallery MEL Cattapan, Jon STATION MEL Dowling, Julie Art Gallery of WA WA Barton, Arkie Koorie Heritage Trust MEL Cavanagh, Bliss Noosa Regional QLD Driessen, Ralf Montalto Sculpture Prize VIC Bartram, Chloe RMIT Project Space MEL Cavanagh, Steven Articulate Project Space SYD Duke, Margy Stirato Gallery ACT Basnett, Amy Stirato Gallery ACT Cézanne, Paul Art Gallery of SA SA Dumnoochin Artists Eltham Library MEL Bastolli, Jamie Factory 49 SYD Chalmers-Robinson, Ellie CCAS - Manuka ACT Dunn, John Art at St Francis MEL Bates, Badger Broken Hill Regional NSW Chan, Andy 541 Art Space SYD Dunnill, Anna FELTspace SA Bates, Kanytjuri Fremantle Arts Centre WA Chang, Jenny Zhe Glen Eira Gallery MEL Dustin, Mark Fox Galleries MEL Bateson, TJ Tacit Galleries MEL Chappell, Danica Mornington Peninsula MEL Duxbury, Lesley Mornington Peninsula MEL Batt, Terry Niagara Galleries MEL Chen, Hua Cun Mornington Peninsula MEL Eaton, Jeremy Sarah Scout MEL Battersby, Anna 541 Art Space SYD Chen, Yi Long Yarra Sculpture Gallery MEL Edgar, David Handmark Gallery TAS Bauer, Yannick Frankston Arts Centre VIC Chibnall, Anne Art Gallery of Ballarat VIC Edgar, David Plimsoll Gallery TAS Bayjoo, Shiraz MADA MEL Choi, Eugene ACE Open SA Edge, Martin Anthea Polson Art QLD Bayraktar, Canbora 541 Art Space SYD Christians, Jacqueline Tacit Galleries MEL Edgoose, Mark Bundoora Homestead MEL Beale, Debra Boomalli Aboriginal SYD Christmann, Gunter Niagara Galleries MEL Edwards, Hellen Tacit Galleries MEL Beck, Priscilla Watch This Space NT Christofides, Andrew King Street Gallery SYD Einhorn, Jens Olsen Gallery SYD Beckhouse, Janet RMIT Gallery MEL Chua, Jennifer Gaffa Gallery SYD Eiseman, Jon Flinders Lane Gallery MEL Becsi, Hannah Heathcote Museum WA Ciccarone, Julie Niagara Galleries MEL El Rayes, Leila Nishi Gallery ACT Beer, Terry Tacit Galleries MEL Cininas, Jazmina RMIT Gallery MEL Elkington, Kylie Colville Gallery TAS Begg, Zanny Bank Art Museum Moree NSW Claremont, Richard Brightspace MEL Ellis, Peter RMIT Gallery MEL Belfrage, Clare JamFactory SA Claringbold, Aaron Tinning Street MEL Ellis, Rachel Bathurst Regional NSW Bell, Martin Mornington Peninsula MEL Clark, Kate RMIT Gallery MEL Emery, Troy Geelong Gallery VIC Bendrups, Ella Modern Times MEL Clarke, Maree Koorie Heritage Trust MEL English, Gail Maunsell Wickes SYD Benwell, Stephen Niagara Galleries MEL Clements, Benita ACCA MEL Ensor, Andrew Gaffa Gallery SYD Benzie, Janie Moores Building WA Clover, Catherine RMIT Gallery MEL Erlich, Esther Fox Galleries MEL Berg, Kirstin Counihan Gallery MEL Cmielewski, Leon Bank Art Museum Moree NSW Errey, Sophia Langford 120 MEL Besserdin, Ray Mornington Peninsula MEL Coburn, John Fellia Melas Gallery SYD Ettelson, James Art House Gallery SYD Best, Marion Hall Hazelhurst Regional SYD Cocherino, Evangeline Walker Street Gallery MEL Evans, Aura 541 Art Space SYD Bettles, Erica Red Gallery MEL Colavita, Julia Olsen Gallery SYD Evans, Megan Art Gallery of Ballarat VIC Bevan, Tony Niagara Galleries MEL Cole, Tiffany Flinders Lane Gallery MEL Ex Nilalang NGA ACT Bezor, Annette Australian Galleries MEL Collard, Emma Watch This Space NT Faeyrglenn, Deborah ANCA ACT Bieniek, Natasha Geelong Gallery VIC Collins, Katie Bundoora Homestead MEL Fahey, Dawne Western Sydney SYD Bing, Xu White Rabbit Gallery SYD Collins, Laurie Red Tree Gallery VIC Fairbairn, David Coffs Harbour Regional NSW Birchall, Seth Geelong Gallery VIC Combes, Janine Queen Victoria Museum TAS Fairhall, Caspar Fremantle Arts Centre WA Birks, Emily Strathnairn Arts ACT Come Tees AIRspace Projects SYD Famé, Ruki Andrew Baker Art Dealer QLD Bisschops, Frans Moores Building WA Connors, Colleen Michelle Stirato Gallery ACT Fanning, Deanna AIRspace Projects SYD Blackmore, Paul Fox Darkroom MEL Consandine, Cate Sarah Scout MEL Fanning, Laura AIRspace Projects SYD Blair, Annette Canberra Glassworks ACT Constandelia, Nancy Geelong Gallery VIC Fantin-Latour Art Gallery of Ballarat VIC Blanch, Alice FELTspace SA Cook, Michael Andrew Baker Art Dealer QLD Fasher, Harrie King Street Gallery SYD Blitner, Edward Japingka Gallery WA Cook, Ros Articulate Project Space SYD Faulkner, Sarah Merricks House VIC Boakes, Leila Hearth Galleries VIC Cooke, Mela Montalto Sculpture Prize VIC Featherston, Grant Heide Museum MEL Boardman, Amber Geelong Gallery VIC Coppersmith, Yvette Geelong Gallery VIC Featherston, Mary Heide Museum MEL Bochner, Mel Fine Arts, Sydney SYD Corot Art Gallery of Ballarat VIC Ferretti, Emily Geelong Gallery VIC Bolden, Karen Watt Space NSW Courbet Art Gallery of Ballarat VIC Ferrier, Tania Salamanca Arts Centre TAS Bond, Jill Moores Building WA Couzens, Vicki ACCA MEL Ferry, Brett Flinders Lane Gallery MEL Bone-Manser, Mel Barossa Regional Gallery SA Cox, Dale Australian Galleries MEL Fielding, Robert ACCA MEL Boney, Camellia Boomalli Aboriginal SYD Crane, Valentyna Stirato Gallery ACT Fielding, Robert Mornington Peninsula MEL Artist Index 183 Finucane, Moira RMIT Gallery MEL Hart, David Fellia Melas Gallery SYD Just, Kate Chapter House Lane MEL Fischer, Carly Artspace at Realm MEL Hartvigsen, Gaynor Barossa Regional Gallery SA Kalabishis, Gina Flinders Lane Gallery MEL Fitzmaurice, John Montalto Sculpture Prize VIC Harvey, Geoff Manly Art Gallery SYD Kaptein, Paul La Trobe Art Institute VIC Fitzsimons, Pamela BAROMETER Gallery SYD Harvey, Ross Fellia Melas Gallery SYD Karamarko, Carissa Geelong Gallery VIC Floyd, Emily Australian Tapestry MEL Hasegawa, Ai RMIT Gallery MEL Kastelan, Claire Bunbury Regional WA Foenander, Laurel Hawthorn Studio MEL Hattam, Katherine Art House Gallery SYD Kay, Michael Academy Gallery TAS Fogarty, Kylie Stirato Gallery ACT Hattam, Katherine Geelong Gallery VIC Kayrooz, Gillian 541 Art Space SYD Foletta, Louise East & West Art MEL Hattam, Katherine Mornington Peninsula MEL Keeling, David Niagara Galleries MEL Foley, Fiona Andrew Baker Art Dealer QLD Hatton, Maddyson Gallery 139 NSW Kelly, Deborah RMIT Gallery MEL Foley, Fiona Niagara Galleries MEL Haus of Dizzy Koorie Heritage Trust MEL Kelly, Madeleine Geelong Gallery VIC Forster, Hendrik Bundoora Homestead MEL Havard, Wendy Tacit Galleries MEL Kendall, Yvonne Niagara Galleries MEL Forwood, Lesley Hugo Michell Gallery SA Havini, Taloi Andrew Baker Art Dealer QLD Kenez, Fruzsi Urban Cow Studio SA Foster, David Moores Building WA Hawkes, David Campbelltown Arts SYD Kenning, India Sister Gallery SA Fowler, Fred Jan Murphy Gallery QLD Hayes, Kendal Mornington Peninsula MEL Kerjan, Lauren AIRspace Projects SYD Fox, Belinda Gallerysmith MEL Hazel, Jason Tinning Street MEL Khazam, Gabrielle Carlisle Street Arts Space MEL Francis, Patrick Geelong Gallery VIC Hazelman, Glenys East & West Art MEL Kher, Bharti RMIT Gallery MEL Frank, Dale Roslyn Oxley9 Gallery SYD He, Pei Pei Mornington Peninsula MEL Kimber, Mason Geelong Gallery VIC Fransella, Graham Aust. Print Workshop MEL He, Zhuxuan AIRspace Projects SYD King, Jan Defiance Gallery SYD Frantastic Fran Jungle’s Art Studio SA Hearth Collective Modern Times MEL King, Tessy Modern Times MEL Fraser, Simone Sabbia Gallery SYD Helmore, Colleen Bundaberg Regional QLD Kirk, Eloise Gallery 9 SYD Fraser, Susie ACE Open SA Hendrian, Irfan Sullivan+Strumpf SYD Kirk, Valerie ANCA ACT Frazer, David Mornington Peninsula MEL Henenberg, Cathy Carlisle Street Arts Space MEL Klein, Deborah RMIT Gallery MEL Freeman, Desmond Maunsell Wickes SYD Heng, Euan Aust. Print Workshop MEL Kneebone, Sue Hugo Michell Gallery SA Friend, Donald Fellia Melas Gallery SYD Heng, Euan Geelong Gallery VIC Kombumerri, Dillon Koorie Heritage Trust MEL Friend, Ian Gallerysmith MEL Heng, Euan Niagara Galleries MEL Koolmatrie, Yvonne Aboriginal & Pacific Art SYD Friend, Ian Mornington Peninsula MEL Henshall, Phil Phil Henshall Studio VIC Koomen, Albert Tacit Galleries MEL Fuata/Enderie, Brian AIRspace Projects SYD Herron, Annie Maunsell Wickes SYD Korfiatis, Stacey BlackCat Gallery MEL Fuente, Keith La AIRspace Projects SYD Herzich, Paul Koorie Heritage Trust MEL Korol, Wendy Bundoora Homestead MEL Galaz, Camila BLINDSIDE MEL Hey, Susan ANCA ACT Koslowsky, Isabel Red Gallery MEL Galiazzo, Cecile Watch This Space NT Heyes, Kendal Stephen McLaughlan MEL Kovacs, Ildiko Delmar Gallery SYD Gallagher, Ben Gallery 139 NSW Hickey, Dale Niagara Galleries MEL Kristensen, Anna Geelong Gallery VIC Gamble, Michaela Western Sydney SYD Hickmott, Gordon Merricks House VIC Kulik, Oleg RMIT Gallery MEL Gannaway, Jessica fortyfivedownstairs MEL Hill, Fiona Stirato Gallery ACT Kum-Sing, Kyra Boomalli Aboriginal SYD Gardiner, Peter Gippsland Art Gallery VIC Hill, Judy Gallery 139 NSW Kuo, Professor Boris Yarra Sculpture Gallery MEL Gardiner, Peter Olsen Gallery SYD Hill, Justin Australian Tapestry MEL Laemmle-Ruff, Kristian Araluen Arts Centre NT Gason, Hannah ANCA ACT Hillberg, Gary Anne & Gordon Samstag SA Laemmle-Ruff, Kristian NCCA NT Gavalas, Katina Handmark Gallery TAS Hillberg, Gary Toowoomba Regional QLD Lambrogiotas, Andy Goat Gallery VIC Gazzard, Marea Utopia Art Sydney SYD Hiller, Kit Handmark Gallery TAS Lane, Francoise Koorie Heritage Trust MEL Geddis, Aleph Coffs Harbour Regional NSW Himstedt, Gabriela Moores Building WA Larder, Frances Coffs Harbour Regional NSW Gende, Simon Andrew Baker Art Dealer QLD Hincksman, Brian M16 Artspace ACT Larsen, Tor Stanley Street Gallery SYD George, Martin Montalto Sculpture Prize VIC Hirschmann, Robert Delmar Gallery SYD Larter, Richard Niagara Galleries MEL Georgetti, Michael La Trobe Art Institute VIC Hiscock, Fiona Gallerysmith MEL Larwill, David Larwill Studio MEL Gerhardt, Joe Fremantle Arts Centre WA Hislop, Mark Mornington Peninsula MEL Lau, Claudia Modern Times MEL Giannini, Eli Queen Victoria Museum TAS Hitti, Deanna Mornington Peninsula MEL Laurent, Titane Laurent Gallery MEL Gibb, Meghan Heathcote Museum WA Hodge, Gregory Geelong Gallery VIC Lawrence, Kay Adelaide Central Gallery SA Gibbes, Caroline Art House Gallery SYD Hoff, Rayner RMIT Gallery MEL Lawrence, Kay S Redland Art Gallery QLD Giles, Nyarapayi Geelong Gallery VIC Hoffmann, Ryan Liverpool Street Gallery SYD Lawrence, Patricia Robin Gibson Gallery SYD Gillespie, Wanda Bundoora Homestead MEL Holding, Judy Montalto Sculpture Prize VIC Le, Ba An Gaffa Gallery SYD Gillian, Minka Gallery 371 SYD Holt, William William Holt Gallery MEL Leach, Sam RMIT Gallery MEL Giraud, Fabien Mona TAS Honeywill, John Artspace Mackay QLD Lee, Adam STATION MEL Glassborow, Stephen Linton & Kay Fine Art WA Hooper, Julian Gallery 9 SYD Lee, Grace Lillian Koorie Heritage Trust MEL Gleeson, James Fellia Melas Gallery SYD Hornum, Emily Bunbury Regional WA Lee, Marcus Koorie Heritage Trust MEL Go-Sam, Carroll Koorie Heritage Trust MEL House, Paul Canberra Glassworks ACT Lee, Rachael Logan Art Gallery QLD Gobel, Annie Bundoora Homestead MEL Hout, Ronnie van RMIT Gallery MEL Lee, Rhys Nicholas Thompson MEL Gordon, Bette AIRspace Projects SYD Howie, Ann Merricks House VIC Lee, Rose Jiiwu Flinders Lane Gallery MEL Goren, Simonne AIRspace Projects SYD Hoyle, Anna Mornington Peninsula MEL Lees, Justin Gallery 139 NSW Gorogo, Danielle Boomalli Aboriginal SYD Hubbard, Lou Sarah Scout MEL Leong, Owen Artereal Gallery SYD Gosling, Sarah Deakin Downtown MEL Hughes, Andrea Alternating Current MEL Lepisto, Jeremy Canberra Glassworks ACT Gossage, Star Niagara Galleries MEL Hughes, Natalya Mornington Peninsula MEL Levy, Nick Ceramic Break NSW Grabner, Michelle Niagara Galleries MEL Hullick, James TarraWarra MEL Lien, Sin Yu Yarra Sculpture Gallery MEL Grace, Wendy Walker Street Gallery MEL Hunt, Alana Mornington Peninsula MEL Liesch, Carla Peacock Gallery SYD Graham, John Hawthorn Studio MEL Hunter, Leeanne Boomalli Aboriginal SYD Lincoln, Kevin Niagara Galleries MEL Graham, Peter Geelong Gallery VIC Hunter, Robert NGV Ian Potter Centre MEL Lindeman, Michael Sullivan+Strumpf SYD Grayley, Caroline Frankston Arts Centre VIC Huppatz, Matt ACE Open SA Lindsay, Norman Norman Lindsay Gallery NSW Green, Rona RMIT Gallery MEL Hurst, Elise Tinning Street MEL Lindsay, Norman RMIT Gallery MEL Greenaway, Jefa Koorie Heritage Trust MEL Hurst, Joe Kerrie Lowe Gallery SYD Ling, Song Niagara Galleries MEL Greeno, Lola Tasmanian Museum TAS Iacobelli, Aldo Anne & Gordon Samstag SA Little, James La Trobe Art Institute VIC Grennan, Simon Counihan Gallery MEL Injalak Arts Koorie Heritage Trust MEL Liu, Kathy Art Space on Concourse SYD Grierson, Jane Heathcote Museum WA Iqbal, Mehwish Mosman Art Gallery SYD Lochman, Marie Moores Building WA Griffiths, Jan Cross Art SYD Irving, Brian Ceramic Break NSW Lockhart River Artists Japingka Gallery WA Griffiths, Peggy Cross Art SYD Irving, Tony Fellia Melas Gallery SYD Logan, Lena Kerrie Lowe Gallery SYD Griggs, David Redland Art Gallery QLD Isaacs, Colin Ceramic Break NSW Lonelyspeck ACE Open SA Groom, Amala Incinerator Gallery MEL Isaacs, Jarrah Ceramic Break NSW Lopes, Steve Stella Downer Fine Art SYD Groom, Lawrie Cambridge Studio MEL Ivin-Smith, Ainslie Gallery 139 NSW Luccio, Marco Fellia Melas Gallery SYD Gumana, Birrikitji La Trobe Art Institute VIC Jaanz, Lynn Lynn Jaanz Art Gallery MEL Maas, Marise Wangaratta Gallery VIC Gumana, Dr La Trobe Art Institute VIC Jackson, Roy Defiance Gallery SYD Mabo, Boneta-Marie Deakin Uni. Art Gallery MEL Gumana, Malaluba Niagara Galleries MEL Jackson, Roy Delmar Gallery SYD MacDonald, Travis Niagara Galleries MEL Gurrie, Pete Tacit Galleries MEL Jackson, Sean Kerrie Lowe Gallery SYD Mack, Lukas Heathcote Museum WA Gurruwiwi, Mithinarri La Trobe Art Institute VIC Jacobsen, Jasper Flinders Lane Gallery MEL Maclean, Rachel NGA ACT Hadfield, Margaret Stirato Gallery ACT Jager, Lana de Tacit Galleries MEL Macleod, Euan Fellia Melas Gallery SYD Haider, Rubaba Niagara Galleries MEL Jahn, Annelies STACKS Projects SYD Macleod, Euan Manly Art Gallery SYD Hall, Adrian Articulate Project Space SYD Jarman, Ruth Fremantle Arts Centre WA Macleod, Euan Niagara Galleries MEL Hall, Maggie Watt Space NSW Jass, Rudi Montalto Sculpture Prize VIC Macnamara, Shirley Uni QLD Art Museum QLD Halles, Fiona Factory 49 SYD Jinks, Sam RMIT Gallery MEL Magree, Shane Montalto Sculpture Prize VIC Halnan, Barbara Articulate Project Space SYD John, Anna AIRspace Projects SYD Mais, Hilarie ANU Drill Hall Gallery ACT Halpern-Wilson, Mira Arc Yinnar Gallery VIC Johns, Kerry Coffs Harbour Regional NSW Maison the Faux AIRspace Projects SYD Hamalainen, Anne Tacit Galleries MEL Johnson, Jessica Boomalli Aboriginal SYD Male, Gary Hawthorn Studio MEL Hamilton, Jim Montalto Sculpture Prize VIC Johnson, Nicolette Modern Times MEL Malkin, Wayne Montville Art Gallery QLD Hannah, Camille Geelong Gallery VIC Jones, Dianne Niagara Galleries MEL Mallie, Luke Artspace Mackay QLD Hanson, Megan AIRspace Projects SYD Jones, Jeannette Lloyd Maunsell Wickes SYD Mallyon, Greg Wishart Gallery VIC Harding, Matthew Montalto Sculpture Prize VIC Jones, Jonathan ACCA MEL Manet, Édouard Art Gallery of SA SA Harley, David Shepparton Art Museum VIC Jones, Locust Mornington Peninsula MEL Marawarr, Susan Vivien Anderson Gallery MEL Harney, Yidumduma Bill Charles Darwin Univ NT Joseph, Jennifer Mornington Peninsula MEL Marawili, Nonggirrnga Mornington Peninsula MEL Harris, Dana Mornington Peninsula MEL Joseph, Jennifer Niagara Galleries MEL Marburg, Amanda Geelong Gallery VIC Harrison, Elenore Ceramic Break NSW Junmanee, Natasha Art Space on Concourse SYD Marburg, Amanda Sutton Gallery MEL

184 Artist Index Mariani, Leah Steps Gallery MEL Napurrula, Ningurra Mitchell Fine Art QLD Quinn, Cathy Anthea Polson Art QLD Marie, Peta Modern Times MEL Nell Canberra Glassworks ACT Quintanilla, Lucreccia AIRspace Projects SYD Marika, Wandjuk La Trobe Art Institute VIC Nell STATION MEL Ralph, David Gallery 9 SYD Markus, Denise Moores Building WA Newitt, James Contemporary Art TAS TAS Raong, Clache 541 Art Space SYD Marlow, Diane Ceramic Break NSW Newton, Peter Tacit Galleries MEL Rasdall, Gemma Frances Keevil Gallery SYD Marlow, Grace ACE Open SA Nicholls, Mike Montalto Sculpture Prize VIC Rayson, Isobel M16 Artspace ACT Marlow, Jesse Box Hill Community Arts MEL Nicholls, Naomi Westend Art Space MEL Rea, Kirstie Suki & Hugh Gallery NSW Martin, Brian Mornington Peninsula MEL Nichols, Gail ANU Drill Hall Gallery ACT Reeve, Juliette Arc Yinnar Gallery VIC Martin, Sam Geelong Gallery VIC Nikolic, Tomislav STATION MEL Reid, Lisa Mornington Peninsula MEL Martin, Sam STATION MEL Nikou, Michelle Western Plains Centre NSW Reinli, Tanya 541 Art Space SYD Mason, Nicola CSIRO Discovery Centre ACT Nilsson, Peter Canberra Glassworks ACT Reisch, Stephanie Linton & Kay Fine Art WA Massey, Samuel Gaffa Gallery SYD Nimrod, Selby AIRspace Projects SYD Reisch, Stephanie Mundaring Arts Centre WA Mattingley, Georgie Gallery @ Bayside Arts MEL Ningde, Wang White Rabbit Gallery SYD Rendall, Steven Niagara Galleries MEL Mattingley, Georgie Mornington Peninsula MEL Nixon, John ANU Drill Hall Gallery ACT Rennick, Ander AIRspace Projects SYD Maudsley, Helen Niagara Galleries MEL Nixon, John Mornington Peninsula MEL Renoir Art Gallery of Ballarat VIC Mawurndjul, John MCA SYD Nolan, Laura 541 Art Space SYD Renoir, Auguste Art Gallery of SA SA Maymuru, Narritjin La Trobe Art Institute VIC Nolan, Sidney RMIT Gallery MEL Rhiji, Alicia van Modern Times MEL McArdle, Claire Bundoora Homestead MEL Nolan, Sydney Fellia Melas Gallery SYD Ricardo, Geoffrey RMIT Gallery MEL McCambridge, Kate M16 Artspace ACT Nona, Dennis Andrew Baker Art Dealer QLD Richards, Wal Central Goldfields VIC McCarthy, Teena Art Atrium SYD Noonan, Ella Handmark Gallery TAS Richardson, Cheryl Mosman Art Gallery SYD McCartney, Karen Grafton Regional NSW Noone, Brigid Lawrence Wilson WA Riddell, Antony BLINDSIDE MEL McCauley, Rebecca Tinning Street MEL Noordennen, John Frankston Arts Centre VIC Ridsdale, Sharon Watt Space NSW McDonald, Alison Port Pirrie Regional SA Not Canberra Glassworks ACT Rienmueller, Renate STACKS Projects SYD McDonald, Darren Geelong Gallery VIC Nugroho, Eko RMIT Gallery MEL Riley, Michael MAMA NSW McEwan, Sarah Western Plains Centre NSW Nungabar, Nora RMIT Project Space MEL Rippert, Louise Mornington Peninsula MEL McGarry, Llewellyn M16 Artspace ACT Nyadbi, Lena Niagara Galleries MEL Rivas, Angela Yering Station MEL McGinley, Ann Alternating Current MEL O’Brien, Isabel Carlisle Street Arts Space MEL Rix, Jimmy Montalto Sculpture Prize VIC McGreevy, Rose Ann Articulate Project Space SYD O’Reilly, Kira RMIT Gallery MEL Robbins, Cameron Heathcote Museum WA McGregor, Laith Geelong Gallery VIC O’Toole, Daniel MAY SPACE SYD Robbins, Cameron Mornington Peninsula MEL McInerney, Julia ACE Open SA Ohmu, Zhu Modern Times MEL Roberts, Margaret Articulate Project Space SYD McKenna, Moya Gallery @ Bayside Arts MEL Ollis, Bernard Harvey Galleries SYD Robertson, Kevin Geraldton Regional WA McKenna, Noel Niagara Galleries MEL Olsen, John Olsen MEL Robertson, Linda Metropolis Gallery VIC McKenzie, Graham Tacit Galleries MEL Olsen, John Olsen Gallery SYD Robertson, Thalia Red Gallery MEL McKenzie, Queenie Fremantle Arts Centre WA Omeenyo, Fiona Japingka Gallery WA Robinson, Brian Mornington Peninsula MEL McKie, Jyoti Moores Building WA Ömie Artists Japingka Gallery WA Robinson, Julia Greenaway Gallery SA McKinnon, Robyn Queen Victoria Museum TAS Open Spatial Workshop Mornington Peninsula MEL Robinson, Kiron Margaret Lawrence MEL McLean, Mary Fremantle Arts Centre WA Ormella, Raquel Shepparton Art Museum VIC Roet, Lisa RMIT Gallery MEL McLoughlin, Margaret Hawthorn Studio MEL Orr, Jill Gallery 139 NSW Rogers, Andrew NGA ACT McLure, Tamsin ANCA ACT Osborne, Laura Stephen McLaughlan MEL Rogers, Catherine BAROMETER Gallery SYD McMonagle, Fiona Geelong Gallery VIC Osmotherly, Carole Stirato Gallery ACT Romeo, Luisa Handmark Gallery TAS McNabney-Stevens, Ali fortyfivedownstairs MEL Owen, Robert Arc One MEL Rooke, Katherine STACKS Projects SYD Meade, John Sarah Scout MEL Pachkova, Andjana Stanley Street Gallery SYD Ross, Sally Geelong Gallery VIC Meaney, Janet ANCA ACT Page, Brenda Yering Station MEL Rowley, Kevin G ACU Gallery MEL Megan, Hayley Peacock Gallery SYD Paine, Katie La Trobe Art Institute VIC Rowney, Tom Canberra Glassworks ACT Meijers, Mish Mornington Peninsula MEL Palmer, Lucy Suki & Hugh Gallery NSW Roxburgh, Bruce Gallery 139 NSW Meilak, Sean Niagara Galleries MEL Pandolfini, Rafaela AIRspace Projects SYD Royds, Naomi Taylor CCAS - Manuka ACT Mein, Annemieke Gippsland Art Gallery VIC Paolozzi, Eduardo Lake Macquarie City NSW Rrap, Julie Roslyn Oxley9 Gallery SYD Mengbo, Feng White Rabbit Gallery SYD Papanikolakis, Elena Mornington Peninsula MEL Russell, John Art Gallery of NSW SYD Mesaric, Frank Gippsland Art Gallery VIC Papanikolakis, Elena Mosman Art Gallery SYD Ruthi, Andreas Niagara Galleries MEL Meysami, Mohsen Flinders Lane Gallery MEL Paramor, Louise Geelong Gallery VIC Ryan, Leonie Gippsland Art Gallery VIC MI Arts Koorie Heritage Trust MEL Paramor, Louise Mornington Peninsula MEL Ryan, Luna Canberra Glassworks ACT Michael, Sue Burra Regional SA Pareroultja, Hubert Mornington Peninsula MEL Ryrie, Nick Sarah Scout MEL Miles, Gary Bradley Hall VIC Parker, Astra Montalto Sculpture Prize VIC Sadauskas, Faustus Montalto Sculpture Prize VIC Millar-Baker, Hayley Vivien Anderson Gallery MEL Parker, Jemima Mornington Peninsula MEL Sami, Huseyin Geelong Gallery VIC Millen, Rhondda Metropolis Gallery VIC Parr, Martin Niagara Galleries MEL Sampson, Elissa Mornington Peninsula MEL Miller, Viv Mornington Peninsula MEL Parr, Robert Watters Gallery SYD Sampson, Rebecca Stephen McLaughlan MEL Mire, Julia Sant Tacit Galleries MEL Parrett, James Montalto Sculpture Prize VIC Sandrussi, Emily Mornington Peninsula MEL Moeller, Alison M16 Artspace ACT Pasquale, Eleanor De Gaffa Gallery SYD Sandy, Carmen Boomalli Aboriginal SYD Moffatt, Tracey Anne & Gordon Samstag SA Paton, Steaphan Gippsland Art Gallery VIC Santiago, Marikit Mosman Art Gallery SYD Moffatt, Tracey Toowoomba Regional QLD Paxton, Sally Fellia Melas Gallery SYD Sargeant, Geoff Mornington Peninsula MEL Molinari, Michelle Gippsland Art Gallery VIC Payne, Julie Handmark Gallery TAS Sarin, Jasmine Boomalli Aboriginal SYD Monaghan, Rebecca Westend Art Space MEL Payne, Riley Mornington Peninsula MEL Scambler, Stewart Lawrence Wilson WA Monet, Claude Art Gallery of SA SA Pearce, Dierdre M16 Artspace ACT Scarce, Yhonnie ACCA MEL Monks, Chico Art Atrium SYD Pearson, Ian Robin Gibson Gallery SYD Scharfenstein, Bella Heathcote Museum WA Monks, Nicole Incinerator Gallery MEL Peart, John Delmar Gallery SYD Schneider, Ilona Queen Victoria Museum TAS Monks, Nicole Koorie Heritage Trust MEL Pegg, Steven Moores Building WA Schneider, Lindy Yering Station MEL Monro, Gordon Langford 120 MEL Pelan, Robyn Queen Victoria Museum TAS Schwertsik, Cynthia Adelaide Central Gallery SA Monu, Sione ACE Open SA Peoples, Sharon ANCA ACT Sciberras, Luke Manly Art Gallery SYD Mooney, Claire Flinders Lane Gallery MEL Perry, Ashley Incinerator Gallery MEL Scicluna, Jo Mornington Peninsula MEL Moore, Laura FELTspace SA Perry, Oscar Chapter House Lane MEL Scotece, Enrico Western Sydney SYD Moore, Tully Geelong Gallery VIC Persson, Stieg Ian Potter Museum MEL Secombe, Ebony Articulate Project Space SYD Moore, Tully Sarah Scout MEL Phillips, Jungle Jungle’s Art Studio SA Sedgwick, Tim Art Gallery of Ballarat VIC Mordant, Angus Lismore Regional NSW Phillips, Nicole Renee Boomalli Aboriginal SYD Seeto, William Articulate Project Space SYD Morgan, Guy 541 Art Space SYD Phu, Jason 4A Centre SYD Seiver, Helen Bunbury Regional WA Morisot, Berthe Art Gallery of SA SA Picasso, Pablo NGA ACT Sellbach, Antonia La Trobe Art Institute VIC Morrison, Anne Despard Gallery TAS Piccinini, Patricia QAG/GOMA QLD Selwood, Paul Muswellbrook Regional NSW Mortensen, Kevin Australian Galleries MEL Piccinini, Patricia RMIT Gallery MEL Selwood, Paul Watters Gallery SYD Moseley, Bill Articulate Project Space SYD Pickering, Linda Langford 120 MEL Semiconductor Fremantle Arts Centre WA Mostert, Deb Lorraine Pilgrim QLD Pigram, Hayley Boomalli Aboriginal SYD Sen, Mithu RMIT Gallery MEL Moynihan, Dan Chapter House Lane MEL Pissarro, Camille Art Gallery of SA SA Senbergs, Jan Niagara Galleries MEL Mptyane, Harry Dixon Niagara Galleries MEL Pittock, Kenny Artspace at Realm MEL Seymour, Dennis Latrobe Regional VIC Mueller, Helen Mornington Peninsula MEL Pola, Toby Chapter House Lane MEL Shafer, Mina Tacit Galleries MEL Muhling, Cathy Alternating Current MEL Pompey, Jimmy ACCA MEL Sharp, Peter Nicholas Thompson MEL Mukeba, Pierre Adelaide Central Gallery SA Popple, Marli ANCA ACT Shaw, Gary Articulate Project Space SYD Mukeba, Pierre Greenaway Gallery SA Porter, Hobie Bundaberg Regional QLD Shaw, Martin Muswellbrook Regional NSW Muller, Justine Broken Hill Regional NSW Power, Kate ACE Open SA Shead, Garry Fellia Melas Gallery SYD Mungkuri, Peter ACCA MEL Prain, Vaughan Collingwood Gallery MEL Shead, Gria Fellia Melas Gallery SYD Murphy, Sarah ANCA ACT Price, Dan Mornington Peninsula MEL Shilham, Andrew Gallery 139 NSW Murray, Catherine Flora AIRspace Projects SYD Price, Tania Salamanca Arts Centre TAS Shneider, Ernst Moores Building WA Murray, Jan Geelong Gallery VIC Przybyszewski, Jacek Articulate Project Space SYD Shreeve, Liz Mornington Peninsula MEL Murri, Frank Gallery 139 NSW Puna, Linda Linden New Art MEL Siboni, Raphaël Mona TAS Nakazawa, Yoko Incinerator Gallery MEL Pwerle, Angelina Niagara Galleries MEL Siddon, John Prince Chapman & Bailey MEL Namatjira, Vincent ACCA MEL Pwerle, Charmaine Kate Owen Gallery SYD Sinclair, Clive Quadrant Gallery MEL Namok, Rosella Japingka Gallery WA Qinwu, Hu Niagara Galleries MEL Sinclair, Emily Watt Space NSW Namunjdja, Samuel Niagara Galleries MEL Quinlin, Jaluka Rosalina Boomalli Aboriginal SYD Singleton, Wayne Royal Qld Art Society QLD

Artist Index 185 Siwes, Darren Greenaway Gallery SA Tinpalit, Pimpisa Yarra Sculpture Gallery MEL Wedd, Gerry ACE Open SA Skeer, Jane Adelaide Central Gallery SA Tipping, Richard Latrobe Regional VIC Wegner, Peter Australian Galleries MEL Skerlj, Laura Deakin Downtown MEL Tiravanija, Rirkrit NGV International MEL Wei, Guan Australian Tapestry MEL Smales, Peter Quadrant Gallery MEL Titmarsh, Mark Gallery 9 SYD Weiss, Rosie Mornington Peninsula MEL Smeeton, Annette Hawthorn Studio MEL Tjanpi Desert Weavers Japingka Gallery WA West, Katie Incinerator Gallery MEL Smeets, William Mornington Peninsula MEL Todd, Geoff Mitchell Fine Art QLD West, Margaret Stanley Street Gallery SYD Smith, Kevina-Jo Blue Mountains City NSW TomboyBill Westend Art Space MEL West, Sally Fellia Melas Gallery SYD Smith, Sharon Boomalli Aboriginal SYD Toomey, Graham Kerrie Lowe Gallery SYD West, Sharon Geelong Gallery VIC Smrekar, Maja RMIT Gallery MEL Toomey, Kerry Kerrie Lowe Gallery SYD Westmoreland, Bradd Geelong Gallery VIC Snell, Anne Watt Space NSW Toyne, Peter Hawthorn Studio MEL Westmoreland, Bradd Niagara Galleries MEL South, John Blue Mountains City NSW Tozer, Claire Thienny Lee Gallery SYD Whiskey, Kaylene ACCA MEL Souza, Keg de Mosman Art Gallery SYD Tracton, Sarah St Heliers Street Gallery MEL Whisson, Ken Niagara Galleries MEL Spenceley, Maggie Bundaberg Regional QLD Tremayne, Marc BlackCat Gallery MEL Whiteley, Brett Fellia Melas Gallery SYD Squish Art Collective Eltham Library MEL Tremayne, Paris BlackCat Gallery MEL Whitford, Jemima Boomalli Aboriginal SYD Srivilasa, Vipoo Scott Livesey Galleries MEL Tremlett, Clayton Wangaratta Gallery VIC Whyoulter, Bugai RMIT Project Space MEL Stallard, Phil Soho Waterloo SYD Trotter, Christopher Ipswich Art Gallery QLD Wigley, Christabel Montalto Sculpture Prize VIC Standke, Karen Manningham MEL Trudinger, Susan Stirato Gallery ACT Wijaya, Agus Gaffa Gallery SYD Starrs, Josephine Bank Art Museum Moree NSW Tsara, Olga Alternating Current MEL Wilkinson, Adam Red Gallery MEL Steer, Wendy Hawthorn Studio MEL Tsomis, Eleni 541 Art Space SYD Wilkinson, Glen Coffs Harbour Regional NSW Sterling, Tim Hugo Michell Gallery SA Tucker, Kate Geelong Gallery VIC Wilks, Maxwell Quadrant Gallery MEL Stevens, Grant Margaret Lawrence MEL Tuffery, Michel Andrew Baker Art Dealer QLD Willet, Jennifer RMIT Gallery MEL Stewart, Angela Geraldton Regional WA Turnbull, Meredith Ian Potter Museum MEL Williams, Mumu Mike Mornington Peninsula MEL Stillman, Kylie Mornington Peninsula MEL Tylor, James Greenaway Gallery SA Williams, Peta-Joy Boomalli Aboriginal SYD Stone, Christen Jo Bolin Bolin Gallery MEL Tylor, James Mornington Peninsula MEL Wills, Laura Mornington Peninsula MEL Storrier, Tim Fellia Melas Gallery SYD Tylor, James Vivien Anderson Gallery MEL Wiltshire, Belinda Flinders Lane Gallery MEL Story, Holly Fremantle Arts Centre WA Uhlmann, Nicholas Montalto Sculpture Prize VIC Winch, Madeleine Beaver Galleries ACT Ussher, Michelle STATION MEL Strampp, Adriane Gallerysmith MEL Wolfe-Alegria, Eduardo Gaffa Gallery SYD Stranks, Nick Canberra Glassworks ACT Valadon, Rosemary Wagner Contemporary SYD Wompi, Nora RMIT Project Space MEL Street, Belinda Gallery 139 NSW van Hout, Ronnie Buxton Contemporary MEL Wood, David Montalto Sculpture Prize VIC Stubbs, Sarah Queen Victoria Museum TAS van Leeuwen, Marina Heathcote Museum WA Woodlands, Naomi Grace Cossington Smith SYD Sukumaran, Myuran Bendigo AG VIC Vandeleur, Jennifer Cambridge Studio MEL Woodward, Margaret Fellia Melas Gallery SYD Sylvester, Darren Sullivan+Strumpf SYD Vasak, Hana Modern Times MEL Woodward, Sarah 541 Art Space SYD Szilagyi, Sophia Beaver Galleries ACT Vesterberg, Katarina Andrew Baker Art Dealer QLD Woolfe, Lisa Peacock Gallery SYD Tanner, Edwin TarraWarra MEL Vodesil-Baruffi, Jana Moores Building WA Wormald, Alice Geelong Gallery VIC Tarry, Jon Heathcote Museum WA Vongpoothorn, Savanhdary Niagara Galleries MEL Tavener, Janet MAY SPACE SYD Vozzo, Vince Harvey Galleries SYD Wren, Cherie Gallery 139 NSW Tawale, Salote Mosman Art Gallery SYD Vozzo, Vince Mildura Arts Centre VIC Wright, Helen Niagara Galleries MEL Taweel, Shireen Mosman Art Gallery SYD Wagner, Luke Colville Gallery TAS Wright, Judith QAG/GOMA QLD Taweel, Shireen Nishi Gallery ACT Wagner, Molly Articulate Project Space SYD Wu, Annie AIRspace Projects SYD Taylor, Andrew Geelong Gallery VIC Wait, Cait Burra Regional SA Wu, Ching Chen Yarra Sculpture Gallery MEL Taylor, Chris Yering Station MEL Waldron, Ian Montalto Sculpture Prize VIC Xiaodong, Liu White Rabbit Gallery SYD Taylor, Deborah Boomalli Aboriginal SYD Walker, Jake STATION MEL Xun, Sun MCA SYD Taylor, Nathan Artspace at Realm MEL Walker, Pam Boomalli Aboriginal SYD Xun, Sun White Rabbit Gallery SYD Taylor, Nathan Plimsoll Gallery TAS Walker, Trent Mornington Peninsula MEL Yaltangki, Tiger ACCA MEL Taylor, Neil Niagara Galleries MEL Wallace, Carmel Wishart Gallery VIC Yaltangki, Tiger Alcaston Gallery MEL Taylor, Ross La Trobe Art Institute VIC Wallace, Kate Alternating Current MEL Yang, William Andrew Baker Art Dealer QLD Taylor, Timna Coffs Harbour Regional NSW Wallace, Steffie Broken Hill Regional NSW Yanima, Puna Linden New Art MEL Templeton, Ainslie AIRspace Projects SYD Walsh, Kate Alternating Current MEL Yanima, Puna Mornington Peninsula MEL Textaqueen Mornington Peninsula MEL Wanambi, Wolpa Niagara Galleries MEL Yankkarr, Paji Honeychild Fremantle Arts Centre WA Thallmaier, Jessica 541 Art Space SYD Wanambi, Wukun Niagara Galleries MEL Yardley, Heidi Jan Murphy Gallery QLD Thamo, Kati Fremantle Arts Centre WA Waples-Crowe, Peter ACCA MEL Yarrenyty Arltere Artists Hugo Michell Gallery SA Thebus, Athena ACE Open SA Warlpiri Artists Japingka Gallery WA Young, Alan Colville Gallery TAS Theobald, Bronwyn Salamanca Arts Centre TAS Warraweena Artists Burra Regional SA Young, Allison Jonas M16 Artspace ACT Theobald, Stephanie Salamanca Arts Centre TAS Warren, Kerrie Pilgrim Creek Studios VIC Young, Lyn-Al Koorie Heritage Trust MEL Thompson, Christian UNSW Galleries SYD Waters, David Montalto Sculpture Prize VIC Zago, Yvonne Mornington Peninsula MEL Thompson, Hetty Bowral Art Gallery NSW Waters, Pat Gippsland Art Gallery VIC Zerunge, John Young 4A Centre SYD Tierney, Steve China Heights Gallery SYD Watters, Max Watters Gallery SYD Zhang, Bi Lan Yarra Sculpture Gallery MEL Tilson, Joe Lake Macquarie City NSW Waup, Lisa ACCA MEL Zhuoquan, Liu Niagara Galleries MEL Tinker, Elizabeth Coffs Harbour Regional NSW Webb, Joshua There Is WA Zu, Tianli Mornington Peninsula MEL

/HYHO %XLOGLQJ $ 3DFLíF +LJKZD\ 6W /HRQDUGV 16: Locked Bag 5555, St Leonards NSW 1590. T 02 9901 6100. Executive Chairman David Gardiner. Managing Director +DPLVK %D\OLVV Circulation Director Caroline Jones. Art Almanac is published by nextmedia Pty Ltd, ACN: 128 805 970 /HYHO %XLOGLQJ $ 3DFLíF +LJKZD\ 6W /HRQDUGV 16: All rights reserved. No part of this magazine may be reproduced, in whole or in part, without the prior permission of the publisher. Printed by SOS Print + Media, distributed in Australia by Gordon & Gotch. ISSN 0313-220x. The publisher will not accept responsibility or any liability for the correctness of information or opinions expressed in the publication. All material submitted is at the owner’s risk and, while every care will be taken nextmedia does not accept liability for loss or damage. Privacy Policy We value the integrity of your personal information. If you provide personal information through your participation in any competitions, surveys or offers featured in this issue of Art Almanac, this will be used to provide the products or services that you have requested and to improve the content of our magazines. Your details may be provided to third parties who assist us in this purpose. In the event of organisations providing prizes or offers to our readers, we may pass your details on to them. From time to time, we may use the information you provide us to inform you of other products, services and events our company has to offer. We may also give your information to other organisations which may use it to inform you about their products, services and events, unless you tell us not to do so. You are welcome to access WKH LQIRUPDWLRQ WKDW ZH KROG DERXW \RX E\ JHWWLQJ LQ WRXFK ZLWK RXU SULYDF\ RIíFHU ZKR FDQ EH FRQWDFWHG DW nextmedia, Locked Bag 5555, St Leonards, NSW 1590.

186 Artist Index